Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.195.703ON57257230650.0
YIL150C (MCM10)5.703ON57157226960.0
Suva_9.385.703ON56957226390.0
Skud_9.185.703ON57157225150.0
NCAS0G002205.703ON59257815910.0
KAFR0D022105.703ON58459014990.0
TDEL0B021705.703ON56757714820.0
KNAG0L021505.703ON61661614290.0
CAGL0H06589g5.703ON58359614030.0
NDAI0F002805.703ON61061214040.0
ZYRO0G06578g5.703ON56957813880.0
Kpol_1043.715.703ON58558513870.0
TPHA0E002105.703ON54455413441e-180
TBLA0G010205.703ON59460112881e-171
KLTH0E01034g5.703ON58356211971e-158
SAKL0E14938g5.703ON57459211801e-155
Kwal_55.196915.703ON46647210851e-142
AFR287W5.703ON6116159601e-122
KLLA0A00572g5.703ON5775858971e-113
KAFR0A074102.91ON35383790.40
ZYRO0B05786g3.124ON2994133800.48
Skud_4.3308.200ON402172751.6
Kpol_1055.894.236ON75355715.1
KLLA0F24024g2.153ON12261658.3
SAKL0B09504g7.102ON65786699.3
ZYRO0A11132gsingletonON69865699.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.19
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...  1185   0.0  
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...  1043   0.0  
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...  1021   0.0  
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   973   0.0  
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   617   0.0  
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   582   0.0  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   575   0.0  
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   555   0.0  
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   545   0.0  
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   545   0.0  
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   539   0.0  
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   538   0.0  
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   522   e-180
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   500   e-171
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   465   e-158
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   459   e-155
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   422   e-142
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   374   e-122
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   350   e-113
KAFR0A07410 Chr1 (1496247..1497308) [1062 bp, 353 aa] {ON} Anc_2...    35   0.40 
ZYRO0B05786g Chr2 complement(457353..466337) [8985 bp, 2994 aa] ...    35   0.48 
Skud_4.330 Chr4 (573869..575077) [1209 bp, 402 aa] {ON} YDR076W ...    33   1.6  
Kpol_1055.89 s1055 (228896..231154) [2259 bp, 753 aa] {ON} (2288...    32   5.1  
KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} simil...    30   8.3  
SAKL0B09504g Chr2 complement(803571..805544) [1974 bp, 657 aa] {...    31   9.3  
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    31   9.5  

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score = 1185 bits (3065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/572 (100%), Positives = 572/572 (100%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120
           IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA
Sbjct: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120

Query: 121 KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 180
           KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH
Sbjct: 121 KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 180

Query: 181 EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240
           EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 181 EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 241 TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300
           TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 241 TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 301 GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360
           GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301 GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 361 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 420
           KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 361 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 421 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 480
           LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI
Sbjct: 421 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 480

Query: 481 QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 540
           QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK
Sbjct: 481 QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 541 RNHREEVWQRHFGPKGEAEEASDASASDLEII 572
           RNHREEVWQRHFGPKGEAEEASDASASDLEII
Sbjct: 541 RNHREEVWQRHFGPKGEAEEASDASASDLEII 572

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score = 1043 bits (2696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/572 (87%), Positives = 534/572 (93%), Gaps = 1/572 (0%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           M+DPREILAVDPYN++TSDEEDEQAIA+ELEFMERKRQAL+ERLKRKQ FKKP DPNFEA
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120
           IEVPQSPTK+RVK GS NA +Q T+ E SN NE  LSQ+Q+QP+ P +TTTYFM+KFQNA
Sbjct: 61  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120

Query: 121 KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 180
           KK+ED+QIAKFESMM+ARVHTF TD KKY PII NELE FSNLWVKKRYIPEDDLKR+LH
Sbjct: 121 KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 180

Query: 181 EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240
           EIKILRLGKLFAK+RPPKFQ PEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 181 EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 241 TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300
           TLDVYIFGKKGVERYYNLRLGD+IAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 241 TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 301 GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360
           GSSRDLGWCPIVN KTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301 GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 361 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 420
           KV+SQPSLYKAKGEN FNII+  RK LSEEEER+KKSSHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 361 KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 421 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 480
           LANLDNKRRKI +TKKS AL+REL KIMRR+ESSGLEDKS GE+QKMK+TTE+ALQTGLI
Sbjct: 421 LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 480

Query: 481 QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 540
           QRLGFDPTHG+IS+VLKSSV G E KNNLL  KKTVINDLLHYKKEKVILAPSKNEWFKK
Sbjct: 481 QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 541 RNHREEVWQRHFGPKGEAEEASDASASDLEII 572
           R+HREEVWQ+HFG K E +E SD SASDLEII
Sbjct: 541 RSHREEVWQKHFGSK-ETKETSDGSASDLEII 571

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score = 1021 bits (2639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/572 (85%), Positives = 528/572 (92%), Gaps = 3/572 (0%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           MDDPREILAVDPYN+VTSDEEDEQAIAKELEFMERK+QALMERLKRKQ FKKP DPNFEA
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120
           +EVPQSP K  +   SQ+A+KQ  R   SN NES LSQ Q Q E P NTTTYFMQKFQ+A
Sbjct: 61  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQ-QSQ-ESPSNTTTYFMQKFQDA 118

Query: 121 KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 180
           K++ED+QIAK+E MM+ARVHTFGTDNK+YKPII NELE FSNLWVKKRYIPE+DLKR+LH
Sbjct: 119 KRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALH 178

Query: 181 EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240
           EIKILRL KLFAK+RPPKFQ P+YANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH
Sbjct: 179 EIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 238

Query: 241 TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300
           +LDVYIFGKKGVERYYNLRLGD+IAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI
Sbjct: 239 SLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 298

Query: 301 GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360
           GSSRDLGWCPIVN KTHK CGSPIN ++H CCDYHREVQFRGT AKRIELNGGYALGAPT
Sbjct: 299 GSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPT 358

Query: 361 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 420
           KV+SQPSLY+AKGEN+FNI+R  RKGLSEEEER+K++SHNFTNSNSAKAFFDEKFQNPDM
Sbjct: 359 KVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDM 418

Query: 421 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 480
           LANLD+KRRKI DTKKS AL+REL KIMRRK+SSGLEDKS+GEKQKMKQTTE+ALQTGLI
Sbjct: 419 LANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLI 478

Query: 481 QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 540
           QRLGFDPTHG+ISKVLKSSVPGGES  N +NGKKTVINDLL YKKEKVILAPSKNEWFKK
Sbjct: 479 QRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKK 538

Query: 541 RNHREEVWQRHFGPKGEAEEASDASASDLEII 572
           R+HREEVWQRHFG K E E ASDAS SDLEI+
Sbjct: 539 RSHREEVWQRHFGSK-ETEVASDASGSDLEIV 569

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/572 (80%), Positives = 517/572 (90%), Gaps = 1/572 (0%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           MDDPRE L  DPYN+VTSDE+DEQ IAKELEFMERK+QAL+ERLKRKQ FK+  DPNFEA
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120
           IEVPQSP K+R    SQN +K+  R   SN N+  LSQ+Q++ ELP NTT YFMQKFQNA
Sbjct: 61  IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDLKLSQLQQKQELPSNTTGYFMQKFQNA 120

Query: 121 KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 180
           K++E++Q AK+E+MM+ARVHTFGTD K+Y+  IANELE FSN+WVKKRYIPEDDLKR+LH
Sbjct: 121 KRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEEFSNIWVKKRYIPEDDLKRALH 180

Query: 181 EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240
           EIKILRLGKLFAK+RPPKFQ P+YANWA VGLISHKSD+KFTSS+KP KFFMFTITDFQH
Sbjct: 181 EIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDFQH 240

Query: 241 TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300
           TLDVYIFGKK VERYYNLRLGD+IAILNPEVLPWRPSG+GNFIKSFNLRISHDFKCILEI
Sbjct: 241 TLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCILEI 300

Query: 301 GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360
           GSSRDLGWCPIVN K ++ CGSPINI+LHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301 GSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 361 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 420
           KV++QP+LY+AKGEN FN++R  RK LSEEEERMKK+SHNF NSNSAKAFFDEKFQNPDM
Sbjct: 361 KVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDM 420

Query: 421 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 480
           LANLD+KRRKI D+KKS AL+REL KIMRRK SSGLEDK D EKQK+KQTTE+ALQTGL+
Sbjct: 421 LANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLL 480

Query: 481 QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 540
           QRLGFDPTHG+ISKVLKSSVPGGE +N ++ GKKTVI+DLL+YKKEKVILAPSKNEWFKK
Sbjct: 481 QRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKK 540

Query: 541 RNHREEVWQRHFGPKGEAEEASDASASDLEII 572
           R+HREEVWQ+HFG K + +E SDAS SDLEI+
Sbjct: 541 RSHREEVWQKHFGSK-DTDEVSDASTSDLEIV 571

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/578 (54%), Positives = 423/578 (73%), Gaps = 15/578 (2%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           M+DPRE+L  DPY++V+SDE+DE+AI ++LE +ERKRQ L+ R+K KQ  KK  DPNF+ 
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120
           ++VP SP K    +      K    +E  + N + L   +K  +LP NTTTYFM+KFQ +
Sbjct: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQLPSNTTTYFMEKFQKS 120

Query: 121 KKDEDRQIAKFESMMDARVHTFGTDNKK--YKPIIANELEGFSNLWVKKRYIPEDDLKRS 178
           KK+E+ +I K E+MM+ARVHTF     K  +KPI  NE+E +SN+W+KKRYIP+ +L++ 
Sbjct: 121 KKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELRKM 180

Query: 179 LHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 238
           LH IKILRL KLFAKVRPPKF  P+Y+NWA +G+IS K D KFT+++KP K+  FT+TDF
Sbjct: 181 LHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMTDF 240

Query: 239 QHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 298
           QH LDVYIFGK GVERYYNLR+GD+IAILNPEV PWRPSG+G FIKSFNLRI+HDFKCIL
Sbjct: 241 QHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFKCIL 300

Query: 299 EIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGA 358
           EIGSS+DLG+C  V ++    C +PIN+S    CDYH+E++FR  ++KRIELNG +ALGA
Sbjct: 301 EIGSSKDLGFCK-VTSRNGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFALGA 359

Query: 359 PTKVNSQPSLYKAK-GE------NRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFF 411
           PTKV + P+LY+ K GE      NR N    A  G   +++   ++ H F+N+NSAKAFF
Sbjct: 360 PTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNRH-FSNNNSAKAFF 418

Query: 412 DEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTT 471
           DEKFQNPDML NL++KRRKI D KK   +++EL+K +  + S  L ++S  E ++MK+ T
Sbjct: 419 DEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQMKRAT 478

Query: 472 ENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNL---LNGKKTVINDLLHYKKEKV 528
           E  LQ+G+IQRLGFDPTHG+I+ VL+++    E K+ L   ++GKK  +NDLLH++K  V
Sbjct: 479 ETTLQSGVIQRLGFDPTHGKIANVLRTT-HSKEEKDTLSEQMSGKKDKVNDLLHFRKSHV 537

Query: 529 ILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEASDASA 566
           ILAP++NE  ++R+ RE +WQ +FG K +   A+D  A
Sbjct: 538 ILAPTRNELIERRDRRERIWQENFGQKRKPISANDLLA 575

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/590 (51%), Positives = 412/590 (69%), Gaps = 24/590 (4%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           M DPREI   D Y ++T D+ED + I  ELE +E  ++ L+ERL RK+   +  DPNF  
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 61  IEVPQSPTKS---RVKSGSQNAVKQVTRLETSNANESNLS---QIQKQPELPIN----TT 110
           ++VP SP K    ++       +K + R E SN N + L    + QKQ    +N    +T
Sbjct: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTAR-LNDSNAST 119

Query: 111 TYFMQKFQNAKKDEDRQIAKFESMMDARVHTF-GTDNK-KYKPIIANELEGFSNLWVKKR 168
            YFM+KF++AK+ E   I K ESMM +RVHTF G + K +Y+ +I +ELE +SNLW+ KR
Sbjct: 120 EYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKR 179

Query: 169 YIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPV 228
           Y P  +LK  LHE+KILRL KLFAKVRPPKF+ P+Y+NW  VG++S KSDIKFT+S KP 
Sbjct: 180 YTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQ 239

Query: 229 KFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNL 288
           K+  FT+TDF+H +D YIFGK+GVERYYNLR+GDIIA+LNPE+LPWRPSG+ N+IKSFNL
Sbjct: 240 KYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNL 299

Query: 289 RISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRI 348
           RISH +KCILEIG SRDL  CPIV   T K+CG PIN  + +CC+YHRE++ R   +KR+
Sbjct: 300 RISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRL 359

Query: 349 ELNGGYALGAPTKVNSQPSLYKA------KGENRFNIIRDARKGLSEEEERMKKSSHNFT 402
           +L+G YALGAPTK+ SQP+LY+       K +N F +     +      ++  + S  F+
Sbjct: 360 DLSGQYALGAPTKLESQPALYRGHTAQNVKIQN-FKLTPSYSQNNPHLIDKYGEKSKFFS 418

Query: 403 NSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDG 462
           N N+AKAFFD++FQNPDM++NLDNKRRKI + +KS  LNREL +++R+ +   LE K+  
Sbjct: 419 NRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQD--LEGKTRE 476

Query: 463 EKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLH 522
           E +KMKQTT+  LQ+GL Q++GFDPT G+IS++LK+     + +   L+ K   ++DL+ 
Sbjct: 477 EVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVDDLMA 536

Query: 523 YKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEASDASASDLEII 572
           +KKE +ILAPSK +   K+N RE+VWQ +FG + ++ + S+ S SDLEI+
Sbjct: 537 FKKEYIILAPSKVDLLNKKNKREKVWQENFG-QNKSNDNSE-SDSDLEIV 584

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/577 (50%), Positives = 405/577 (70%), Gaps = 15/577 (2%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           M+DPRE++  DP+  +TSDEED++ +  ++  +ER+++ L+ERLK K+  K   DPNF+A
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKS-KDPNFDA 59

Query: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120
           I+V  SP K   +S      +    L+  N NE    +++ + ++P NTT+YF+  F+N+
Sbjct: 60  IQVESSPVKKPAESIKVEPSRTKRVLDIENLNEK---KVESRSQIPANTTSYFIDNFRNS 116

Query: 121 KKDEDRQIAKFESMMDARVHTF-GTD-NKKYKPIIANELEGFSNLWVKKRYIPEDDLKRS 178
           KK+E +   + + ++  RVHTF G D N K+K +   E+E +S+LWVK+RYI +DDL++ 
Sbjct: 117 KKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLRKV 176

Query: 179 LHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 238
           LHE+KILRL KLFAK++PPKF  P+Y+NWA +G+IS K  +KF+SS KP+K+F FT+TDF
Sbjct: 177 LHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLTDF 236

Query: 239 QHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 298
           Q+ LDVY+FGKKGVERYYNLR+GDI+AILNPEVLPWRPS +GNFIKSFNLRISHDF CIL
Sbjct: 237 QYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPCIL 296

Query: 299 EIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGA 358
           EIG SRD+ WC   N   +K CG+PIN +  KCCD+HRE+QFR   AKRIELNG +ALGA
Sbjct: 297 EIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFALGA 356

Query: 359 PTKVNSQPSLYKAK--GENR-FNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKF 415
           PTKV+S P+LY+ K  G +R F ++ +  +    +   ++    +F+N N+AKAFF+++F
Sbjct: 357 PTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLR--GIHFSNGNAAKAFFNDEF 414

Query: 416 QNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENAL 475
           QNPD+L NLD+KRRK  D KKS  L ++L +I  R  +  +E K   + +++ +TTE  L
Sbjct: 415 QNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTEATL 473

Query: 476 QTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKN 535
           Q+GLIQ LGFDPTHGEI  VLK +    +S N  LN K+  ++ LL +KKE V L P+K 
Sbjct: 474 QSGLIQNLGFDPTHGEIGNVLKQAAK-DKSNNGQLNKKQKEVSSLLKFKKEHVELKPAKE 532

Query: 536 EWFKKRNHREEVWQRHFGPKGEAEEASDASASDLEII 572
              +++  RE  WQ +FG K  +   S  S SD+EI+
Sbjct: 533 VLLQRKRDRERAWQENFGDK--SVNLSSDSDSDIEIV 567

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/616 (46%), Positives = 414/616 (67%), Gaps = 49/616 (7%)

Query: 3   DPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA-I 61
           DPR+++  DPY+++TSDE++E  I +ELE MER+++ L +RLK K+A  KP D N +  +
Sbjct: 4   DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 62  EVPQSPTK--------SRVKSGSQNAVKQ------VTRLETSNANESNLSQIQ-KQPELP 106
           +VP SP K        +R +     A+K+      +   +  N NE+  +Q+     +  
Sbjct: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123

Query: 107 IN-TTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWV 165
           +N TT+YF++KFQ +KK E  +I   E+M+ ARVHTF   +K+++    NELE FS+LW+
Sbjct: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQFSDLWI 183

Query: 166 KKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSE 225
            KRYIP+  L+ SL ++K+LRL KLFAKVRPPKFQ P+Y+NWA + +IS KS++KFT+S+
Sbjct: 184 SKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSK 243

Query: 226 KPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSG---RGNF 282
            P KF  FT+T+FQ  LD+++FG  GV+RYYNLR GDI+A+LNPE+LPWRPSG   +   
Sbjct: 244 NPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQTTS 303

Query: 283 IKSFNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRG 342
           IKSFNL+I+H FKCILEIG SRDLG+CP+    +++KCGS IN++  + C+YHRE+Q R 
Sbjct: 304 IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQMRQ 363

Query: 343 TSAKRIELNGGYALGAPTKVNSQPSLYKAKGENRF-----NIIRDARK------------ 385
            S+KR++LNGG+ALGAPTKV +QP L++ +   RF     ++ RD  K            
Sbjct: 364 NSSKRLDLNGGFALGAPTKVGTQPDLFR-EASGRFKQSARSLPRDQGKRFYTEPSWNSRH 422

Query: 386 ---GLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNR 442
              G SEE   +K     FT+SN+AKAFFD++FQNPDML NLD KRRK+ D+KKS+ L+R
Sbjct: 423 GQGGSSEENYGLK--GKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDR 480

Query: 443 ELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLK---SS 499
           +L +++ + E     DK+  E   +K+TTE AL TGLIQRLGFDPTHG  + V+K   S 
Sbjct: 481 KLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSE 540

Query: 500 VPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKG--- 556
              G +++  L+ K+ ++N+LL +K++K  L PS+ +   ++ HR EVW+  FG KG   
Sbjct: 541 RGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGTPV 600

Query: 557 EAEEASDASASDLEII 572
           +++   +  + DLEI+
Sbjct: 601 DSQPVDNDDSDDLEIV 616

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/596 (48%), Positives = 408/596 (68%), Gaps = 44/596 (7%)

Query: 2   DDPREILAVDPYNSVTSDE-EDEQAIAKELEFMERKRQALMERLK--RKQAFKKPNDPNF 58
           +DPRE+  +DPY  ++ D+ E E  I +ELE +ERK+Q L+ RLK  +++   K  DPN 
Sbjct: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 59  EAI------EVPQSPTKSRV--KSGSQNAVKQVTRLETSNANESNLSQ---IQKQPELPI 107
           + I      EVP+SP +  +  +   Q+ V QVT  + +N  ++N ++   ++K+ ++ +
Sbjct: 67  KNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAANNKKANPNEEDIVRKELDV-V 125

Query: 108 NTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTF--GTDNKKYKPIIANELEGFSNLWV 165
            TT+YF  KF+N+K DE+R +  ++ MM AR HTF   T     K I  +ELE +SN  +
Sbjct: 126 ATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYSNFHI 185

Query: 166 KKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSE 225
           KKRYIP+D++ + LH IKILRL KLFAKVRPP F  P+Y+NW  +G IS K D+K T++ 
Sbjct: 186 KKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKLTNAA 245

Query: 226 KPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKS 285
           KPVK+F FT+TDF+H LDVY+FGKK VERYYNLR+GDIIA+LNPE+LPWRPSG  N IKS
Sbjct: 246 KPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVNGIKS 305

Query: 286 FNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSA 345
           FNLRI HDF CILEIG+SRDLGWC +VN    K C SPIN    +CC++HRE+Q R T++
Sbjct: 306 FNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMRSTAS 365

Query: 346 KRIELNGGYALGAPTKVNSQPSLYKAKGENR---------FNIIRDARKGLSEEEERMKK 396
           KRIEL+G YALGAPTKV +QPS+YK   ++R         F+I     K   +E+E+ + 
Sbjct: 366 KRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSKK-EQEKEKHEI 424

Query: 397 SSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGL 456
            +H+F+N  +AKAFFD+ FQ+P +LANL++KRRKI    K+  ++R L K +  +++S  
Sbjct: 425 EAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKI----KASKMDRNLLKALNGEDASQS 480

Query: 457 EDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTV 516
           ++     KQ++K+ TE  LQTG+IQRLGFDP+ G+I+KVL  S  G ++ +  ++ K  +
Sbjct: 481 KN-----KQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSR-GTKTDDPTISKKMGL 534

Query: 517 INDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEASDASASDLEII 572
           INDL+H+KK+K+ L PS+    +KR+ RE +W++HF       + ++ S SDLEI+
Sbjct: 535 INDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF-------QDTNDSDSDLEIV 583

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/612 (48%), Positives = 404/612 (66%), Gaps = 42/612 (6%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           M+DPRE    DP+  ++  EE+E A+ +ELE ++R++  L+ RLK  +  +K  DPNF+ 
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 61  IEVPQSPTK--SRVKSGSQNAVKQVTRLETS------------NANESNLSQIQKQPE-L 105
           +++P +P +  + + +  Q  ++   R E              N NE  + + ++  E L
Sbjct: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKL 120

Query: 106 PINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDNK-------KYKPIIANELE 158
           P NTT+YFM+KFQ+ KK E+ +  + E M+ ARVH F   NK       +Y+P  ANE+E
Sbjct: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 159 GFSNLWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSD 218
            +S L ++KRYIP+ +L      IKILRL KLFAKVRPPKF+ P+Y+NW T+G+I+ K  
Sbjct: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 219 IKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSG 278
           IKFTSS+KP K+F FTI+DF++ +D++IF K  VERYYNLR+GDIIAILNPEVLPWRPS 
Sbjct: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300

Query: 279 --RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVN-TKTHKKCGSPINISLHKCCDYH 335
              G  IKSFNLRI+H++ CI+E+G S+DLG+CPI N       C +PI+IS    C YH
Sbjct: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360

Query: 336 REVQFRGTSAKRIELNGGYALGAPTKVNSQPSLYK-----AKG---ENRFNIIRDARKGL 387
           +E++FR   +KRIELNG +ALGAP KV +QP LY+      +G    NRFN+++ +    
Sbjct: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420

Query: 388 SEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKI 447
           +E +   ++    F+++NSAKAFFDEKFQNPDML NLD KRRKI D K+S  L++EL+K 
Sbjct: 421 NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA 480

Query: 448 MRRKESSGLE-DKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESK 506
           +  K S+ L  +K+  E  KMK  TE  LQTG+IQRLGFDPTHG+I+KVL++    G  K
Sbjct: 481 IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSG--K 538

Query: 507 NNLLNGKKTV-INDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEAS--- 562
           +N+ N  K   + DLL +KK KV+LAP+K E  K++N REEVWQ+HFG      E     
Sbjct: 539 DNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLND 598

Query: 563 --DASASDLEII 572
             D S SDLEI+
Sbjct: 599 DVDTSESDLEIV 610

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/578 (48%), Positives = 391/578 (67%), Gaps = 16/578 (2%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           M DPRE+L  D Y+ +TS+ E+E  I  ++  +ER+++ L++RL  K+   KP DPN   
Sbjct: 1   MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120
           I+V  SP K           +Q  R E  N N + L + Q Q ++P NTT++F++K+  +
Sbjct: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNEL-KAQSQEQIPANTTSFFIEKYSTS 119

Query: 121 KKDEDRQIAKFESMMDARVHTFGTDNKK--YKPIIANELEGFSNLWVKKRYIPEDDLKRS 178
           K+ +D ++   E ++  RVHTF    ++  YKPI  NELE FSNLW+ KRYIP+++ +  
Sbjct: 120 KRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSI 179

Query: 179 LHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 238
              IKILRL KLFAKV+PPKF  P Y+NWA +GLIS+K ++KFTS+  P K+F FT+T+F
Sbjct: 180 FANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNF 239

Query: 239 QHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCIL 298
           Q+++D YIFGK+GVERYYNLR+GDIIAILNP+VLPWRPSG    IKSFNLRISH F+CIL
Sbjct: 240 QYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECIL 299

Query: 299 EIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGA 358
           EIG+SRDLGWCP+ N   ++ C +PIN     CC+YHRE++FR T+AKR+EL+G YALGA
Sbjct: 300 EIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGA 359

Query: 359 PTKVNSQPSLYKAKGENR---FNIIRDARKGLSEEE-ERMKKSSHNFTNSNSAKAFFDEK 414
           PT++++QP+LY+     +   +NII +   G S +E   +  ++ +F+N N+AKAFFDE+
Sbjct: 360 PTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFDER 419

Query: 415 FQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENA 474
           FQNP+ L NL+NKRRK+ D +KS  LNREL K         ++ KS  E  ++K+TTE+ 
Sbjct: 420 FQNPETLRNLENKRRKLRDNRKSNILNRELKK----NSELDIKHKSAEEIDEIKRTTEST 475

Query: 475 LQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSK 534
           + +G+++ LGFDPT G+I+ V K      + K   L  K + +  LL +KK+ V L PSK
Sbjct: 476 MGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKP--LTEKDSSVASLLSFKKDNVKLKPSK 533

Query: 535 NEWFKKRNHREEVWQRHFGPKGEAEEASDASASDLEII 572
               K++  RE VW+ HFG  G+ ++ SD   SDLEI+
Sbjct: 534 EILIKQKRRRERVWKEHFGSGGDEKDDSD---SDLEIV 568

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/585 (48%), Positives = 397/585 (67%), Gaps = 25/585 (4%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           M+DPRE    D Y++++SDE ++  I+++L+ +ER++Q L+ERLK+K+  K   DPNF  
Sbjct: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120
           ++VP SP KSRV      + K +   E       N   +  + +    TT+YFM+KF N+
Sbjct: 59  VQVPSSPKKSRVVELKPTS-KPIDNNEEEEEENPNEVALMTKDDSNYGTTSYFMEKFYNS 117

Query: 121 KKDEDRQIAKFESMMDARVHTF-GTDNKK-YKPIIANELEGFSNLWVKKRYIPEDDLKRS 178
           KKD +R++  + SMM +RVHTF GT +KK +KP   +EL+ +SNLW++ RYIP D+L   
Sbjct: 118 KKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNLM 177

Query: 179 LHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDF 238
           L +IKILRL KLFAKVRPPKF  P+Y+NW   G+I+ K DIK+TSS KP K+F FTI+DF
Sbjct: 178 LLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISDF 237

Query: 239 QHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPS----GRGNFIKSFNLRISHDF 294
           QH LDV+IFG KGVE+YYNLR+GD++AILNPE+LPWRPS    G G+ IKSFNLRISH F
Sbjct: 238 QHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSFNLRISHKF 297

Query: 295 KCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGY 354
            CILEIG+SRDLGWCPI N   +  C +PIN S    C YHRE+QFR T++ R+EL+G Y
Sbjct: 298 DCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELSGTY 357

Query: 355 ALGAPTKVNSQPSLYKAKG-------ENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSA 407
           ALGAPTKV+++P+LY+ +G       +  +N++ D+     ++  +++   H+F+  NSA
Sbjct: 358 ALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTMNSA 417

Query: 408 KAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKM 467
           KAFFDE FQNPD+L NLD+KRRKI D+K    + R L K ++        DK     + +
Sbjct: 418 KAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNLVKALK-----NTVDKESKNFKNL 468

Query: 468 KQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEK 527
           K  T+  LQTG++QRLGFDPT G++S V+++S    E  N     KK  ++DL+ ++K+ 
Sbjct: 469 KNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFRKDT 528

Query: 528 VILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEASDASASDLEII 572
           V L PSK++  K+R  R+  W++ FG +  + + +D S SDL+I+
Sbjct: 529 VNLKPSKDDLIKRRIDRQRNWKKLFGKQQSSIDNNDDSGSDLKIL 573

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  522 bits (1344), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 274/554 (49%), Positives = 362/554 (65%), Gaps = 32/554 (5%)

Query: 41  MERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGSQ-NAVKQVTRLETSNANESNLSQI 99
           M+RLK K+  +K  DPNF  I++ +SP K +    +  N +     +E  N NE+   ++
Sbjct: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDVNPNEA---KV 57

Query: 100 QKQPELPINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDN--KKYKPIIANEL 157
                LP NTT+YFMQ F  AKK+E +Q+ +++  M +RVH+F   N  KKY+ II  EL
Sbjct: 58  VSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEEL 117

Query: 158 EGFSNLWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKS 217
           E +S   + KRY+P++++ + LH IKILRL KLFAK+RPPKF  P+YANWA  G+I  K 
Sbjct: 118 EEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKE 177

Query: 218 DIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPS 277
           DIK TSS+ PVKFF FTIT+FQHTLD++IFG  GVE+YYNLR+GDII ILNPEVLPWRP 
Sbjct: 178 DIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPE 237

Query: 278 GRGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHRE 337
            +GN IKSFNLRISH F CILEI  S+D+ WC  +N KT  KC +PIN S    CDYH+E
Sbjct: 238 FKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCDYHKE 297

Query: 338 VQFRGTSAKRIELNGGYALGAPTKVNSQPSLYKAKGE------NRFNIIRDARKGLSEEE 391
           +QFR  +AKR+EL+G YALGAPT+++S+P+LY++K        N FNI+ D R    +E 
Sbjct: 298 MQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMKKKEN 357

Query: 392 ERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRK 451
           + +    H+F++SNSAKAFFDE FQNPDML NL+NKRRKI D K+   L R L      +
Sbjct: 358 DPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRAL------R 411

Query: 452 ESSG-----LEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESK 506
           ES G     L+DKS+ E Q M+ TT+  LQ G IQ+LGFDPT G+I  VL+ S     ++
Sbjct: 412 ESVGNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSA-DKSTQ 470

Query: 507 NNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEASDASA 566
           + L   K   + +L+ +KK  V L PS+    +K +HRE+ + ++      AE     SA
Sbjct: 471 SKLQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRKSA 530

Query: 567 S--------DLEII 572
           S        DLEII
Sbjct: 531 STKNDTDSDDLEII 544

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  500 bits (1288), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 259/601 (43%), Positives = 388/601 (64%), Gaps = 36/601 (5%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           M+DPRE+   D +++++ DE++E  + K++E +ER+++ L ERL+ K+   +  DPNF +
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 61  ------------IEVPQSPTKSRVKSGSQNAVKQVTRLETS---NANESNLSQIQKQPEL 105
                       I+VP SP K + K  +Q A   VT+  T    N NE  L    +   +
Sbjct: 61  TEGNVDATSESRIQVPGSPEKIKRKH-TQLAATPVTKKNTGIQDNPNELKLKNQIEPASV 119

Query: 106 PINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFG--TDNKKYKPII-ANELEGFSN 162
           P  +T YFM  F ++KK E ++I  +E++M ARVH+FG  T+ +K   II   E E +S 
Sbjct: 120 PAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSG 179

Query: 163 LWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFT 222
           LW+ +RY+ E+ + + L +IKILRL KLFAK+RPPKF++P+Y+NW  VG+I+ KS  K T
Sbjct: 180 LWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLT 239

Query: 223 SSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNF 282
           SS  P K+F FTI DFQ  + +++F ++ + +YYNLR+GDII ILNP + PWRPS    +
Sbjct: 240 SSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGY 299

Query: 283 IKSFNLRISHDFKCILEIGSSRDLGWCPI-VNTKTHKKCGSPINISLHKCCDYHREVQFR 341
           IKSFNL I   + CI+EIG SRDLGWC + V +K  K CG+PIN +  KCC++HRE +FR
Sbjct: 300 IKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFR 359

Query: 342 GTSAKRIELNGGYALGAPTKVNSQPSLYKAK-----GENRFNIIRDARKGLSEEEERMKK 396
             +AKRIELNG +ALGAPTK ++ PSLYK K      +N+FN++R  R    E + ++  
Sbjct: 360 NAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVR-RRNARKEGDSKLHN 418

Query: 397 SSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKE--SS 454
           S  NF ++N AKAFF+++FQNPD+++NLD+KRRK+ D K+   L +EL K + +++  S 
Sbjct: 419 S--NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSK 476

Query: 455 GLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKK 514
            LE KS  + ++M+  TEN +Q G+++ +G+DPTHG++  ++K S     S     + + 
Sbjct: 477 NLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPS---YTSNRS 533

Query: 515 TVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKGEAEE---ASDASASDLEI 571
             +NDLLH+KK+KV L P K++   K+  R+E+W  +FG + ++      S    SDLEI
Sbjct: 534 NAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLEI 593

Query: 572 I 572
           +
Sbjct: 594 V 594

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  465 bits (1197), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 245/562 (43%), Positives = 366/562 (65%), Gaps = 22/562 (3%)

Query: 3   DPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEAIE 62
           DPRE+L +D ++ VTSDE+++  I ++L+ +ER+++ L +RL++K + KK    + E +E
Sbjct: 6   DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERVE 65

Query: 63  VPQSPT---KSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQN 119
           VP SP    KS+    SQ + K +T    +N+N  ++    K    P NTT+YF++ F N
Sbjct: 66  VPASPKEERKSKASPQSQKSSKGITL--AANSNNDSIEVPWKNG--PSNTTSYFVENFVN 121

Query: 120 AKKDEDRQIAKFESMMDARVHTF-GTDN-KKYKPIIANELEGFSNLWVKKRYIPEDDLKR 177
           A+K E+++I    S++  RVHTF G D+ K  +P+  +E E +S   + +RY+   +L  
Sbjct: 122 ARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDE 181

Query: 178 SLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITD 237
            + EIK+LRL KLF+KVRPPKF  P+YANW  +G+IS KS++K TSS KP K+F  T+TD
Sbjct: 182 IMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTD 241

Query: 238 FQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSG------RGNFIKSFNLRIS 291
           F H LD+YIF  K VE+YYNLR+GDIIAILNP++LPWRPS        G  +KSFNL I 
Sbjct: 242 FTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIR 301

Query: 292 HDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELN 351
           H+F C+LEIG+S+DLG+C I N  T K CG+PIN +    C+YH++V+FR  +A+R+ELN
Sbjct: 302 HNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELN 361

Query: 352 GGYALGAPTKVNSQPSLYKAKGENR-FNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAF 410
           G  +L +P K   + +LY   G  R   ++ D     +++ E   +++  F+N N AKAF
Sbjct: 362 GSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQAQDGE--SQNTLFFSNPNYAKAF 419

Query: 411 FDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQT 470
           FD+ +QNPDML NL+NKRRK+ D++K + L  +L   + +       +KS  E+++MK  
Sbjct: 420 FDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDA 479

Query: 471 TENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVIL 530
           TE  L +GL++ +GFDP  G++ +VLK     G++ N+ LN K + + +++ +KK  V L
Sbjct: 480 TEQVLNSGLLRDIGFDPFRGKMREVLK----FGKNVNSGLNSKSSQVKEIMSFKKSNVSL 535

Query: 531 APSKNEWFKKRNHREEVWQRHF 552
           APSK E  K+   RE+VW+ HF
Sbjct: 536 APSKAEQKKRLLRREQVWREHF 557

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  459 bits (1180), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 251/592 (42%), Positives = 375/592 (63%), Gaps = 38/592 (6%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           M+DPRE   +D ++ ++ DE+D+  + K L+ +ER+++ L +RL+     KK  DPNF  
Sbjct: 1   MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 61  IEVPQSPTKSRVKSGSQNAVKQVTR----LETSNANESNLS--QIQKQPELPINTTTYFM 114
           +EVP+SP+KS+       AVK+ +R     E+      NL+  Q+QK+  L   +T YF 
Sbjct: 59  VEVPRSPSKSK-----HVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFA 113

Query: 115 QKFQNAKKDEDRQIAKFESMMDARVHTF-GTD-NKKYKPIIANELEGFSNLWVKKRYIPE 172
           Q F ++KK ++ +  +   M++ RVHTF G D  ++Y PI  NE E FS  W+ KRYI  
Sbjct: 114 QNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITA 173

Query: 173 DDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFM 232
           +  ++ L E K+LRL KLFAKVRPP F  P+Y+NW T+G+IS KS +K T+  KP ++F 
Sbjct: 174 EQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFT 233

Query: 233 FTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPS------GRGNFIKSF 286
            T+TDF+HT+++Y+FG K VE+YYNL++GDIIA+LNPE+ PWRPS           IKSF
Sbjct: 234 LTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSF 293

Query: 287 NLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAK 346
           NL I H+F  ILEIG+SRD G+C I N    K CG+PIN S+   C YH+EVQFR  +AK
Sbjct: 294 NLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAK 353

Query: 347 RIELNGGYALGAPTKVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHN---FTN 403
           R+ELNG  +L +PTK   +  LY      +++++ D     ++      K S N   F+N
Sbjct: 354 RLELNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPDRYAPQTQS-----KDSQNVLYFSN 408

Query: 404 SNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGE 463
            N+A+AFFD+ +QNPD L NLD+KRRK+   KK K L ++L +++ +  S+  ++++  +
Sbjct: 409 PNAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTK 468

Query: 464 KQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHY 523
           + ++++ T+NAL++GLI+++GFDPT G +S VLK++  G + +      K + + ++L  
Sbjct: 469 QDEIRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQ-----AKNSAVEEILQI 523

Query: 524 KKEKVILAPSKNEWFKKRNHREEVWQRHFGPK---GEAEEASDASASDLEII 572
           KKEK+ L PSK    +K   REEVW  HF  +       E+SD   S+LEI+
Sbjct: 524 KKEKIELKPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGD-SELEIV 574

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  422 bits (1085), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 215/472 (45%), Positives = 305/472 (64%), Gaps = 19/472 (4%)

Query: 114 MQKFQNAKKDEDRQIAKFESMMDARVHTFG--TDNKKYKPIIANELEGFSNLWVKKRYIP 171
           M+ F N++K E+ +I     M+D+RVHTF      K  KPI   E E  S LWV +RYI 
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 172 EDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFF 231
            D+L   L +IKILRL KLF+KVRPPKF  P+YANW  VG++ HKS +K TSS KP K+F
Sbjct: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 232 MFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGN------FIKS 285
             TITDF H+LDVY+F    VE+YYNLR+GDIIAILN ++LPWRPS  GN       +KS
Sbjct: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 286 FNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSA 345
           FNL I  ++ C+LEIG+SRDLG+C I N    K CG+PIN +    CDYH+E++FR  +A
Sbjct: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 346 KRIELNGGYALGAPTKVNSQPSLYKAKGENR-FNIIRDARKGLSEEEERMKKSSHNFTNS 404
           +R+ELNG  +L +P K   + +LY + G  R  N++ D  K   ++++R  +++  F+N 
Sbjct: 241 QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPD--KHAPQQQDRESQNTLYFSNP 298

Query: 405 NSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEK 464
           N AKAFFD+ +QNPD+L NLD+KRRK+ DT+  + L  +L++ + +       +K+  E+
Sbjct: 299 NYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQEQ 358

Query: 465 QKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYK 524
           ++MKQ TE  + +GL++ +GFDPT G++  VLK     G++  N  + K   + +++  +
Sbjct: 359 KQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKV----GKNSKNSTDTKSIQVREIIETR 414

Query: 525 KEKVILAPSKNEWFKKRNHREEVWQRHF----GPKGEAEEASDASASDLEII 572
           K  V LAPSK +  K+   RE+VW+ HF     P    +  SD+S SDLEI+
Sbjct: 415 KTNVSLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  374 bits (960), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/615 (34%), Positives = 338/615 (54%), Gaps = 53/615 (8%)

Query: 1   MDDPREILAVDPYNSVTSDEED-----------------------EQAIAKELEFMERKR 37
           ++DPREI+    Y+ + SDEED                          +   L+ +E +R
Sbjct: 6   LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64

Query: 38  QALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLS 97
             L+ RL+  +   K        +EVP+SPTK++            +        E+   
Sbjct: 65  SDLLARLEELKHRSKKKAKKSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVEEPEENENE 124

Query: 98  QIQKQPELPINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDNK--KYKPIIAN 155
           +       P  TT+YF +KF  A+      + + + ++  RV+TF   +   +Y     +
Sbjct: 125 RYLLSANTP--TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVD 182

Query: 156 ELEGFSNLWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISH 215
           E+E +SN+ + KRY+PE+DLKR LH+IK+LRL KLFAKVRPPKF  P+YANW T+G IS+
Sbjct: 183 EVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISY 242

Query: 216 KSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWR 275
           KSD+K TS EKP K+F   ITDF + + + +FG+K VE+YY LR+GD+IAILNPE+ PW+
Sbjct: 243 KSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWK 302

Query: 276 PSGRG------NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLH 329
            S +          +SF L I H+  CILEIG S++LG+CP +N      CG+PIN    
Sbjct: 303 ESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKE 362

Query: 330 KCCDYHREVQFRGTSAKRIELNGGYALGAPTKVNSQPSLYKAKGEN--RFNIIRDARKGL 387
           + C YH+E   R  +AKR+ELNG  +L APT+   Q + Y  +  +  +  ++ D     
Sbjct: 363 QVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPR 422

Query: 388 SEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKI 447
           +   E  +K   +F ++N+ +A+FD  + NPD+L NL++KRRKI  +KK + +N++L+ +
Sbjct: 423 APGAE--QKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLV 480

Query: 448 MRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKN 507
           + +  +   +  S+   Q+ ++ T+N ++TG+++ +GFDPT G ++ VL     G     
Sbjct: 481 LGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPAD-- 538

Query: 508 NLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHF------GPKGEAEEA 561
                ++  I+++L  KK  + L PSK    K+   R EV+   F       P+G  E A
Sbjct: 539 ---TVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCETA 595

Query: 562 ----SDASASDLEII 572
               +D+S  +LEI+
Sbjct: 596 QLSSADSSDEELEIV 610

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  350 bits (897), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/585 (35%), Positives = 330/585 (56%), Gaps = 25/585 (4%)

Query: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60
           + DPREI A DPY  ++ DE + + + + +  ++ +++ L  RL   +  +   DPNF++
Sbjct: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLE-----TSNANESNLSQIQKQPELPINTTTYFMQ 115
           I+VP+SP KS   +     +K +  +      T N NE  + +  K+    + TT+YF +
Sbjct: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKK----LGTTSYFTE 120

Query: 116 KFQNAKKDEDRQIAKFESMMDARVHTFGTDN-KKYKPIIANELEGFSNLWVKKRYIPEDD 174
           K ++   +E   I + + ++  RV+TF  D   +Y+PI  +E +  S L + +RY+P   
Sbjct: 121 KLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAV 180

Query: 175 LKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFT 234
           L++    IK+LRL KLF+KVR PKF  P+Y NW  +G+IS K++ + T+S KPVKFF  T
Sbjct: 181 LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240

Query: 235 ITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWR--PSGRGNFIKSFNLRISH 292
           I+DFQ  L+V  FGK  VE+YY LRLGD+IAILNPE++P +   +G      +F+L++S 
Sbjct: 241 ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSK 300

Query: 293 DFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNG 352
           D   ILE+G S++ G C        K CG+PIN      C YH+E + R  S++R+E++ 
Sbjct: 301 DTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISS 360

Query: 353 GYALGAPTKVNSQPSLYKAKGENRFNIIR---DARKGLSEEEERMKKSSHNFTNSNSAKA 409
             A+ AP     Q ++ K++  N    IR   +  K    E    + +   F+++N++ A
Sbjct: 361 SVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTA 420

Query: 410 FFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQ 469
           FFD+ ++NPD+LANLDNKRRKI + +     NR L K ++      L  K D   Q+ K+
Sbjct: 421 FFDDDYENPDILANLDNKRRKIQELRN----NRNLEKKLKGLSDKLLSKKEDRVNQEAKK 476

Query: 470 T-TENALQTGLIQRLGFDPTHGEIS-KVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEK 527
           T T +  Q GL  ++G+DPT G+ S ++L+ S      KN+    K+  I D+ + KK+ 
Sbjct: 477 TATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKND----KQLAITDICNIKKDN 532

Query: 528 VILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEASDASASDLEII 572
           V L PSK +  +K   R  ++        E  +  + S+ DLEII
Sbjct: 533 VSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577

>KAFR0A07410 Chr1 (1496247..1497308) [1062 bp, 353 aa] {ON} Anc_2.91
           YNL164C
          Length = 353

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 18/83 (21%)

Query: 397 SSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGL 456
           S++   +S SA AFFDE+F +P++                   +N E A+I+   ES  +
Sbjct: 106 SANILIDSKSAGAFFDEEFPDPEL------------------HINGEEAEIIFDYESHDM 147

Query: 457 EDKSDGEKQKMKQTTENALQTGL 479
           ED ++G  +K+ +  E+ L  G 
Sbjct: 148 EDPTEGIGRKISEMIESVLPGGF 170

>ZYRO0B05786g Chr2 complement(457353..466337) [8985 bp, 2994 aa] {ON}
            similar to uniprot|P18963 Saccharomyces cerevisiae
            YBR140c IRA1 or uniprot|P19158 Saccharomyces cerevisiae
            YOL081w IRA2
          Length = 2994

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 57/133 (42%), Gaps = 20/133 (15%)

Query: 85   RLETSNANESNLSQIQKQ-----PELPINTTTYFMQKFQNAKKDEDRQIAKFES------ 133
            R  T + N + L Q +++     P+  I++   + Q ++   +   R IA F++      
Sbjct: 1890 RFLTIDENMAILGQPREELRNEIPQCIIDSKEEYPQLYEFMSRHAFRSIAVFDTTNTFVH 1949

Query: 134  ---------MMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLHEIKI 184
                     ++     +F + N + + II    + ++ +W  K Y+  D      HEI +
Sbjct: 1950 ESMSSDGLPIITLTFSSFRSKNIEIETIIYRTFQIYARIWSVKYYLVLDCTHFDEHEIDV 2009

Query: 185  LRLGKLFAKVRPP 197
            ++L  LF  + PP
Sbjct: 2010 VKLTSLFNNLVPP 2022

>Skud_4.330 Chr4 (573869..575077) [1209 bp, 402 aa] {ON} YDR076W
           (REAL)
          Length = 402

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 77/172 (44%), Gaps = 18/172 (10%)

Query: 62  EVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNAK 121
           E+   P   +   G Q   K +  ++ S AN+  +  I+   ++PIN       +F   K
Sbjct: 40  EIFGPPGIGKTNFGLQLVSKLLEAMQQSEANDDRILWIEAFQDMPINILRERFPEFDIVK 99

Query: 122 KDEDR-QIAKFESMMDARVHTFG-TDNKKYKPIIANELEGFSNLW------VKKRYIPED 173
           ++  R +I KF  ++    + F  + + KYK II   ++GFS L       + KR     
Sbjct: 100 ENLKRVRITKFGQLLYFFQNLFKLSQSMKYKLII---IDGFSQLVCDHLCTLSKR--SGG 154

Query: 174 DLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSE 225
            L +++HE+K   L  +F  +         ++  +T+ L++   +  F S+E
Sbjct: 155 TLDKTIHELKCRHLILIFTAMTKYT-----HSTGSTIILLNDCMNTAFQSNE 201

>Kpol_1055.89 s1055 (228896..231154) [2259 bp, 753 aa] {ON}
           (228896..231154) [2259 nt, 753 aa]
          Length = 753

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 368 LYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLA 422
           L++A  EN  N       G+    ER      N TN  +A A FDEKF  PD+L+
Sbjct: 672 LFQAPIENILNWDSQKIVGI----ERWLNKLINLTNQITALASFDEKFSTPDVLS 722

>KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} similar
           to uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 122

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 1/61 (1%)

Query: 198 KFQAPE-YANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYY 256
           K Q PE  A      L  +K+ + FT  +  V  + F   D + TL+ Y F  KG   YY
Sbjct: 13  KLQQPEKVAENVDPSLELNKTKVNFTPEKTDVNTYKFYPDDPESTLNRYRFAVKGASEYY 72

Query: 257 N 257
           +
Sbjct: 73  D 73

>SAKL0B09504g Chr2 complement(803571..805544) [1974 bp, 657 aa] {ON}
           some similarities with uniprot|P31376 Saccharomyces
           cerevisiae YAL011W SWC3 Protein of unknown function
           component of the Swr1p complex that incorporates Htz1p
           into chromatin required for formation of nuclear-
           associated array of smooth endoplasmic reticulum known
           as karmellae
          Length = 657

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 7/86 (8%)

Query: 343 TSAKRIELNGGYALGAPTKVNSQPSLYKAKGENRF----NIIRDARKGLSEEEERMKKSS 398
           T  K  +L+G   LG P   +S P L + K + ++    N++    K  S EE+ M+ ++
Sbjct: 407 TQVKAEDLSGVTTLGKPAAADSSPKLDQPKPKRKYTKRKNVL--VAKDESTEEKSMQLTT 464

Query: 399 HNFTNSNSAKAFFDEKFQNPDMLANL 424
                 N+A   F E  +NP++  NL
Sbjct: 465 FQQKYMNNADIVF-EYLENPNIRYNL 489

>ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {ON}
           some similarities with uniprot|Q22X91 Tetrahymena
           thermophila SB210 TTHERM_00561660 Viral A-type inclusion
           protein repeat containing protein
          Length = 698

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 380 IRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKA 439
           + +AR   S+ E R   + +N   SNSAKA      +  DML +L N RR +  T+ S++
Sbjct: 638 LYNARMNASDHENRCTAADYNGLTSNSAKA----PLRKRDMLRSLAN-RRTVLVTEPSQS 692

Query: 440 LNREL 444
           LN+ +
Sbjct: 693 LNKNI 697

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,707,545
Number of extensions: 3134933
Number of successful extensions: 11559
Number of sequences better than 10.0: 232
Number of HSP's gapped: 12136
Number of HSP's successfully gapped: 238
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)