Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.1857.128ON1821829611e-134
YIL009C-A (EST3)7.128ON1811827861e-107
Skud_9.1637.128ON1801827511e-102
Suva_9.1957.128ON1891906767e-91
NCAS0E021507.128ON1851864735e-60
NDAI0E036907.128ON1961934492e-56
Zrou_YGOB_EST37.128ON1681793918e-48
KNAG0L009607.128ON1851843744e-45
Kpol_1062.557.128ON1821863588e-43
TDEL0H029007.128ON1881893545e-42
KAFR0L004807.128ON1801833371e-39
Sklu_YGOB_EST37.128ON1961863311e-38
TPHA0C043107.128ON2012023182e-36
CAGL0C03828g7.128ON1801853058e-35
ADL016C7.128ON2021852809e-31
Kwal_YGOB_EST37.128ON1921892529e-27
KLLA0D14289g7.128ON1841862502e-26
Kthe_YGOB_EST37.128ON1931842311e-23
TBLA0A009607.128ON2152092294e-23
ZYRO0C05258gsingletonOFF87931935e-19
Sklu_YGOB_Anc_7.128singletonOFF98971352e-10
Kwal_55.20848singletonOFF96961002e-05
KLTH0F12606gsingletonOFF9696969e-05
ZYRO0C14674g6.139ON43428672.6
Smik_15.1158.800ON39626645.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.185
         (182 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 b...   374   e-134
YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp...   307   e-107
Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 b...   293   e-102
Suva_9.195 Chr9 complement(324112..324381,324353..324373,324377....   265   7e-91
NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 ...   186   5e-60
NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 ...   177   2e-56
Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [5...   155   8e-48
KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558...   148   4e-45
Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 ...   142   8e-43
TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 ...   140   5e-42
KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,...   134   1e-39
Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196...   132   1e-38
TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa...   127   2e-36
CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 a...   122   8e-35
ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, ...   112   9e-31
Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [57...   101   9e-27
KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} simil...   100   2e-26
Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026...    94   1e-23
TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 ...    93   4e-23
ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa] {OF...    79   5e-19
Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF} ...    57   2e-10
Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa] {OF...    43   2e-05
KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa] {...    42   9e-05
ZYRO0C14674g Chr3 (1142866..1144170) [1305 bp, 434 aa] {ON} simi...    30   2.6  
Smik_15.115 Chr15 complement(198046..199236) [1191 bp, 396 aa] {...    29   5.5  

>Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 bp,
           182 aa] {ON} YIL009C-A (REAL)
          Length = 182

 Score =  374 bits (961), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 182/182 (100%), Positives = 182/182 (100%)

Query: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKIL 60
           MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKIL
Sbjct: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKIL 60

Query: 61  TNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVNCL 120
           TNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVNCL
Sbjct: 61  TNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVNCL 120

Query: 121 MIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFPFVYK 180
           MIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFPFVYK
Sbjct: 121 MIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFPFVYK 180

Query: 181 YL 182
           YL
Sbjct: 181 YL 182

>YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp,
           181 aa] {ON}  EST3Component of the telomerase
           holoenzyme, involved in telomere replication
          Length = 181

 Score =  307 bits (786), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 147/182 (80%), Positives = 161/182 (88%), Gaps = 1/182 (0%)

Query: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKIL 60
           MP+V+LESHSKPTDS+FLQPWIKAL+EDNSEH QYHPS HVIP LT+QDL LPHMS  IL
Sbjct: 1   MPKVILESHSKPTDSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTIL 60

Query: 61  TNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVNCL 120
           TNPCHFAKIT+FYNVCDYKV ASIRDS+HQI LVEFS ECVSNFER HNCRIT+ET NCL
Sbjct: 61  TNPCHFAKITKFYNVCDYKVYASIRDSSHQI-LVEFSQECVSNFERTHNCRITSETTNCL 119

Query: 121 MIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFPFVYK 180
           MIIGDA L+  T+SR  SHFKI LS+ISS ++VPVL +NQ TIFDIDQVGSLS FPFVYK
Sbjct: 120 MIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVNQATIFDIDQVGSLSTFPFVYK 179

Query: 181 YL 182
           YL
Sbjct: 180 YL 181

>Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 bp,
           180 aa] {ON} YIL009C-A (REAL)
          Length = 180

 Score =  293 bits (751), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/182 (76%), Positives = 162/182 (89%), Gaps = 2/182 (1%)

Query: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKIL 60
           MPR++LESHSKP DSIFLQPWIKALV+DNS+ H+  PS+ VIP LT QDL +PHMSA+IL
Sbjct: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHR--PSERVIPSLTRQDLLVPHMSAQIL 58

Query: 61  TNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVNCL 120
           TNPCHF KITRFY+V +YKVCASIRDSTHQILLVEFS ECVS+FER HNCRIT+ET+NCL
Sbjct: 59  TNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETINCL 118

Query: 121 MIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFPFVYK 180
           MIIGDA LI  TS++V + FKIR+SSIS N+++PVL+INQ TIFDIDQVGSLS FPFVYK
Sbjct: 119 MIIGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFPFVYK 178

Query: 181 YL 182
           +L
Sbjct: 179 FL 180

>Suva_9.195 Chr9
           complement(324112..324381,324353..324373,324377..324652)
           [567 bp, 189 aa] {ON} YIL009C-A (REAL)
          Length = 189

 Score =  265 bits (676), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 153/190 (80%), Gaps = 9/190 (4%)

Query: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKIL 60
           MPRV LES+S+  DSIFLQPWIK L++DNSEHH   PSDHVIP L +QDL LPHM  +IL
Sbjct: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHHHI-PSDHVIPALAQQDLALPHMCPQIL 59

Query: 61  TNPCHFAKITRFYNVCDYKVCASIRDSTHQIL--------LVEFSPECVSNFERIHNCRI 112
           TNP HFA+ITRFYNVCDY+V AS+RDSTHQIL        LVEFS +CVS+FERI+N RI
Sbjct: 60  TNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRI 119

Query: 113 TAETVNCLMIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSL 172
           T+ET NCLMIIGDA L   TS++  + F IRLSSIS+++ VP+L INQ TIFDIDQVGSL
Sbjct: 120 TSETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQVGSL 179

Query: 173 SAFPFVYKYL 182
           + FPFVYKYL
Sbjct: 180 NNFPFVYKYL 189

>NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 bp,
           185 aa] {ON} Anc_7.128 YIL009C-A
          Length = 185

 Score =  186 bits (473), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 94/186 (50%), Positives = 128/186 (68%), Gaps = 5/186 (2%)

Query: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHV--IPVLTEQDLKLPHMSAK 58
           MPRV+L S    TDSIFLQPWI+ L+ ++ +   Y P +    +P L E DL+ P  S K
Sbjct: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60

Query: 59  ILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVN 118
           +LTN CHF K+T+F+ + +Y + ASIRDS  Q LLVEF+P+CVSNFER H+ R+T+ET+N
Sbjct: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQ-LLVEFTPKCVSNFERRHHRRLTSETLN 119

Query: 119 CLMIIGDASLINATSSRVKSHFKIRLSSISSN--DLVPVLQINQVTIFDIDQVGSLSAFP 176
           CL++IGDA++I  +  ++ + F      IS N   LVP+LQINQ ++FD DQV  L +FP
Sbjct: 120 CLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRSFP 179

Query: 177 FVYKYL 182
           FVY  L
Sbjct: 180 FVYSTL 185

>NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 bp,
           196 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 196

 Score =  177 bits (449), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 90/193 (46%), Positives = 126/193 (65%), Gaps = 12/193 (6%)

Query: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPV--LTEQDLKLPHMSAK 58
           MPRV+L S    +DS+FLQPWI  ++    +   Y P +  + +  L+ +D+  P +S  
Sbjct: 1   MPRVILSSKQTVSDSVFLQPWIANIIRKEIQAKTYLPGNQRLSIARLSRRDMDAPEISET 60

Query: 59  ILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVN 118
           IL N  HFAK+T+F++V +YK+ ASIRDST+QIL VEF+P+CV  FER++  RIT+ETVN
Sbjct: 61  ILNNYSHFAKVTKFFSVNNYKIFASIRDSTYQIL-VEFTPQCVLEFERVYRSRITSETVN 119

Query: 119 CLMIIGDASLINATSSRVKSHF-KIRLSSISSN--------DLVPVLQINQVTIFDIDQV 169
           CL +IGD ++I  T S+++S F K  L S++           L PVLQINQ ++FD DQV
Sbjct: 120 CLFVIGDCTVIYKTRSQIRSSFPKFDLQSLAGEKNSNKNGFGLFPVLQINQASLFDSDQV 179

Query: 170 GSLSAFPFVYKYL 182
             L  FPF+Y  L
Sbjct: 180 QLLFEFPFIYNKL 192

>Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [507
           bp, 168 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 168

 Score =  155 bits (391), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 87/179 (48%), Positives = 115/179 (64%), Gaps = 14/179 (7%)

Query: 1   MPRVVLESHSKPTDSIFLQPWIK-ALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKI 59
           MP+ ++    KP DS+FLQPWI+ AL E     H     D +IP +  QDL  P +S+K+
Sbjct: 1   MPQAIVSV--KPFDSVFLQPWIQTALAE-----HDPRLGDRLIPPVPTQDLSQPELSSKV 53

Query: 60  LTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVNC 119
           L+N  HF K+TRF++V  Y V ASIRDS  Q LLVEF+P+CVS+FER +  RITAET NC
Sbjct: 54  LSNIRHFVKVTRFFDVDHYTVYASIRDSKAQ-LLVEFTPQCVSDFERRYYTRITAETTNC 112

Query: 120 LMIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFPFV 178
           + II D  LI  + S +++H+K     I +    PVL++NQ  IFD DQV SL  +P V
Sbjct: 113 VFIIADCQLIYHSPSYIENHYK-----IVTRGETPVLRVNQTAIFDWDQVESLETYPLV 166

>KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558
           bp, 185 aa] {ON} Anc_7.128 YIL009C-A ribosomal
           frameshifting
          Length = 185

 Score =  148 bits (374), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 86/184 (46%), Positives = 113/184 (61%), Gaps = 5/184 (2%)

Query: 1   MPRVVL-ESHSKPTDSIFLQPWIKALVEDNSEH-HQYHPSDHVIPVLTEQDLKLPHMSAK 58
           MP V L ++  K  + IF  PWIK LV+  +E      P   +IP LT  DLK P  S +
Sbjct: 1   MPAVKLSQTGHKFQEWIFTHPWIKNLVKLPTEEISLMRPVRQIIPKLTTNDLKNPTRSKR 60

Query: 59  ILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVN 118
           +L N  HFAK+ +FY+V +YKV A IRDS  Q LLVEF PECVS FER H+CRIT+ TVN
Sbjct: 61  VLKNKTHFAKVMKFYSVHNYKVFACIRDSECQ-LLVEFHPECVSYFERFHHCRITSGTVN 119

Query: 119 CLMIIGDASLINATSSRVKSHFKIRLSSISSN--DLVPVLQINQVTIFDIDQVGSLSAFP 176
           CL +IG+  L   + +RV   F+I +        D +PVL INQ T+ D  Q+ + + FP
Sbjct: 120 CLFVIGNCDLEYRSVARVNDEFRINILPRKQKLMDQIPVLVINQATVADWGQMEAQTTFP 179

Query: 177 FVYK 180
           FV++
Sbjct: 180 FVHQ 183

>Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 aa]
           {ON} (125085..125366,125368..125634) [549 nt, 183 aa]
          Length = 182

 Score =  142 bits (358), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 81/186 (43%), Positives = 111/186 (59%), Gaps = 13/186 (6%)

Query: 1   MPRVVLESH-SKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLK--LPHMSA 57
           MP+++L S+ S   DS +LQ WI  +++ N     Y  +  VIP+L E        +MS+
Sbjct: 1   MPKIILPSNKSSCVDSTYLQEWIDLIIDRN-----YDNTGEVIPILDEYGFNDSQSYMSS 55

Query: 58  ---KILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITA 114
               I+  P HFAK+T F+NV DY V ASIRD   Q+L  EF+  CVS+FER++N RIT 
Sbjct: 56  VINLIIKKPYHFAKVTNFFNVVDYSVYASIRDRKFQVL-SEFTSNCVSSFERLYNSRITE 114

Query: 115 ETVNCLMIIGDASLINATSSRVKSHFKIRLSSI-SSNDLVPVLQINQVTIFDIDQVGSLS 173
            T+NCL +IGD  L   T   +K  +K+ LSSI + N L PVL INQ  +FD  Q+ S  
Sbjct: 115 NTINCLFLIGDCKLKFMTYWEIKELYKLDLSSICNKNSLYPVLSINQARMFDWSQIKSFE 174

Query: 174 AFPFVY 179
            F ++Y
Sbjct: 175 KFDWIY 180

>TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 bp,
           188 aa] {ON} Anc_7.128 YIL009C-A
          Length = 188

 Score =  140 bits (354), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 114/189 (60%), Gaps = 13/189 (6%)

Query: 1   MPRVVLESHSKPTDSIFLQPWIKA----LVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMS 56
           MP+ +L S SK  D++FL PWI+     L+ D S+     P  + IP L  +DL+ P +S
Sbjct: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRL--PVFNFIPKLQLKDLRKPQLS 58

Query: 57  AKILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAET 116
            +IL NP HF K+ +F++V  ++V A++RDS HQI LVEF+P+CVS FER H  RIT ET
Sbjct: 59  PRILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQI-LVEFTPQCVSEFERTHRSRITLET 117

Query: 117 VNCLMIIGDASLINATSSRVKSHFKIRLSSISSN------DLVPVLQINQVTIFDIDQVG 170
            + L II D  L +   + +  +F I + +  S         +PVL +NQ + F++DQ+ 
Sbjct: 118 EHSLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIE 177

Query: 171 SLSAFPFVY 179
           S   FP++Y
Sbjct: 178 SFEHFPYLY 186

>KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,
           180 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 180

 Score =  134 bits (337), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 113/183 (61%), Gaps = 10/183 (5%)

Query: 1   MPRVVLES-HSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMS-AK 58
           MP V L S H++P DSIF+  WIK L+++N +     P    IP +   +++ P  S   
Sbjct: 1   MPTVKLTSQHTRP-DSIFIHDWIKPLLDENCQG-LLRPIYRAIPPINNTNVRNPLSSRPS 58

Query: 59  ILTNP--CHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAET 116
           +LT    CHF KI +FY V ++K+ ASIRD+  QIL VEF+P CVS FER + CR+T++T
Sbjct: 59  LLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQIL-VEFTPHCVSTFERTNRCRLTSDT 117

Query: 117 VNCLMIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFP 176
            NC ++IGD S+   +S  +  ++++   +  +  L+PVL INQ +I D DQ   L  FP
Sbjct: 118 TNCTLLIGDCSIEYKSSHEISQNYRL---NFPNKRLLPVLTINQASILDRDQATLLEQFP 174

Query: 177 FVY 179
           FVY
Sbjct: 175 FVY 177

>Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196
           aa] {ON} ANNOTATED BY YGOB - Ribosomal frameshifting
           (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 196

 Score =  132 bits (331), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 78/186 (41%), Positives = 113/186 (60%), Gaps = 7/186 (3%)

Query: 1   MPRVVLESHSKPTDSIFLQPWI-KALVEDNSEHHQYHPSDHV---IPVLTEQDLKLP-HM 55
           MP+V L S +K +DSI+L  WI  +++    E         V   +P L ++D+    H+
Sbjct: 1   MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 56  SAKILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAE 115
           S KI+ N  HF K+T+FY V +Y+V AS RDS   IL VEF+  CVSNFER+H+ RIT+E
Sbjct: 61  SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSIL-VEFTACCVSNFERLHHSRITSE 119

Query: 116 TVNCLMIIGDASLINATSSRVKSHFKIRLSSISSN-DLVPVLQINQVTIFDIDQVGSLSA 174
           T N L +IGD  L+    + V   F I ++  +   +LVP+L++NQ  ++D+DQV S   
Sbjct: 120 TTNTLFVIGDVKLVFMDKASVSQKFGIDITQFNPQLNLVPILRVNQAFVYDMDQVESNRK 179

Query: 175 FPFVYK 180
           FPF Y+
Sbjct: 180 FPFFYQ 185

>TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa]
           {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 201

 Score =  127 bits (318), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 107/202 (52%), Gaps = 29/202 (14%)

Query: 1   MPRVVLESHSKPT-DSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKI 59
           MP+++L S    + DSIFL+PWIK  +ED  + +      ++  +L   ++KL      I
Sbjct: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIED-GKKNSIGKIGNLDELLNNTNVKL----QLI 55

Query: 60  LTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVNC 119
           L  P    K+T  YN+ +Y V  SIRD+ HQ LLVEF+  CVSNFER +  RIT +T NC
Sbjct: 56  LKYPNQLVKLTNIYNILNYCVFGSIRDNKHQ-LLVEFTSNCVSNFERNYKIRITDQTKNC 114

Query: 120 LMIIGDASLINATSSRVKSHFKIR----------------------LSSISSNDLVPVLQ 157
           L +IGD  +   T   +  +FKI                       LS    N L P+LQ
Sbjct: 115 LFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQ 174

Query: 158 INQVTIFDIDQVGSLSAFPFVY 179
           +NQV IFD DQV +   +PFVY
Sbjct: 175 VNQVMIFDWDQVVTFENYPFVY 196

>CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 aa]
           {ON} similar to uniprot|Q03096 Saccharomyces cerevisiae
           YIL009ca
          Length = 180

 Score =  122 bits (305), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 68/185 (36%), Positives = 108/185 (58%), Gaps = 8/185 (4%)

Query: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKIL 60
           MP  + +S S   +S++L  W++ ++ ++           VIP +   +  +P +S +I 
Sbjct: 1   MPPFIPKSRSNAVESVYLHGWVRDMLLESKTSQNIA----VIPRVDPDEASIPLLSRRIY 56

Query: 61  TNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVNCL 120
            N  HF KIT+F+ V +Y V AS++DS HQI L +F+P+CVS FE  +  RIT++TVN L
Sbjct: 57  ANRRHFVKITKFFQVHNYSVYASVKDSQHQI-LSQFTPKCVSEFESRNRSRITSDTVNTL 115

Query: 121 MIIGDASLINATSSRVKSHFKIRLSSISSN-DL--VPVLQINQVTIFDIDQVGSLSAFPF 177
            +IGDA L       ++ +F  ++ S+ +  D+  +P L INQ  I D DQV +    PF
Sbjct: 116 FMIGDAKLGIMVVDELRHYFGEKIVSLFNGLDMPYIPYLIINQAFILDYDQVEAFKMTPF 175

Query: 178 VYKYL 182
           VY+Y+
Sbjct: 176 VYQYI 180

>ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, 202
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YIL009C-A (EST3)
          Length = 202

 Score =  112 bits (280), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 104/185 (56%), Gaps = 7/185 (3%)

Query: 1   MPRVVLESHSKPTDSIFLQPW-IKALV---EDNSEHHQYHPSDHVIPVLTEQDLKLPHMS 56
           MP+VVL S +   DSIFL+ W + A+V   E +     +   +  IP L      L  + 
Sbjct: 1   MPKVVLASRAHKADSIFLREWLVDAVVPALERSGACAPWAGVECFIPALPPATATL-SLE 59

Query: 57  AKILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAET 116
             ++ NP  F +I RF  V D+ VCA  RD+   IL VEF+P CVSNFER ++ RIT+ T
Sbjct: 60  PTVIQNPKRFLRIVRFTRVHDFAVCAVARDAGCCIL-VEFTPHCVSNFERRYHQRITSST 118

Query: 117 VNCLMIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFP 176
           VN L +IG+ SL+    S   + F++  + ++ +  +PVL++    IFD DQV S   FP
Sbjct: 119 VNSLFVIGNTSLLFYARSDAAAAFEVP-ALMNGSSTLPVLRVGDCAIFDQDQVESHRRFP 177

Query: 177 FVYKY 181
            V ++
Sbjct: 178 LVQEH 182

>Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [579
           bp, 192 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 192

 Score =  101 bits (252), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 105/189 (55%), Gaps = 18/189 (9%)

Query: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPS----DHVIPVLTEQDLKLPHMS 56
           MP+       K  +S FL+ WI+  V +  + H   P     +  +P +   D  +  +S
Sbjct: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPM-QLS 59

Query: 57  AKILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAET 116
           +++L N  HF KIT F+ + ++ V AS RD + QIL VEF+P+CVS FER H  RITA T
Sbjct: 60  SQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL-VEFTPKCVSQFERRHGLRITART 118

Query: 117 VNCLMIIGDASLINATSSRVKSHFKIRLSSISSNDL------VPVLQINQVTIFDIDQVG 170
           VN + +IG      A + +    +++R +   ++DL      +PVL +N+ T+FD+DQV 
Sbjct: 119 VNTIFLIG------AVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVE 172

Query: 171 SLSAFPFVY 179
           S   F ++Y
Sbjct: 173 SRRKFNYLY 181

>KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} similar
           to uniprot|Q03096 Saccharomyces cerevisiae YIL009C-A
           EST3 Component of the telomerase holoenzyme involved in
           telomere replication
          Length = 184

 Score =  100 bits (250), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 96/186 (51%), Gaps = 8/186 (4%)

Query: 1   MPRVVLESHSKPTDSIFLQPWIKALVED---NSEHHQYHPSDH-VIPVLTEQDLKLPHMS 56
           MP VVL S     DS+FLQ WIK  V      +E  ++ P    ++  L E D+      
Sbjct: 1   MPNVVLSSRLTNNDSVFLQEWIKPSVRPYYLKNEKTKFWPEQRELVTDLLEHDIIESAFQ 60

Query: 57  AKILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAET 116
             +   P  F +I +F+ V DY V A+IRDST  ++L  F+ +CV ++E I+N RIT  T
Sbjct: 61  TALNPAPQRFVRIVKFHRVNDYTVYATIRDST-ALILCYFTVDCVLDYETINNDRITLNT 119

Query: 117 VNCLMIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFP 176
           +N L +IG+ +L        K  F      +    +VPVL+I +  +FD DQ+ S   F 
Sbjct: 120 LNTLFVIGNVTLQFWNHRECKLWFNQDFPGLR---MVPVLKIEKARMFDRDQISSNVQFE 176

Query: 177 FVYKYL 182
           +VY  L
Sbjct: 177 WVYDTL 182

>Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026)
           [582 bp, 193 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006).
           Replaces KLTH0F12606g.
          Length = 193

 Score = 93.6 bits (231), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/184 (34%), Positives = 104/184 (56%), Gaps = 6/184 (3%)

Query: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHP----SDHVIPVLTEQDLKLPHMS 56
           M ++V  +  K  +S+FL+ WI + V    + H   P      + +P L +    +P  S
Sbjct: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60

Query: 57  AKILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAET 116
            +IL N  HF KIT F+ V  + V AS RD+  +IL VEF+P+CVS FER+++ RITA+T
Sbjct: 61  -EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL-VEFTPQCVSAFERLNSIRITAKT 118

Query: 117 VNCLMIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFP 176
           VN +++IG  +L         + + + +       +VPVL + Q  +FD+DQV +  +F 
Sbjct: 119 VNTILLIGSGTLKYLPVHEAYTQWSLSIPLDPRVPVVPVLVVEQCAVFDLDQVEARPSFD 178

Query: 177 FVYK 180
           ++Y+
Sbjct: 179 YLYQ 182

>TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 bp,
           215 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 215

 Score = 92.8 bits (229), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 106/209 (50%), Gaps = 42/209 (20%)

Query: 15  SIFLQPWIKALVE---------DNSEHHQYHP----------------SDHVIPVLTEQD 49
           S+FL+ W+K L++         DN+   Q+ P                 + VI  ++ ++
Sbjct: 8   SVFLKKWLKNLIQPLYSGIFKNDNNYSEQFQPISDCEWSELPNKFIPQGERVIRQISSEE 67

Query: 50  LKLPHMSA--------KILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECV 101
           +K+    +         +L+N  H  KIT+F+ V +YK+CAS++D+  QI LVE +P CV
Sbjct: 68  MKMFGADSYNVIPLSSSLLSNNNHIIKITKFFKVNNYKICASVQDAECQI-LVELTPICV 126

Query: 102 SNFERIHNCRITAETVNCLMIIGDASLINATSSRVKSHFKIR--------LSSISSNDLV 153
           + +ER    R+T+ T++CL +IGD  L     + V  +F           L+++  + L+
Sbjct: 127 TEYERKTRDRMTSNTLDCLFVIGDCRLYFQNKNEVLHNFNCNTFRNIIPGLNALDRDSLI 186

Query: 154 PVLQINQVTIFDIDQVGSLSAFPFVYKYL 182
           PVL INQ+   D     SLS  PF++ YL
Sbjct: 187 PVLVINQIICVDRHPSKSLSTLPFLHSYL 215

>ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa]
          {OFF} some similarities with uniprot|Q03096
          Saccharomyces cerevisiae YIL009C-A
          Length = 87

 Score = 79.0 bits (193), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 8/93 (8%)

Query: 1  MPRVVLESHSKPTDSIFLQPWIK-ALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKI 59
          MP+ ++    KP DS+FLQPWI+ AL E     H     D +IP +  QDL  P +S+K+
Sbjct: 1  MPQAIVSV--KPFDSVFLQPWIQTALAE-----HDPRLGDRLIPPVPTQDLSQPELSSKV 53

Query: 60 LTNPCHFAKITRFYNVCDYKVCASIRDSTHQIL 92
          L+N  HF K+TRF++V  Y V ASIRDS  Q+L
Sbjct: 54 LSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLL 86

>Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF}
          ANNOTATED BY YGOB -
          Length = 98

 Score = 56.6 bits (135), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (56%), Gaps = 5/97 (5%)

Query: 1  MPRVVLESHSKPTDSIFLQPWI-KALVEDNSEHHQYHPSDHV---IPVLTEQDLKLP-HM 55
          MP+V L S +K +DSI+L  WI  +++    E         V   +P L ++D+    H+
Sbjct: 1  MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 56 SAKILTNPCHFAKITRFYNVCDYKVCASIRDSTHQIL 92
          S KI+ N  HF K+T+FY V +Y+V AS RDS   IL
Sbjct: 61 SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSIL 97

>Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa]
          {OFF} [contig 138] FULL
          Length = 96

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 5/96 (5%)

Query: 1  MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPS----DHVIPVLTEQDLKLPHMS 56
          MP+       K  +S FL+ WI+  V +  + H   P     +  +P +   D  +  +S
Sbjct: 1  MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPM-QLS 59

Query: 57 AKILTNPCHFAKITRFYNVCDYKVCASIRDSTHQIL 92
          +++L N  HF KIT F+ + ++ V AS RD + QIL
Sbjct: 60 SQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL 95

>KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa]
          {OFF} no similarity
          Length = 96

 Score = 41.6 bits (96), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 5/96 (5%)

Query: 1  MPRVVLESHSKPTDSIFLQPWIK----ALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMS 56
          M ++V  +  K  +S+FL+ WI     A++++++    +    + +P L +    +P  S
Sbjct: 1  MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60

Query: 57 AKILTNPCHFAKITRFYNVCDYKVCASIRDSTHQIL 92
           +IL N  HF KIT F+ V  + V AS RD+  +IL
Sbjct: 61 -EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL 95

>ZYRO0C14674g Chr3 (1142866..1144170) [1305 bp, 434 aa] {ON} similar
           to uniprot|P38151 Saccharomyces cerevisiae YBR233W
          Length = 434

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 12  PTDSIFLQPWIKALVEDNSEHHQYHPSD 39
           P  S+ L   +  +V  + +HHQYHP+D
Sbjct: 255 PLYSVLLNGGMSPMVYSHQQHHQYHPAD 282

>Smik_15.115 Chr15 complement(198046..199236) [1191 bp, 396 aa] {ON}
           YOL052C (REAL)
          Length = 396

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%)

Query: 79  KVCASIRDSTHQILLVEFSPECVSNF 104
           K C    D T ++L+ E +PEC S F
Sbjct: 202 KECIEDDDETFEVLMTELNPECASKF 227

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,755,781
Number of extensions: 720655
Number of successful extensions: 2869
Number of sequences better than 10.0: 28
Number of HSP's gapped: 2889
Number of HSP's successfully gapped: 28
Length of query: 182
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 79
Effective length of database: 41,670,801
Effective search space: 3291993279
Effective search space used: 3291993279
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 62 (28.5 bits)