Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.1847.126ON21421411041e-155
Skud_9.1627.126ON2172149261e-128
YIL010W (DOT5)7.126ON2152148841e-121
Suva_9.1947.126ON2152118591e-118
Kpol_1062.577.126ON2192136783e-90
KAFR0K012007.126ON2022076461e-85
SAKL0F05368g7.126ON2312186386e-84
KLLA0D14333g7.126ON2052076252e-82
CAGL0C03850g7.126ON2092095922e-77
KNAG0G010207.126ON2072115923e-77
TBLA0A009407.126ON2881485976e-77
NCAS0F008107.126ON2312295918e-77
NDAI0H013107.126ON2611935833e-75
TDEL0H028807.126ON3541645862e-74
Ecym_83517.126ON2242275534e-71
ADL018W7.126ON2442365451e-69
TPHA0C043307.126ON2091765351e-68
Kwal_55.208397.126ON3051545232e-65
KLTH0F12562g7.126ON2932094701e-57
TDEL0C015907.388ON24950654.8
NDAI0D03540na 1ON110737649.6
NOTE: 1 genes in the same pillar as Smik_9.184 were not hit in these BLAST results
LIST: ZYRO0C05214g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.184
         (214 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   429   e-155
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   361   e-128
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   345   e-121
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   335   e-118
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   265   3e-90
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   253   1e-85
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   250   6e-84
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   245   2e-82
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   232   2e-77
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   232   3e-77
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   234   6e-77
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   232   8e-77
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   229   3e-75
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   230   2e-74
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   217   4e-71
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   214   1e-69
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   210   1e-68
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   206   2e-65
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   185   1e-57
TDEL0C01590 Chr3 complement(275920..276669) [750 bp, 249 aa] {ON...    30   4.8  
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    29   9.6  

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  429 bits (1104), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 214/214 (100%), Positives = 214/214 (100%)

Query: 1   MGKALRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTS 60
           MGKALRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTS
Sbjct: 1   MGKALRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTS 60

Query: 61  TELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDD 120
           TELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDD
Sbjct: 61  TELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDD 120

Query: 121 LKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180
           LKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF
Sbjct: 121 LKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180

Query: 181 VDGKLRFKRVKISPEVSVNDAKKEILELAEKVKE 214
           VDGKLRFKRVKISPEVSVNDAKKEILELAEKVKE
Sbjct: 181 VDGKLRFKRVKISPEVSVNDAKKEILELAEKVKE 214

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  361 bits (926), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 197/214 (92%)

Query: 1   MGKALRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTS 60
           MG+ALRRSTRIAASKR LEDEESK  PISPPEV KK+VKT  KVK SE     D+S S +
Sbjct: 1   MGEALRRSTRIAASKRLLEDEESKLVPISPPEVPKKKVKTAPKVKTSEPVKSEDDSLSAA 60

Query: 61  TELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDD 120
           TEL+IGD IPDLSLLSEDND ISLK+IA+ENKIVVFFVYPKASTPGCTRQACGFRDNY+D
Sbjct: 61  TELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120

Query: 121 LKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180
           LKKH+AVFGLS+D VTSQK+FQTKQNLPYHL+SDPKREFIGLLGAKKTPLSGSIRSHFVF
Sbjct: 121 LKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVF 180

Query: 181 VDGKLRFKRVKISPEVSVNDAKKEILELAEKVKE 214
           V+GKLRFKR+KISPEVSV+DAKKE+LE+AE+V+E
Sbjct: 181 VNGKLRFKRIKISPEVSVSDAKKEVLEIAERVEE 214

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  345 bits (884), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 168/214 (78%), Positives = 190/214 (88%)

Query: 1   MGKALRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTS 60
           MG+ALRRSTRIA SKR LE+EESK  PIS PEV KK++KT  K   ++   Q  N +S  
Sbjct: 1   MGEALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDV 60

Query: 61  TELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDD 120
            EL+IGDPIPDLSLL+EDNDSISLKKI E N++VVFFVYP+ASTPGCTRQACGFRDNY +
Sbjct: 61  NELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQE 120

Query: 121 LKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180
           LKK++AVFGLS+DSVTSQK+FQ+KQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHF+F
Sbjct: 121 LKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIF 180

Query: 181 VDGKLRFKRVKISPEVSVNDAKKEILELAEKVKE 214
           VDGKL+FKRVKISPEVSVNDAKKE+LE+AEK KE
Sbjct: 181 VDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKE 214

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  335 bits (859), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 164/211 (77%), Positives = 187/211 (88%)

Query: 1   MGKALRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTS 60
           MG+ALRRS RIA SKR LE+E SK  P+SPPE  KK++KT  K+ + E   + D+S+  +
Sbjct: 1   MGEALRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGA 60

Query: 61  TELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDD 120
            ELK+GD IPDLSLL+EDND +SLK+IA+ENKIVVFFVYPKASTPGCTRQACGFRDNY+D
Sbjct: 61  NELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120

Query: 121 LKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180
           LK+H+AVFGLS+DSV SQK+FQTKQ LPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF
Sbjct: 121 LKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180

Query: 181 VDGKLRFKRVKISPEVSVNDAKKEILELAEK 211
           VDGKLRFKRVKISPEVSV DAKKE++ELAEK
Sbjct: 181 VDGKLRFKRVKISPEVSVGDAKKEVMELAEK 211

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  265 bits (678), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 166/213 (77%), Gaps = 6/213 (2%)

Query: 4   ALRRSTRIAASKRSLEDEESKFDPISPP---EVLKKRVKTDLKVKVSETEDQ---GDNSA 57
           A+RRSTRIA SKR LE +E++ D  S         K++K +  V+V++ +D+    +N  
Sbjct: 3   AVRRSTRIANSKRKLEADEAERDVASKSGEETTSSKKLKKEKDVRVTKVDDKESKAENKP 62

Query: 58  STSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDN 117
           S   E++IGD IPDL L ++D   ISL+++A++N I+VFF YP+A TPGCTRQACGFRD 
Sbjct: 63  SGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDT 122

Query: 118 YDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSH 177
           YDDLKKH+AVFGLS+DS  SQK+FQ K +LPY LLSDPKREFIGLLGAKKTP SG IRSH
Sbjct: 123 YDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSH 182

Query: 178 FVFVDGKLRFKRVKISPEVSVNDAKKEILELAE 210
           F+FVDGKLRFKR+KISPE+SVND KKE+LE+ E
Sbjct: 183 FIFVDGKLRFKRIKISPEISVNDGKKEVLEIVE 215

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  253 bits (646), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 128/207 (61%), Positives = 163/207 (78%), Gaps = 10/207 (4%)

Query: 5   LRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTSTELK 64
           LR STRI A K   ED E   D    PE  KKR     +V +S+ E    +   +S+EL+
Sbjct: 3   LRNSTRIKA-KVLFEDIED--DKERRPE--KKR-----RVTISKEETVESSGNVSSSELQ 52

Query: 65  IGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDLKKH 124
           IGD +PD++L+++DN  ISL+++A+ NKI+V F YPKASTPGCTRQACGFRDNYD++KKH
Sbjct: 53  IGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEIKKH 112

Query: 125 SAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVDGK 184
           +AVFGLS+DSV SQKRFQ KQNLP+ LLSDPKRE IG+LGAKKTP SG IRSH+VF+DGK
Sbjct: 113 AAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFLDGK 172

Query: 185 LRFKRVKISPEVSVNDAKKEILELAEK 211
           LRF+ +K+SPE S++++KKE++ELAEK
Sbjct: 173 LRFRNIKVSPERSISESKKEVMELAEK 199

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  250 bits (638), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 166/218 (76%), Gaps = 14/218 (6%)

Query: 5   LRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQ-----GDNSAS- 58
           LRRS R+AASK+  + E+   +P +    + ++ K++ K++  +TED+      D S   
Sbjct: 4   LRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIE-DKTEDEVQDKPADKSEDE 62

Query: 59  -------TSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQA 111
                   S+EL++GD IPDL L ++D+  ISLK++A++N+IVVFF YPKASTPGCTRQ 
Sbjct: 63  PTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQV 122

Query: 112 CGFRDNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLS 171
           CG+RDNY+DLK+H+AVFGLS+D+  +QK FQTKQ+LPY LLSDPKREFIGLLGAKKTP S
Sbjct: 123 CGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQS 182

Query: 172 GSIRSHFVFVDGKLRFKRVKISPEVSVNDAKKEILELA 209
           G IRSH+VF +GKLRFKRVKISPE SV D KKE+LELA
Sbjct: 183 GVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELA 220

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  245 bits (625), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 122/207 (58%), Positives = 160/207 (77%), Gaps = 10/207 (4%)

Query: 5   LRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKV--SETEDQGDNSASTSTE 62
           LRRS RI+A K  L+ E +        E +K + KT+ KV     + E + ++SA+   E
Sbjct: 4   LRRSNRISAKKEPLDSESA--------EPIKVKAKTESKVTKPNGKKEVKNEDSANKLAE 55

Query: 63  LKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDLK 122
           L+IGD IPDL+LL++D++ ISLK++A +NK+VVFF YPKASTPGCTRQACG+RDNY +LK
Sbjct: 56  LQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELK 115

Query: 123 KHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVD 182
           +H+AVFGLS+D+  SQK FQTKQ LP+ LLSDPKREFIG LGAKKT +SG +RSH++F +
Sbjct: 116 EHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKN 175

Query: 183 GKLRFKRVKISPEVSVNDAKKEILELA 209
           GKL  KRV++SPEVS+ + KKE+LELA
Sbjct: 176 GKLEVKRVQVSPEVSIEEGKKEVLELA 202

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  232 bits (592), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 155/209 (74%), Gaps = 7/209 (3%)

Query: 5   LRRSTRIAASKRSLEDEESKFDPIS--PPEVLKKRVKTDLKVKVSETEDQGDNSASTSTE 62
           LRRSTR++A   +   +E    PI      VLK++V T   VK   T+++    +S    
Sbjct: 3   LRRSTRLSAKHGNEVKDEG---PIKKKAKSVLKEKVNTKEPVKKPNTKEE--KVSSDEAI 57

Query: 63  LKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDLK 122
           L++GD IPD++L ++D   +SLK +A+ENK+++ F+YPKASTPGCTRQACGFRDN+DDLK
Sbjct: 58  LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLK 117

Query: 123 KHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVD 182
           +H  V GLS D+  +Q +F+ K +LPY LL DP REFIG+LGAKKTP SGSIRSHFVF D
Sbjct: 118 EHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFAD 177

Query: 183 GKLRFKRVKISPEVSVNDAKKEILELAEK 211
           GKL+FKR+KISPE+SV D KKE+LELA++
Sbjct: 178 GKLKFKRLKISPEISVADGKKEVLELAKQ 206

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  232 bits (592), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 115/211 (54%), Positives = 161/211 (76%), Gaps = 10/211 (4%)

Query: 5   LRRSTRIAASKRSLEDEESKFDPISPPEVLKK--RVKTDLKVK-VSETEDQGDNSASTST 61
           LR+S R+A    +++ + +   P +  +++KK     +  KVK V+ETED+    A    
Sbjct: 4   LRKSARVA----NIKKQTTLTTPATSNKIVKKTSNAASHKKVKIVAETEDKPLVDAKV-- 57

Query: 62  ELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDL 121
            L+IGD IPDL+L+ ++ + +SL ++A  NKI+V F YP+ASTPGCTRQACGFRDNY +L
Sbjct: 58  -LEIGDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTRQACGFRDNYAEL 116

Query: 122 KKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFV 181
           KKH+AV+GLS+D+V SQK+FQTKQNLPY+LLSDPKREFIG+LGAKKT  SG IRS+++F 
Sbjct: 117 KKHAAVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTSQSGIIRSYWIFF 176

Query: 182 DGKLRFKRVKISPEVSVNDAKKEILELAEKV 212
           +GKLR K++K+SPE SV ++K E+LEL +++
Sbjct: 177 NGKLRIKKIKVSPEASVAESKAEVLELVKEL 207

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  234 bits (597), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 102/148 (68%), Positives = 127/148 (85%)

Query: 62  ELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDL 121
           EL++GD +PD  L +++N++ISLKK+ EEN+IVV F YPKA+TPGCTRQACG RDNY+DL
Sbjct: 126 ELEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNYNDL 185

Query: 122 KKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFV 181
           KK++ VFG+S+DSV++QK FQ KQNLPY LLSD  RE IG LG KKTP SG IRSHF+ V
Sbjct: 186 KKYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHFIIV 245

Query: 182 DGKLRFKRVKISPEVSVNDAKKEILELA 209
           +GKL+FKRVKISPEVSV+D KKE+LE++
Sbjct: 246 NGKLKFKRVKISPEVSVSDCKKEVLEIS 273

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  232 bits (591), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 125/229 (54%), Positives = 165/229 (72%), Gaps = 27/229 (11%)

Query: 5   LRRSTRIAASKRS--LEDEESKFDPISPPEVLKKRV-----------------KTDLKVK 45
           LRRS RI+  K++  L +E+S+      P + K+RV                 K D K +
Sbjct: 4   LRRSGRISTLKKTHFLTEEDSEE---VKPAIKKQRVSKTKKIVIKKSNGKMKPKLDGKEE 60

Query: 46  VSETEDQGDNSASTST-----ELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYP 100
           + ++  + D++A  +T     EL+IGD IPD+ L  E+  S+SLKK+ EENKIVVFF +P
Sbjct: 61  IVKSVKELDSTAVKNTDSIYKELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFP 120

Query: 101 KASTPGCTRQACGFRDNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFI 160
           KA+TPGCTRQACGFRDNY +LK+H+AV+G+S+D VT+QK+F+TKQNLPY LLSD KR+FI
Sbjct: 121 KANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFI 180

Query: 161 GLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVNDAKKEILELA 209
           GLLGAKKTP SG IRS+F+FVDGKL+ KRVKISPE+SV +A+KE+   A
Sbjct: 181 GLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFA 229

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  229 bits (583), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 111/193 (57%), Positives = 153/193 (79%), Gaps = 7/193 (3%)

Query: 22  ESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTSTELKIGDPIPDLSLLSEDNDS 81
           E K D I   EV  K+VK D +    +  D+  N+ S   EL+IGD IPD++L +++   
Sbjct: 75  EDKVDGIEHEEV--KKVKFDEQ----QVSDKSANNDSI-IELEIGDDIPDITLSNQNGKE 127

Query: 82  ISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDLKKHSAVFGLSSDSVTSQKRF 141
           ISLK+IA+ NKI+V F +P+ASTPGCTRQACGFRDNYD+LKK++ VFGLS+D+++SQK+F
Sbjct: 128 ISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADAISSQKKF 187

Query: 142 QTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVNDA 201
           + KQ+LPY LLSDPKR+ IGLLGAKKTP SG++RS+++FV+GKL  KR+K+SPE+SV ++
Sbjct: 188 EEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSPEISVAES 247

Query: 202 KKEILELAEKVKE 214
           KKE++E A+K+ E
Sbjct: 248 KKEVIEFAKKLSE 260

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  230 bits (586), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 103/164 (62%), Positives = 134/164 (81%), Gaps = 4/164 (2%)

Query: 46  VSETEDQGDNSASTSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTP 105
           V+E  DQ     + STEL IGD IPD++L ++D   +SL+ +A+E+KI++ F YPKASTP
Sbjct: 189 VAEDSDQ----TAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTP 244

Query: 106 GCTRQACGFRDNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGA 165
           GCTRQACG+RDNYD+LK+H+AVFGLS D+ ++QK+FQTKQ+LP+ LL DP R  IG LGA
Sbjct: 245 GCTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGA 304

Query: 166 KKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVNDAKKEILELA 209
           KKT  SG++RSH+VF DGKL++KRVK+SPEVS+ D KKE+LELA
Sbjct: 305 KKTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELA 348

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  217 bits (553), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 108/227 (47%), Positives = 158/227 (69%), Gaps = 24/227 (10%)

Query: 1   MGKALRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTS 60
           M   LRRSTR+A  K    +E+ +F+ I      +K++KT     VS  + + +N  S  
Sbjct: 1   MATELRRSTRLATRK---ANEKPEFEEI---RFSQKKIKTS--SGVSGVKKKSNNGGSVG 52

Query: 61  T----------------ELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKAST 104
                            EL++GD +P+++L ++D+  ++LK +A++NKIV+ F YPKA+T
Sbjct: 53  VLKADSVLKSEKVGGPKELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANT 112

Query: 105 PGCTRQACGFRDNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLG 164
           PGCTRQACGFRDNY++L+KH+ +FG+SSDSV SQK FQ+KQ+LP+ LLSDP RE IG+LG
Sbjct: 113 PGCTRQACGFRDNYEELQKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLG 172

Query: 165 AKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVNDAKKEILELAEK 211
           AKKT  +G IRSH++F +GKL++KRVK+SPE S+++  +E+L L +K
Sbjct: 173 AKKTAQAGVIRSHWIFCNGKLKYKRVKVSPETSISEGLEEVLGLIKK 219

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  214 bits (545), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 149/236 (63%), Gaps = 26/236 (11%)

Query: 1   MGKALRRSTRIAASKRSLEDE--ESKFDPIS------PPEVLKKRVKTDL---------- 42
           M   LRRSTR+A  K S   E  ESK  P++      P     K+V TD           
Sbjct: 1   MATELRRSTRLATRKASDASEYAESKL-PLTKRVRKAPKTDAPKKVATDAPKKVVTEAPK 59

Query: 43  -------KVKVSETEDQGDNSASTSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVV 95
                  KV+  +     + S     EL++GD +P+++L ++D   + L  + ++NKIVV
Sbjct: 60  KEAGAAKKVETPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVV 119

Query: 96  FFVYPKASTPGCTRQACGFRDNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDP 155
            F YPKASTPGCTRQACGFRDNY +L+KH+ VFG+S+DSV SQK FQ KQ LP+ LLSDP
Sbjct: 120 LFAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDP 179

Query: 156 KREFIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVNDAKKEILELAEK 211
           KRE IG LGA+KT  +G IRSH+VFVDGKL  KR+KISPE+S+ D   E+L  A+K
Sbjct: 180 KRELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKK 235

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  210 bits (535), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 139/176 (78%), Gaps = 11/176 (6%)

Query: 37  RVKTDLKVKVSETEDQGDNSASTSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVF 96
           +++TDLK      E Q D+      E+++GD IPDL+L +++ + +SL+ +A++NKI+  
Sbjct: 45  KIETDLK------ETQKDDYE----EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITI 94

Query: 97  FVYPKASTPGCTRQACGFRDNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPK 156
           FVYP+ASTPGCTRQACGFRDN+DDLKK+S + GLS DS+T+QK F+TKQNLPY LL D +
Sbjct: 95  FVYPRASTPGCTRQACGFRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTE 154

Query: 157 REFIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVNDAKKEILELAEKV 212
           ++ I +LG KK P SG IRS+F+FVDGKL+ KRVK+SPEVS+ ++KKEIL+L +++
Sbjct: 155 KKLITILGCKKKP-SGIIRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  206 bits (523), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 123/154 (79%), Gaps = 1/154 (0%)

Query: 56  SASTSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFR 115
           S S+  EL++GD +PD+ L ++D + +SLKK+A+ENK+V+ F YPKASTPGCT QACGFR
Sbjct: 40  SDSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFR 99

Query: 116 DNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIR 175
           DNY+DLK+  AVFGLS+D+  +Q++FQ   +LP+ LLSDPKRE IGLLGAKK+P SG+ R
Sbjct: 100 DNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKR 158

Query: 176 SHFVFVDGKLRFKRVKISPEVSVNDAKKEILELA 209
           SH+VF +GKL  KR+ +SPEVS+ DAK E  E A
Sbjct: 159 SHWVFANGKLINKRIAVSPEVSIRDAKTEAHEAA 192

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  185 bits (470), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 102/209 (48%), Positives = 147/209 (70%), Gaps = 25/209 (11%)

Query: 5   LRRSTRIAAS---KRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTST 61
           LRRSTR  +S   KR+ E+EE     ++P     K+ KT+                 +  
Sbjct: 4   LRRSTRKKSSDAPKRAPEEEE-----VAPNAPETKKAKTN----------------GSKG 42

Query: 62  ELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDL 121
           EL+ GD +PD+ L +++ + +SLK + ++NK+VV F YPKASTPGCT+QACGFRDNY++L
Sbjct: 43  ELEEGDEVPDVVLKNQEGEEVSLKSVVQQNKVVVVFAYPKASTPGCTKQACGFRDNYEEL 102

Query: 122 KKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFV 181
           KK++AVFGLS+D+  +Q++F+ K +LP+ LLSDP+R+ IG LGA K+P SG+ RS++VFV
Sbjct: 103 KKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFV 161

Query: 182 DGKLRFKRVKISPEVSVNDAKKEILELAE 210
            GKLR KR+ +SPE SV++AKKE +E A+
Sbjct: 162 QGKLRTKRISVSPEASVSEAKKEAIEAAQ 190

>TDEL0C01590 Chr3 complement(275920..276669) [750 bp, 249 aa] {ON}
           Anc_7.388 YBL064C
          Length = 249

 Score = 29.6 bits (65), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query: 95  VFFVYPKASTPGCTRQACGF---RDNYDDLKKHSAVFGLSSDSVTSQKRF 141
           VFF +P   TP CT +   F   +  +D  K+   + GLS++ V S K++
Sbjct: 68  VFFSHPADFTPVCTTELGAFSKLKPEFD--KRGVKLIGLSAEDVESHKKW 115

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {ON}
           
          Length = 1107

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 169 PLSGSIRSHFVFVDGKLRFKRVKISPEVSVNDAKKEI 205
           P  G+I++ F   DG L FKR   SPE S  +  KE+
Sbjct: 154 PELGTIKAPFAAFDGNLPFKRGPSSPENSSKNDCKEV 190

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,446,199
Number of extensions: 961717
Number of successful extensions: 3370
Number of sequences better than 10.0: 67
Number of HSP's gapped: 3358
Number of HSP's successfully gapped: 68
Length of query: 214
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 109
Effective length of database: 41,441,469
Effective search space: 4517120121
Effective search space used: 4517120121
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)