Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.185.706ON1118111857010.0
YIL151C5.706ON1118111851510.0
Skud_9.175.706ON1118111850610.0
Suva_9.375.706ON1117111849370.0
TDEL0B021405.706ON1147114325580.0
ZYRO0B16412g5.706ON137297425210.0
KAFR0H001805.706ON124198024740.0
KNAG0C066305.706ON1281101424090.0
CAGL0G02541g5.706ON129594423960.0
Skud_11.3365.706ON118895423580.0
Smik_11.3605.706ON118094623580.0
Suva_11.3335.706ON118794323280.0
Kpol_1043.735.706ON126096523270.0
NCAS0A031705.706ON1319103023080.0
SAKL0E15004g5.706ON119697622940.0
YKR096W5.706ON119594522850.0
CAGL0H06611g5.706ON1282125522340.0
TPHA0E001905.706ON136199022330.0
AFR290W5.706ON121797821990.0
KLTH0E00968g5.706ON114897021820.0
Kwal_55.196785.706ON117897321830.0
Ecym_40155.706ON125797921500.0
KLLA0A00528g5.706ON122997120720.0
NDAI0E050705.706ON155637811491e-134
TBLA0E017105.706ON152640710391e-119
TPHA0D046405.706ON9628453572e-33
KLTH0F09592g2.335ON90991736.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.18
         (1118 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...  2200   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...  1988   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...  1954   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...  1906   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...   989   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...   975   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...   957   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   932   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   927   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   912   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   912   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   901   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   900   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   893   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...   888   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   884   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   865   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   864   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   851   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   845   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   845   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   832   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   802   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   447   e-134
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   404   e-119
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   142   2e-33
KLTH0F09592g Chr6 (830181..832910) [2730 bp, 909 aa] {ON} simila...    33   6.1  

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score = 2200 bits (5701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1067/1118 (95%), Positives = 1067/1118 (95%)

Query: 1    MVDLMVPVNDDPSNETDYPRSNNNYSQTVTDMRPTTTAFLHQKRHSSSSHNDTPESSFAK 60
            MVDLMVPVNDDPSNETDYPRSNNNYSQTVTDMRPTTTAFLHQKRHSSSSHNDTPESSFAK
Sbjct: 1    MVDLMVPVNDDPSNETDYPRSNNNYSQTVTDMRPTTTAFLHQKRHSSSSHNDTPESSFAK 60

Query: 61   RRVPGVVEPVGKGFIDGVTNGQISAQNTPSKVDDVSRRPSISRKVMESTPQAKTASISTM 120
            RRVPGVVEPVGKGFIDGVTNGQISAQNTPSKVDDVSRRPSISRKVMESTPQAKTASISTM
Sbjct: 61   RRVPGVVEPVGKGFIDGVTNGQISAQNTPSKVDDVSRRPSISRKVMESTPQAKTASISTM 120

Query: 121  DVPKSPYYVNRTAVARNMEVVSKESYDENANPQMRIDESLVASNGIYNNSQPQSQVTLPD 180
            DVPKSPYYVNRTAVARNMEVVSKESYDENANPQMRIDESLVASNGIYNNSQPQSQVTLPD
Sbjct: 121  DVPKSPYYVNRTAVARNMEVVSKESYDENANPQMRIDESLVASNGIYNNSQPQSQVTLPD 180

Query: 181  IRKXXXXXXXXXXXXRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240
            IRK            RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL
Sbjct: 181  IRKAPVVASSPPPVVRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240

Query: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLD 300
            KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLD
Sbjct: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLD 300

Query: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360
            VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360

Query: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420
            DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL
Sbjct: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420

Query: 421  LIENIYQSAFIDRGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480
            LIENIYQSAFIDRGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK
Sbjct: 421  LIENIYQSAFIDRGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480

Query: 481  NKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQX 540
            NKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ 
Sbjct: 481  NKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540

Query: 541  XXXXXXXXXXXXXXRSSATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLE 600
                          RSSATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLE
Sbjct: 541  PKYLKLKKDKREKKRSSATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLE 600

Query: 601  SLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIH 660
            SLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIH
Sbjct: 601  SLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIH 660

Query: 661  FLRRTMPWNSMVSLANVLVCYMLDNLHPFLKKELESFYSFELDDLIEHFNENENLPEIWK 720
            FLRRTMPWNSMVSLANVLVCYMLDNLHPFLKKELESFYSFELDDLIEHFNENENLPEIWK
Sbjct: 661  FLRRTMPWNSMVSLANVLVCYMLDNLHPFLKKELESFYSFELDDLIEHFNENENLPEIWK 720

Query: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGI 780
            CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGI
Sbjct: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGI 780

Query: 781  AKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXYETIEI 840
            AKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEG           YETIEI
Sbjct: 781  AKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYETIEI 840

Query: 841  NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900
            NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG
Sbjct: 841  NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 901  NGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATSWLRHF 960
            NGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATSWLRHF
Sbjct: 901  NGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATSWLRHF 960

Query: 961  AHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRF 1020
            AHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRF
Sbjct: 961  AHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRF 1020

Query: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQFAVLVT 1080
            TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQFAVLVT
Sbjct: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQFAVLVT 1080

Query: 1081 XXXXXXXXXXXXXIKTCNTKYLFSLGSKLGINSGLCTN 1118
                         IKTCNTKYLFSLGSKLGINSGLCTN
Sbjct: 1081 DDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score = 1988 bits (5151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 952/1118 (85%), Positives = 1009/1118 (90%)

Query: 1    MVDLMVPVNDDPSNETDYPRSNNNYSQTVTDMRPTTTAFLHQKRHSSSSHNDTPESSFAK 60
            MVDLMVP NDDPSNETDY RSNNN++  V+DMRPT+ AFLHQKRHSSSSHNDTPESSFAK
Sbjct: 1    MVDLMVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAK 60

Query: 61   RRVPGVVEPVGKGFIDGVTNGQISAQNTPSKVDDVSRRPSISRKVMESTPQAKTASISTM 120
            RRVPG+V+PVGKGFIDG+TN QISAQNTPSK DD SRRPSISRKVMESTPQ KT+SI TM
Sbjct: 61   RRVPGIVDPVGKGFIDGITNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTM 120

Query: 121  DVPKSPYYVNRTAVARNMEVVSKESYDENANPQMRIDESLVASNGIYNNSQPQSQVTLPD 180
            DVPKSPYYVNRT +ARNM+VVS+++Y++NANPQMR DE LVASNGIY+NSQPQSQVTL D
Sbjct: 121  DVPKSPYYVNRTMLARNMKVVSRDTYEDNANPQMRADEPLVASNGIYSNSQPQSQVTLSD 180

Query: 181  IRKXXXXXXXXXXXXRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240
            IR+            RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL
Sbjct: 181  IRRAPVVAASPPPMIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240

Query: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLD 300
            KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIY +EKRLWVYGIITFLD
Sbjct: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300

Query: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360
            VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360

Query: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420
            DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL
Sbjct: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420

Query: 421  LIENIYQSAFIDRGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480
            LIENIYQSAFIDR S   NNNE AH+NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK
Sbjct: 421  LIENIYQSAFIDRSSGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480

Query: 481  NKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQX 540
            +KFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ 
Sbjct: 481  DKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540

Query: 541  XXXXXXXXXXXXXXRSSATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLE 600
                          RS ATET  Y DPF  + S ESYFQNIDAL+S+F+DIPTNLNIWL+
Sbjct: 541  PKYLKLKKDKREKKRSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLD 600

Query: 601  SLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIH 660
            SLNHINMTSIQCSIHVLTKFLHAP V+ALPHFLTWL+F+VAILK+LE +NSKQV+AFWIH
Sbjct: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIH 660

Query: 661  FLRRTMPWNSMVSLANVLVCYMLDNLHPFLKKELESFYSFELDDLIEHFNENENLPEIWK 720
            FLRRTMPWNS+V+L NVLVCYMLDNLHPFLKKELE FYS ELDDLIE++NENENLPEIWK
Sbjct: 661  FLRRTMPWNSIVTLGNVLVCYMLDNLHPFLKKELEKFYSLELDDLIEYYNENENLPEIWK 720

Query: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGI 780
            CWG+LWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDE+GE+FW+RSVRA+ LLKGI
Sbjct: 721  CWGTLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGI 780

Query: 781  AKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXYETIEI 840
            AKKFPDLGLKV+FQA VFCRRNDIP DYFL+  TFKLDAYDE            Y+TIEI
Sbjct: 781  AKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDTIEI 840

Query: 841  NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900
            NE+I+ VN+D +ATPNLSVV GESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG
Sbjct: 841  NEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 901  NGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATSWLRHF 960
            NGV +DVS E IYDV +N+LSLHWEKIFFD+IAAA K  DEN NCT+YFV+DATSWLRHF
Sbjct: 901  NGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATSWLRHF 960

Query: 961  AHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRF 1020
            AHIFKLAKN+ L FAICLTTFQELRYLRGSKDD VVEAATRSVITIRQLYDE+KIIPMRF
Sbjct: 961  AHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRF 1020

Query: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQFAVLVT 1080
            TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQ FQ ER+  ENKNK K+FAVLVT
Sbjct: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEFAVLVT 1080

Query: 1081 XXXXXXXXXXXXXIKTCNTKYLFSLGSKLGINSGLCTN 1118
                         IKTCNTKYLFSLGSKLGINSGLCTN
Sbjct: 1081 DDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score = 1954 bits (5061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 928/1118 (83%), Positives = 998/1118 (89%)

Query: 1    MVDLMVPVNDDPSNETDYPRSNNNYSQTVTDMRPTTTAFLHQKRHSSSSHNDTPESSFAK 60
            MVD M PVNDDPSN+TDY R N++ +  V DMRPTT A LHQKRHSSSSHNDTPESSF K
Sbjct: 1    MVDPMAPVNDDPSNKTDYLRFNDSNASVVNDMRPTTVALLHQKRHSSSSHNDTPESSFVK 60

Query: 61   RRVPGVVEPVGKGFIDGVTNGQISAQNTPSKVDDVSRRPSISRKVMESTPQAKTASISTM 120
            RRVPGVVEPVGKGFIDG+ +GQ+S QNTPSK DD+SRRPSISRK ME+TP+  TASIST+
Sbjct: 61   RRVPGVVEPVGKGFIDGIASGQVSVQNTPSKTDDISRRPSISRKAMETTPKVNTASISTI 120

Query: 121  DVPKSPYYVNRTAVARNMEVVSKESYDENANPQMRIDESLVASNGIYNNSQPQSQVTLPD 180
            DVPKSPYY+N++A+ RNMEVVS+ +Y EN   QMR DES+  SNGIY+NSQPQSQVTL D
Sbjct: 121  DVPKSPYYMNKSAITRNMEVVSRGNYAENTTSQMRTDESMATSNGIYSNSQPQSQVTLSD 180

Query: 181  IRKXXXXXXXXXXXXRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240
             R             RQLPSAQPNQTFIKKLQEIY+IIVVQETELQQRCL+LTTSQTTEL
Sbjct: 181  FRTAPAFATSPPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTEL 240

Query: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLD 300
            KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIY +EKRLWVYGIITFLD
Sbjct: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300

Query: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360
            VLKNFSNFMDPEVCCQFIIYAFISVS+MLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 301  VLKNFSNFMDPEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360

Query: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420
            DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQD FTPSQQTLQL
Sbjct: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQL 420

Query: 421  LIENIYQSAFIDRGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480
            LIENIYQSAFIDR S+GTNNNETAH+NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK
Sbjct: 421  LIENIYQSAFIDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480

Query: 481  NKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQX 540
            +KFGKDFNGND+FDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ 
Sbjct: 481  DKFGKDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540

Query: 541  XXXXXXXXXXXXXXRSSATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLE 600
                          +S ATE PQYRDPF D+ S ESYFQNID+L+SNFDDIPTNLNIWL+
Sbjct: 541  PKYLKLKRHKREKKKSGATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLD 600

Query: 601  SLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIH 660
            SLNHINMTSIQCSIHVLTKFLHAP V+ALPHFLTWL+F+VAILK+LET+NSK V  FWIH
Sbjct: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIH 660

Query: 661  FLRRTMPWNSMVSLANVLVCYMLDNLHPFLKKELESFYSFELDDLIEHFNENENLPEIWK 720
            FLRRTMPWNSMV+LANVLVCYMLDN+HPFL++ELE FYS ELDDLIE+FNENENLPEIWK
Sbjct: 661  FLRRTMPWNSMVNLANVLVCYMLDNIHPFLERELERFYSLELDDLIEYFNENENLPEIWK 720

Query: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGI 780
            CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFW+RS+R I +LKG+
Sbjct: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGV 780

Query: 781  AKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXYETIEI 840
            AKKFPDLGLKVNFQAPVFCRRNDI  DYFL+ FTFKLD Y+E            Y+TIEI
Sbjct: 781  AKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELYDTIEI 840

Query: 841  NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900
            NEKI+ VN DLRATPNLSVV GE+IFEYTGYTRL PDYHCFDKNGGFNSAFIYSQWSNVG
Sbjct: 841  NEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 901  NGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATSWLRHF 960
            NG+ +DVS+E +YD  +N+LS HWEKIFFDRI  A  N D+N NC++YFV+DATSWLRHF
Sbjct: 901  NGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATSWLRHF 960

Query: 961  AHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRF 1020
            AHIFKLAKN+IL FAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDE+KIIP+RF
Sbjct: 961  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRF 1020

Query: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQFAVLVT 1080
            TGNIAT+VEENLEFEEQITW+THVDEFVIDAIAKLNQNFQTER+I +NKNKN  +AVLVT
Sbjct: 1021 TGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYAVLVT 1080

Query: 1081 XXXXXXXXXXXXXIKTCNTKYLFSLGSKLGINSGLCTN 1118
                         IKTCNTKYLFSLGSK+GINSGLCTN
Sbjct: 1081 DDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score = 1906 bits (4937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 906/1118 (81%), Positives = 979/1118 (87%), Gaps = 1/1118 (0%)

Query: 1    MVDLMVPVNDDPSNETDYPRSNNNYSQTVTDMRPTTTAFLHQKRHSSSSHNDTPESSFAK 60
            MVD+M  VNDDPSNETDY RS+NN +  V DMRPTT AFLHQKRHSSSSHNDTPESSFAK
Sbjct: 1    MVDIMAQVNDDPSNETDYSRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPESSFAK 60

Query: 61   RRVPGVVEPVGKGFIDGVTNGQISAQNTPSKVDDVSRRPSISRKVMESTPQAKTASISTM 120
            RRVPGVVEPVGKGFIDG+T  QIS QN P K +D+SRRPSISRK ME+TPQ  T+S S M
Sbjct: 61   RRVPGVVEPVGKGFIDGITTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSSNSAM 120

Query: 121  DVPKSPYYVNRTAVARNMEVVSKESYDENANPQMRIDESLVASNGIYNNSQPQSQVTLPD 180
            D+PKSPYYVNRTA+ RNMEVVSKES+DEN  PQ R D+SL  S GIY NSQPQSQ+TL D
Sbjct: 121  DIPKSPYYVNRTAITRNMEVVSKESHDENG-PQTRADDSLTTSTGIYANSQPQSQITLSD 179

Query: 181  IRKXXXXXXXXXXXXRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240
             R             RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL
Sbjct: 180  TRAAPIVANSLPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 239

Query: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLD 300
            KSLWAIY+LNTELIKNYINFIITALLTTQPINDLIMGQEILDIY +EKRLWVYGIITFLD
Sbjct: 240  KSLWAIYKLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 299

Query: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360
            VLK+FSNFMDPEVCCQFI YAFI +SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 300  VLKSFSNFMDPEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 359

Query: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420
            DWRLSAEYWYTESMKYIYGCGKLYYHIAT+QQNSLEAFVNLGKSVFCQDPFTPSQQTLQL
Sbjct: 360  DWRLSAEYWYTESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 419

Query: 421  LIENIYQSAFIDRGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480
            LIENIYQSAFIDR S  TNNNETAH+NSQLIDYLKHTEVMLLPSFLEN+DLQHVVL+YFK
Sbjct: 420  LIENIYQSAFIDRSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFK 479

Query: 481  NKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQX 540
            +KFGKDFNGNDVF TKDMFCQNPESLRYYFRHAPAFAESQ+LQLIGFGNPKNPFALLFQ 
Sbjct: 480  DKFGKDFNGNDVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQL 539

Query: 541  XXXXXXXXXXXXXXRSSATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLE 600
                          +S A E P YRDPF D+ S ESYFQNID L+S+F+D PTN+ IWL+
Sbjct: 540  PKHLKFKKDKREKKKSGAAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLD 599

Query: 601  SLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIH 660
            SLN+INMTSIQCSI VLTKFLHAP  +ALPHFL WL+F++A+LK+LETINS+QV AFWIH
Sbjct: 600  SLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIH 659

Query: 661  FLRRTMPWNSMVSLANVLVCYMLDNLHPFLKKELESFYSFELDDLIEHFNENENLPEIWK 720
            FLRRTMPWNSMV+ +NVLVCYMLDNLHPFL+K+LE FYS ELDDLIE+FNENENLPE+WK
Sbjct: 660  FLRRTMPWNSMVTFSNVLVCYMLDNLHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWK 719

Query: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGI 780
            CWGSLWFDA+KKCDVMEIPGVQDHLFFDSPLDGIVFD+KDEIGE+FW+RSVR I  LKGI
Sbjct: 720  CWGSLWFDAVKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGI 779

Query: 781  AKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXYETIEI 840
            AKKFPDLGLKVNFQA VFCRRNDI  DYFL+  TFKLD Y+E            Y+TIEI
Sbjct: 780  AKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEI 839

Query: 841  NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900
            NE I+ VN+DL+ATP LSVV GESIFEYTGYTRL  DYHCFDKNGGFNSAFIY+QWSNVG
Sbjct: 840  NELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVG 899

Query: 901  NGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATSWLRHF 960
            NGV +DVS+E +YD T NDLSLHW KI FD++    KN D++ +C++YFV+DATSWLRHF
Sbjct: 900  NGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLRHF 959

Query: 961  AHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRF 1020
            AHIFKLAKN+IL FAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDE+KIIPMRF
Sbjct: 960  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRF 1019

Query: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQFAVLVT 1080
            TGNIATH+EENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTER I +NK ++K+FAVLVT
Sbjct: 1020 TGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFAVLVT 1079

Query: 1081 XXXXXXXXXXXXXIKTCNTKYLFSLGSKLGINSGLCTN 1118
                         IKTCNTKYLFSLGSKLGINSGLCTN
Sbjct: 1080 DDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score =  989 bits (2558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/1143 (47%), Positives = 716/1143 (62%), Gaps = 107/1143 (9%)

Query: 42   QKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGVTNGQISAQNTPSKVDDVSRRPSI 101
            QKRHSS+ +N + ES+  KRRV    + + + F+D   NG I   NTP K    SRRPS 
Sbjct: 46   QKRHSSNPYN-SAESTGVKRRVANHDDGITQ-FLD---NGAIP--NTPCKEPVSSRRPSA 98

Query: 102  SRKVMESTPQAKTA-------------------------------SISTMDVPKSPYYVN 130
            +R+ +  TP++ T+                                +S  +V + P +++
Sbjct: 99   TRRTVNRTPRSTTSYVADASASPYCYSPNNSNLRIDHLSRMVNSSGVSIPNVCRDPSFLS 158

Query: 131  RTA-----------VARNMEVVSKESYDENANPQMRIDESLVASNGIYNNSQPQSQVTLP 179
            + A           ++ N   V+ +S D +AN + R D      N   ++ + ++     
Sbjct: 159  KEAHIVSDGQDTGTISINSGEVNDQSQDNSANDEGRDD------NNENDSIRNKNSNNDN 212

Query: 180  DIRKXXXXXXXXXXXXRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTE 239
            D  +              +PS + +Q  ++KLQ+IYK+IV QE ELQ+RC  LT SQTTE
Sbjct: 213  DNNRENNKDNNGNVPSVVVPSKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTE 272

Query: 240  LKSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFL 299
            LK LW IY++N++LI NY+ FI TALL  Q   DL +GQEI++IY +E+RLWVYG ITFL
Sbjct: 273  LKQLWVIYKVNSDLINNYVTFITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFL 332

Query: 300  DVLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGF 359
            DVLKNFSNFMDPEVC QFI + FIS+SNML DIP +Y+I W QRLGDLSRMAI+LYPSGF
Sbjct: 333  DVLKNFSNFMDPEVCAQFITHVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGF 392

Query: 360  IDWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQ 419
            IDW+LSAE+WY E+MKYIYG GKLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +Q
Sbjct: 393  IDWKLSAEHWYMEAMKYIYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQ 452

Query: 420  LLIENIYQSAFIDRGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYF 479
            L+I+NIYQ AF++R       N   H+NSQLI+YLKH+EVMLLPSFLE+ DLQ VVL+YF
Sbjct: 453  LVIDNIYQRAFVER-------NNGNHRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYF 505

Query: 480  KNKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ 539
            ++KFG D N N++FDT+ MF QNP+ L+Y+FRHAPAFAES +LQL+GFG+PKNPFALLF+
Sbjct: 506  RDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFE 565

Query: 540  XXXXXXXXXXXXXXXRSSA---TETP--------QYRD-PFHDKKSPESYFQNIDALSSN 587
                           ++ +   TET         +Y D  F      + +F NID+L+S 
Sbjct: 566  LPRCLKDRRDKKEKRKTKSSVTTETSSAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSP 625

Query: 588  FDDIPTNLNIWLESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLE 647
            +   P +L +W  SL ++N+TS+ CS+ VL KFL  P V+ALPH L W YF++A++ +++
Sbjct: 626  Y-LFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQ 684

Query: 648  TINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCYMLDNLHPFLKKE--LESFYSFELDDL 705
             I       FW+  + R  PWN++V+  NVL+ Y LDN+HP L  +   E   +  LD L
Sbjct: 685  HITDGASREFWLELVNRIFPWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQL 744

Query: 706  IEHFNENENLPEIWKCWGSLWFDAI-----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKD 760
            +EHFN NE+LPE+WKCWG LWFDAI      + D  E  G++DH+F D P+DGI FD  D
Sbjct: 745  VEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDD 804

Query: 761  EIGERFWVRSVRAISLLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKL-DA 819
            E G +FW R+ R I L K IA+ F    L V+ QA V CRR D P ++ L+ F FKL D 
Sbjct: 805  ESGIKFWKRACRVIFLFKRIAENF-QTRLVVSSQAQVHCRRTD-PMNHVLKSFCFKLRDT 862

Query: 820  YDEGXXXXXXXXXXXYETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYH 879
            +                TIE+ E+  + N D++ TP LSV+  ESIF Y GY RL  D  
Sbjct: 863  F-------YNSNSVLQNTIEVFEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLS 915

Query: 880  CFDKNGGFNSAFIYSQWSN--VGNGVPIDVSNEPIYDVTDNDLSLHWEKI--FFDRIAAA 935
            C+D+ G F S  +Y+ W N    N +P    +EP    T N+  L  E I          
Sbjct: 916  CYDRGGEFVSTSLYTSWGNETSKNEIP---QSEPTQQQTANEADLFIEGINTSLTEFNID 972

Query: 936  YKNCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNV 995
            +  C  N   T +FV+DATSWLRHFAH++KLA N +L FAICLTTFQELR+LR SKD+NV
Sbjct: 973  FPECKMNGKDT-FFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENV 1031

Query: 996  VEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKL 1055
            VEAATR+VIT+RQLY E +I+P+RFTGN+ATH+EE+LEFEEQITW++HVDEFV +AI K 
Sbjct: 1032 VEAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKA 1091

Query: 1056 NQNFQTERMIAENKNKNKQFAVLVTXXXXXXXXXXXXXIKTCNTKYLFSLGSKLGINSGL 1115
                  E       N++    VLVT             I T +T+++F+  + +G    +
Sbjct: 1092 QARLSQE-------NRDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKI 1144

Query: 1116 CTN 1118
            CTN
Sbjct: 1145 CTN 1147

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/974 (50%), Positives = 651/974 (66%), Gaps = 62/974 (6%)

Query: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257
            +PS + +Q  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTTELK+LW IY++N++LI NY
Sbjct: 408  VPSKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNY 467

Query: 258  INFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            + F+ TALL +Q   D+++G+EI++IY +E+RLWVYG ITFLD+ KNFSNFMDPEVCCQF
Sbjct: 468  VTFLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQF 527

Query: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + FIS+SNML DIP KY I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ 
Sbjct: 528  ITHVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFT 587

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSG 437
            Y  GKLYYH++TVQQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF++R    
Sbjct: 588  YSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVER---- 643

Query: 438  TNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKD 497
               N   H+N+QLI+YLKH+EVMLLPSFLE+ DLQ VVL+YFK KFG D N  ++FDT+ 
Sbjct: 644  ---NNGNHRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRK 700

Query: 498  MFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSS 557
            MFCQNP+ LRY+FRHAPAFAES +LQL+GFG+PKNPFALLF+               R+ 
Sbjct: 701  MFCQNPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTK 760

Query: 558  ATETPQYR-----DPFHDKKS-----PESYFQNIDALSSNFDDIPTNLNIWLESLNHINM 607
            +T   +       D   D++S     PE +F NI+ L   +  +P+NL IW ESLN+INM
Sbjct: 761  STTVTETSSTMAIDDLEDEQSDRMSTPEGFFGNIETLRFPY-SVPSNLEIWNESLNYINM 819

Query: 608  TSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMP 667
            TS++CS+ VL KFL  P V+ALPHF+ W YF++++  +++ +N +    FW+ F+ R  P
Sbjct: 820  TSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFP 879

Query: 668  WNSMVSLANVLVCYMLDN--LHPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSL 725
            WN++VS  NVL+ YMLDN      +      + S  L+DL+++FN NE LPE+WKCWG+L
Sbjct: 880  WNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTL 939

Query: 726  WFDAI-----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGI 780
            WFD I        + +E  G+++H+F D+P+DGI FD  DE GE FW R+ R I L KG+
Sbjct: 940  WFDTICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGL 999

Query: 781  AKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGX---------XXXXXXX 831
            A+ FP +G+ ++  APV+CRRND+   + L+ F+FKL    +                  
Sbjct: 1000 AENFP-IGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDL 1058

Query: 832  XXXYETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAF 891
                 T+EI E+    N+ +   P LSV+ GESIF+Y GY RL PDY  +DKNG F SA 
Sbjct: 1059 DHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSAS 1118

Query: 892  IYSQW---SNVGNGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDEND----- 943
            +Y+ W   +N  N   I      +    D   S+    IF   +   Y     +D     
Sbjct: 1119 LYTSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRD 1178

Query: 944  -------NCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVV 996
                   + T YFV+D T+WLRHF HI+KLA + +L FAICLTTF ELR+LR  KD+NVV
Sbjct: 1179 ALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVV 1238

Query: 997  EAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLN 1056
            EAATR++IT+RQLY E K++P+RFTGN+ATH+EE+LEFEE+ITW++HVDEFVI+A+ K  
Sbjct: 1239 EAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQ 1298

Query: 1057 QNFQTERMI------------AENKNKNKQFAVLVTXXXXXXXXXXXXXIKTCNTKYLFS 1104
              FQ    +            A +     +F VLVT             ++T +TK++FS
Sbjct: 1299 SKFQEMNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFS 1358

Query: 1105 LGSKLGINSGLCTN 1118
            L + +G+ S +CTN
Sbjct: 1359 LCNSIGLRSKICTN 1372

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/980 (50%), Positives = 649/980 (66%), Gaps = 76/980 (7%)

Query: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259
            + + ++  I+KLQ IYKIIV QE ELQQRC  LTTSQTTELK+LW+IY+LNT+LI NYI 
Sbjct: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336

Query: 260  FIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319
            FI TALL +Q + D+ +G+EI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEVC QFI 
Sbjct: 337  FITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396

Query: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379
            + FIS+S ML D+P K+SI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y 
Sbjct: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456

Query: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTN 439
             GKLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR  +G  
Sbjct: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGN- 515

Query: 440  NNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMF 499
                  +NS LIDYLKH+EVMLLPSFLEN DLQ VVL YF ++FG D+N N++F+T+DMF
Sbjct: 516  -----VRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMF 570

Query: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLF--------QXXXXXXXXXXXX 551
             Q P SLR+YFRHAPAFAES +LQL+GFGNPKNPFALLF        +            
Sbjct: 571  FQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSS 630

Query: 552  XXXRSSATETPQYRDPFHDKKS-------PESYFQNIDALSSNFDDIPTNLNIWLESLNH 604
                + + +T   R P  +  +          YF NID+L    D    N+ +WL+SL H
Sbjct: 631  TEISTMSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDH--PNILVWLKSLEH 688

Query: 605  INMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRR 664
            +NMTS++CS+ VL KFL  P +IALPH L W YF++A   + ++  +   + FW   +RR
Sbjct: 689  LNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRR 748

Query: 665  TMPWNSMVSLANVLVCYMLDNLHPF--LKKELESFYSFE-LDDLIEHFNENENLPEIWKC 721
             +PWN++ S  NVL+ Y+LDN +    + K  E++ +FE   +L+++FN NENLPEIWKC
Sbjct: 749  ILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKC 808

Query: 722  WGSLWFDAIK-----KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISL 776
            WG+LWFD I        D     G++DH+F D PLDGI FDE DE GE FW R++R + L
Sbjct: 809  WGTLWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFL 868

Query: 777  LKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXYE 836
             KGIA+     GL+V+  APV CRR+DI  ++ L+ F+FK++ +DE             +
Sbjct: 869  FKGIAENL-QTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTIN-K 926

Query: 837  TIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW 896
             + + E ID  NLD  A P LSVV GE+IFEY GY +L  + H FD+NG   S+ IY+ W
Sbjct: 927  LLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAW 986

Query: 897  ---------SNVGNGVPIDV-----------------------SNEPIYDVTDNDLSLHW 924
                     ++ GN    ++                       SNE   D  + +L ++ 
Sbjct: 987  VIDNDNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNP 1046

Query: 925  EKI--FFDRIAAAYKNCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQ 982
            EK+    D+ +      DE +    YFV DATSWLRHFAHI+KL+ N++L+FA+CLTTFQ
Sbjct: 1047 EKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQ 1106

Query: 983  ELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKT 1042
            ELR+LR SKD+NVV AA R++IT+RQLY E K++P+RFTGN+AT +EE+LEFEEQITW++
Sbjct: 1107 ELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRS 1166

Query: 1043 HVDEFVIDAIAKLNQNFQTERMIAENKN----KNKQFAVLVTXXXXXXXXXXXXXIKTCN 1098
            HVDEFVI+A+ K    F     I+ N++    K     VLVT             IKT  
Sbjct: 1167 HVDEFVIEAVVKAQNKF-----ISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFT 1221

Query: 1099 TKYLFSLGSKLGINSGLCTN 1118
            T ++FS+  KLGI   +CTN
Sbjct: 1222 THFIFSVCRKLGIQDNVCTN 1241

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 50/98 (51%), Gaps = 7/98 (7%)

Query: 33  RPTT-TAFLHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGVTNGQISAQNTPSK 91
           RP + +A L QKRH S+S+    +   A+     +   +   +ID   N  ++   TP K
Sbjct: 36  RPISPSAALRQKRHGSNSYIYKNQKRIARPDDKILNANININYIDH--NSIVNENATPVK 93

Query: 92  VDDVSRRPSISRKVMESTPQAKTASISTMDVPKSPYYV 129
              +SRRPS+S+K    TPQ    S    + PKSP+YV
Sbjct: 94  -SVLSRRPSLSKKSNNVTPQ---PSFLVTEPPKSPFYV 127

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1014 (48%), Positives = 646/1014 (63%), Gaps = 115/1014 (11%)

Query: 202  QPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFI 261
            + +Q  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTTELK+LW IY++NT+LI NY  FI
Sbjct: 286  KSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFI 345

Query: 262  ITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYA 321
             TALL +QP  D+++G+EI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEVC QFI + 
Sbjct: 346  TTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHV 405

Query: 322  FISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 381
            FIS+S +L DIP K++I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  G
Sbjct: 406  FISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHG 465

Query: 382  KLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNN 441
            KLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR + G    
Sbjct: 466  KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGN--- 522

Query: 442  ETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQ 501
               ++N  LIDYLKH+EVMLLPSFL + DLQ VVL YF+++FG D++ N++FDT+DMF Q
Sbjct: 523  ---YRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQ 579

Query: 502  NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSSATET 561
             P  LR++FRHAPAFAES +LQL+GFGNPKNPFALLF+               +S +T T
Sbjct: 580  PPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTST 639

Query: 562  P------------QYRDPFHDKK----------SPESYFQNIDALSSNFD--DIPTNLNI 597
                         Q  D  ++            S   Y  NI+ L    +  DI T    
Sbjct: 640  ADVSSTAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETPDICT---- 695

Query: 598  WLESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAF 657
            W++SL+ INMTS++CS+ VL KFLH P +IALPHFL W  F++A   ++  + +++   F
Sbjct: 696  WIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKF 755

Query: 658  WIHFLRRTMPWNSMVSLANVLVCYMLDNL-HPFLKKELESFYS-FELDDLIEHFNENENL 715
            W   ++R  PW+++ S  NVL+ Y+LDN  +  + +EL   YS  +LDD++ HFN++E+L
Sbjct: 756  WRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDL 815

Query: 716  PEIWKCWGSLWFDAI-----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRS 770
            PE+WKCWG+LW+DAI        D     G+ DH+F D P+DGI FD +DE G +FW R+
Sbjct: 816  PEVWKCWGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRA 875

Query: 771  VRAISLLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXX 830
            +R I L KGI+KKF D GLK++ +A V+C RN+   D  LR+FTFKL++YDE        
Sbjct: 876  LRVIFLFKGISKKF-DFGLKISHEAGVYC-RNEKAADSPLRRFTFKLESYDEPTSSKFN- 932

Query: 831  XXXXYETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSA 890
                 E I + E++  +N D  ATP+LSVV GE+IFEY GY  L  D + FDKNG   S+
Sbjct: 933  -----EFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSS 987

Query: 891  FIYSQW-------------------------SNVGNGVPIDVS-----NEPIYDVTD--- 917
             IY+ W                             NG PI  S           VTD   
Sbjct: 988  SIYTSWMIDTGEAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQD 1047

Query: 918  -----NDLSLHWEKIFFDRIAAAYKN----------------CDENDNCTIYFVVDATSW 956
                 NDL   +  +   R    Y N                 DE D    +F+ DATSW
Sbjct: 1048 PGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSW 1107

Query: 957  LRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKII 1016
            LRHFAHI+K+A N +L F +CLTTFQELR+LR SKD+NVVEAA R++IT+RQLY E +++
Sbjct: 1108 LRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLL 1167

Query: 1017 PMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENK------- 1069
            P+RFTGN+A  +EE+LEFEEQITW++HVDEFVI+A+ K    F T     + +       
Sbjct: 1168 PLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPP 1227

Query: 1070 -----NKNKQFAVLVTXXXXXXXXXXXXXIKTCNTKYLFSLGSKLGINSGLCTN 1118
                  K   +  LVT             IKT +T ++FSL SKLG++  LCTN
Sbjct: 1228 RVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 7/94 (7%)

Query: 42  QKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGVTNGQISAQNTPSKVDDVSRRPSI 101
           QKRH S+S++    +  +KRR+    E   +  I   ++  +  QNTP +  DV+R+ + 
Sbjct: 81  QKRHGSASYSFANANFPSKRRIANAEEDSKR--ISSYSDNLLLQQNTPRRSRDVARKSAS 138

Query: 102 SRKVMESTPQAKTASISTMDVPKSPYYVNRTAVA 135
                 S    ++AS S     +SP+ +  T++A
Sbjct: 139 G-----SASGCRSASGSGSAPQESPFCMEFTSLA 167

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/944 (49%), Positives = 644/944 (68%), Gaps = 36/944 (3%)

Query: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259
            S +P Q  ++KLQ+IYK IV QE ELQ++C  LT+SQTT+L S+W+IYR+N EL+ NY+ 
Sbjct: 363  SNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVT 422

Query: 260  FIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319
            FI TALL++Q   DL++GQEI++ Y + +RLWVYG ITFLDVLKNFS+FMDPEVC QFI 
Sbjct: 423  FISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFIT 482

Query: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379
            + FIS+S ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LS+EYWY +++KY YG
Sbjct: 483  HVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYG 542

Query: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTN 439
             GKLYYH++T+QQN+LEAFVNLGKSVFCQD F PS Q +QL+I+NIYQ AFI+RGS+ T 
Sbjct: 543  YGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNT- 601

Query: 440  NNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMF 499
                  +NSQLI+YLKH+EVMLLP+F+ N +LQ VV+ YF++KFG D +  ++F  +D+F
Sbjct: 602  ------RNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIF 655

Query: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSSAT 559
             QNPE+L+Y+FRHAPAFAES +LQ +GFG+ KNPFALLF                ++ ++
Sbjct: 656  LQNPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSS 715

Query: 560  ETPQYRDPFHDKK--------SPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQ 611
              P   +              S + YF N++++   +   P   +IWL+SL+++N+T++Q
Sbjct: 716  GEPTSNESVMSLDNISTDSLISSDQYFSNLESMQHPYLP-PPRYDIWLKSLSYLNLTAVQ 774

Query: 612  CSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSM 671
            C + VL KFLH PFV+ALPH + W YF++++  + ET+  ++   FW  F+RR +P NS+
Sbjct: 775  CGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSI 834

Query: 672  VSLANVLVCYMLDNLH--PFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDA 729
            VS  NVL+ Y LDN +    +    E   S +L +L+  FN NE LPE+WKCWG+LWFDA
Sbjct: 835  VSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDA 894

Query: 730  I-----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKF 784
            I        +  E  GV DHLFFDSP+DGIVFD KDE GE+FW R++R I L K IA+ F
Sbjct: 895  ITDKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETF 954

Query: 785  PDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAY-DEGXXXXXXXXXXXYETIEINEK 843
             D+G+ ++  APV+CRR+D+  ++ L  F+FK++ +   G              IE+ E 
Sbjct: 955  -DIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEM 1013

Query: 844  IDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGV 903
             + VN+ + ATP +S+   E+IFEYTGY R+AP+   FDKNG   SA  Y+ W +    V
Sbjct: 1014 PNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIV 1073

Query: 904  PIDVSNEPIYDVTDNDLSLHWE-KIFFDRIAAAYKNCDENDNC--------TIYFVVDAT 954
            P   ++ P   V  +     ++ +   + I + + N +EN           T  FV+DAT
Sbjct: 1074 PKSAAS-PENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTSFVLDAT 1132

Query: 955  SWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERK 1014
            SWLRH AHI+KLA NS L F+ICLTTFQELR+LR SKD+NV+EAA R++I IRQLY + K
Sbjct: 1133 SWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQLYSDGK 1192

Query: 1015 IIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQ 1074
            +IP+RFTGNIATH+EE+LEFEEQITW++HVDEFVI++I+K  + F  +  +    + + +
Sbjct: 1193 VIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF-LQPFVQNPVDNDSR 1251

Query: 1075 FAVLVTXXXXXXXXXXXXXIKTCNTKYLFSLGSKLGINSGLCTN 1118
            F VLV+             I+T  T+++F+L S++G    +CTN
Sbjct: 1252 FFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  912 bits (2358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/954 (49%), Positives = 627/954 (65%), Gaps = 54/954 (5%)

Query: 196  RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIK 255
            R   S + +   I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IYR+NTELI 
Sbjct: 258  RSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELIN 317

Query: 256  NYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCC 315
            NY+ FI TALL +QP++DL++GQEI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEVCC
Sbjct: 318  NYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 377

Query: 316  QFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMK 375
            QFI + F+S+S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MK
Sbjct: 378  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 437

Query: 376  YIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGS 435
            YIY  GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R  
Sbjct: 438  YIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER-- 495

Query: 436  SGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDT 495
                 N    +NS LI+YLKH+E MLLPSFLE+ DLQ+VV+ YF  KFG D NG ++F+ 
Sbjct: 496  -----NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNP 550

Query: 496  KDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXR 555
            +DMF QNP+  +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+               +
Sbjct: 551  EDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKK 610

Query: 556  SSATETPQYRDPFHDKK----------SPESYFQNIDALSSNFDDIPT----------NL 595
            SS  ++        + +          S  +   + D L+  F+DI T            
Sbjct: 611  SSNNDSSVTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLTS 670

Query: 596  NIWLESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVI 655
              WLE+L  +NMTS++C + VL KFLH P  IALPH L W+YF++A   +   ++     
Sbjct: 671  EAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSK 730

Query: 656  AFWIHFLRRTMPWNSMVSLANVLVCYMLDN--LHPFLKKELESFYSFELDDLIEHFNENE 713
             FW+  ++R  PW+++V+  NVL+ Y+LDN  L+P + +    + +  L  L+E FNE+E
Sbjct: 731  DFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESE 790

Query: 714  NLPEIWKCWGSLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEIGER 765
             LPEIW CWG+LWFD I + +   I         G++D++  D+P DGI+FD+KDE GE+
Sbjct: 791  ELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEK 850

Query: 766  FWVRSVRAISLLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXX 825
            FW R+ R I L + +++ FP +G+ V+    + C  +       LR   +KL+       
Sbjct: 851  FWKRACRIIFLFRELSRTFP-IGVIVSNDPLIKCSSSQ--SSIILRNLVYKLEPL-SNIR 906

Query: 826  XXXXXXXXXYETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNG 885
                       +++I+E     N+DL A P LSV  G++IF YTGY +L PDY CFD+NG
Sbjct: 907  SNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNG 966

Query: 886  GFNSAFIYSQWS-NVGNGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDN 944
             F SA +Y++W    GN +   + N  I +  D DL L   K           +C   D 
Sbjct: 967  EFLSASLYTRWYLPNGNNISEALVNSDI-EKGDEDLFLECMK----------PDCPGIDF 1015

Query: 945  CTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVI 1004
             T YFV DATSWLRH A IFKLA+N +L FAICLTTFQELR+LR SKD+NV+EAATR +I
Sbjct: 1016 ETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGII 1075

Query: 1005 TIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERM 1064
            TIRQLY E K++P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  +  +    
Sbjct: 1076 TIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQ 1135

Query: 1065 IAENKNKNKQFAVLVTXXXXXXXXXXXXXIKTCNTKYLFSLGSKLGINSGLCTN 1118
                  ++  + VL++             IKT +TK++FSL +KLG    LCT+
Sbjct: 1136 -PHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score =  912 bits (2358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/946 (50%), Positives = 625/946 (66%), Gaps = 53/946 (5%)

Query: 206  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265
              I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IY++NTEL+ NY+ FI TAL
Sbjct: 255  ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314

Query: 266  LTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325
            L +QP +DL++GQEI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS+
Sbjct: 315  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374

Query: 326  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY Y  GKLYY
Sbjct: 375  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434

Query: 386  HIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETAH 445
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R       N    
Sbjct: 435  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER-------NNGNL 487

Query: 446  KNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQNPES 505
            +NS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF  KFG D NG ++F+ +DMF QNP+ 
Sbjct: 488  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDF 547

Query: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ-----XXXXXXXXXXXXXXXRSSATE 560
             +Y+FRH P+FA+S +LQ++GFG PKNPFA+LF+                     SS TE
Sbjct: 548  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTE 607

Query: 561  --TPQYRDPFHDKK---SPESYFQNIDALSSNFDDI--------PTNLN--IWLESLNHI 605
              T   R+   D     S  +   + D L   F+DI        P+ L    WLE+L  +
Sbjct: 608  SSTGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPILPSMLTNEAWLETLKFL 667

Query: 606  NMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRT 665
            NMTS++C + VL KFLH P  +ALPH L W+YF+++I  +   +N      FWI  ++R 
Sbjct: 668  NMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRM 727

Query: 666  MPWNSMVSLANVLVCYMLDN--LHPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWG 723
             PW++MV+  NVL+ Y+LDN   +  +      +    L +L+  FNENE+LPEIW CWG
Sbjct: 728  FPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWG 787

Query: 724  SLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAIS 775
            +LWFDAI + +   I         G++D++  DSP DGI+FD+KDE GE+FW R+ R I 
Sbjct: 788  TLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIF 847

Query: 776  LLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXY 835
            L + +++ FP LG+ V     V C  + +  +  LR   +KL+                 
Sbjct: 848  LFREVSRSFP-LGVIVRHDPLVNC--SSLQSNNILRDLVYKLEPL--TNIRSSVPVLSTL 902

Query: 836  ETI-EINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYS 894
            E+I +I+E    +N DL A P LSV+ G++IF Y GY +L PDY CFDKNG F SA +Y+
Sbjct: 903  ESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYT 962

Query: 895  QW--SNVGNGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVD 952
             W   N  N +  ++S    Y     + +L  E +       AY    E D  T YFV D
Sbjct: 963  SWYVPNCNNNLETNIS----YANERENEALFLECMKSVHPEIAYP---EIDFKTTYFVFD 1015

Query: 953  ATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDE 1012
            ATSWLRH A IFKLA+N +L FAICLTTFQELR+LR SKD+NV+EAATR +ITIRQLY E
Sbjct: 1016 ATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCE 1075

Query: 1013 RKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKN 1072
             K++P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  +  +  +    + ++ 
Sbjct: 1076 DKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHR- 1134

Query: 1073 KQFAVLVTXXXXXXXXXXXXXIKTCNTKYLFSLGSKLGINSGLCTN 1118
              + VL++             I+T +T+++FSL +KLG    LCT+
Sbjct: 1135 FNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/943 (49%), Positives = 616/943 (65%), Gaps = 52/943 (5%)

Query: 206  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265
              I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IYR+NTEL+ NY+ FI TAL
Sbjct: 267  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTAL 326

Query: 266  LTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325
            L +QP +DL++GQEI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+
Sbjct: 327  LPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 386

Query: 326  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY+Y  GKLYY
Sbjct: 387  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYY 446

Query: 386  HIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETAH 445
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R       N    
Sbjct: 447  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER-------NNGNL 499

Query: 446  KNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQNPES 505
            +NS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF  KFG D NG ++F+ +DMF QNP+ 
Sbjct: 500  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDF 559

Query: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSSAT------ 559
             +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+               +SS        
Sbjct: 560  FKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITE 619

Query: 560  --------------ETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHI 605
                          E         ++ S   +F +ID L             WLESL  +
Sbjct: 620  SSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFL 679

Query: 606  NMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRT 665
            NMTS++C + VL KFLH P  IALPHFL W+YF+++I  +   ++      FWI  ++R 
Sbjct: 680  NMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRI 739

Query: 666  MPWNSMVSLANVLVCYMLDN--LHPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWG 723
             PW++MV+  N+L+  +LDN    P +    + +    L +L++ F E E LPEIW CWG
Sbjct: 740  FPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWG 799

Query: 724  SLWFD--------AIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAIS 775
            +LWFD        +I   D  E  G++D++  DSP+DGI+FD  DE GE+FW R+ R I 
Sbjct: 800  TLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIF 859

Query: 776  LLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXY 835
            L + +++ F  +G+ +N ++ +   R+ +  +  L   ++KL+                 
Sbjct: 860  LFRELSRSF-QIGVIINNESSI--NRSSLQSNNILGNLSYKLEPLS-TLGSSIPTLNTLE 915

Query: 836  ETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQ 895
              I++ E     N+DL A P LSV+ G SIF YTGY +L P+Y CFDKNG F SA +Y+ 
Sbjct: 916  GIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTS 975

Query: 896  WSNVGNGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATS 955
            W  V NG     SN P  ++  N      E  F + + +  +  D N   T YFV DATS
Sbjct: 976  WY-VPNG-----SNNPETNINSN-CEKENEGQFLECLKSDDREIDLN---TTYFVFDATS 1025

Query: 956  WLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKI 1015
            WLRH A IFKLA+N +L FAICLTTFQELR+LR SKD+NV+EAATR +ITIRQLY E K+
Sbjct: 1026 WLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKV 1085

Query: 1016 IPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQF 1075
            +P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  +  +    +  +  +   +
Sbjct: 1086 LPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCR-FNY 1144

Query: 1076 AVLVTXXXXXXXXXXXXXIKTCNTKYLFSLGSKLGINSGLCTN 1118
             +L++             IKT +T+++FSL +KLG    LCT+
Sbjct: 1145 VILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/965 (49%), Positives = 632/965 (65%), Gaps = 79/965 (8%)

Query: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257
            +P  + +Q  ++KLQ+IYKII+ QE ELQ+RC  LT SQTTE+K+LW IY+LN +LI NY
Sbjct: 309  VPPRKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNY 368

Query: 258  INFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            + FI TAL  +Q  +DL++G+EI+DIY +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQF
Sbjct: 369  VTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQF 428

Query: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + FIS+S+ML+DIP KY+I W Q+LGDLSRMA++L+PSGFIDW+LSAE WY  +M+Y 
Sbjct: 429  ITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYS 488

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSG 437
            YG GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ F PSQQ LQL+I+NIYQ AF DR SS 
Sbjct: 489  YGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSS 548

Query: 438  TNNNETAHKNSQ-LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDV--FD 494
             +      +N Q L+DYLKH+EVMLLP+F+E+ DLQ VVL+YF  KFG D+N N+V  F 
Sbjct: 549  NS------RNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQ 602

Query: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXX 554
             + MF QN + L++YFRHA AFAE+Q+LQL+G+GNPKNPFALLF                
Sbjct: 603  PRQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKR 662

Query: 555  RS--------------SATETPQYRDPFHDKK--SPESYFQNIDALSSNFDDIPTNLNIW 598
            +               S+    +Y            E +F NID L+ N + +P ++++W
Sbjct: 663  KPKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAIN-NFMPNSISLW 721

Query: 599  LESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFW 658
             +SL + N T+ +CS+ VL KFL+ P ++ALPH L W+YFL++I  ++E      ++ FW
Sbjct: 722  NDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFW 781

Query: 659  IHFLRRTMPWNSMVSLANVLVCYMLDNL--HPFLKKELESFYSFELDDLIEHFNENENLP 716
              F++R  PWNSMV   NVL+ YM+DN   +  L +  + + S  L++L+ +FN NE+LP
Sbjct: 782  YAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLP 841

Query: 717  EIWKCWGSLWFDAI------KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRS 770
            E+WKC GSLWFD I      + CD     G++D+ F D P+DGI FDE DEIG +FW RS
Sbjct: 842  EVWKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRS 901

Query: 771  VRAISLLKGIAKKFPDLG-LKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXX 829
            VR I L +GI ++F   G L +++ APV  RR  +  +  L  ++FKL A  +       
Sbjct: 902  VRVIFLFRGIVERFNGFGNLAISYNAPVINRRG-LGVNSHLVGYSFKLMAKSDDIMFDDM 960

Query: 830  XXXXXYETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNS 889
                        E+ID+ N D  A P LS+++GE+IFEY GY R+  DY+ FDKNG   S
Sbjct: 961  LVSNF-------EEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLIS 1013

Query: 890  AFIYSQWS---NVG-NGVPI------------DVSNE---------PIYDVTDNDLSLHW 924
               Y+ WS   + G NG P+            D  NE         P YD  D      W
Sbjct: 1014 TSFYNTWSINQDTGVNGGPLSNNSSSSNAASSDPMNEKELFNKCFDPEYDSVDE----FW 1069

Query: 925  EKIFFDRIAAAYKNCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQEL 984
             K  +D I   +      D    YF++DATSWLRHFAH++K+A NSIL F+ICLTTFQEL
Sbjct: 1070 NKEIYDDIGRKFGMELYED---TYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQEL 1126

Query: 985  RYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHV 1044
            R+LR SKD+NVVEAATR++IT+RQL+ E K++P+RFTGN+ATH+EE+LEFEEQITW++HV
Sbjct: 1127 RFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHV 1186

Query: 1045 DEFVIDAIAKLNQNFQTERMIAENKNKNKQFAVLVTXXXXXXXXXXXXXIKTCNTKYLFS 1104
            DEFVI+A+ K     +T+R   E  N      VLVT              KT +T+++F+
Sbjct: 1187 DEFVIEAVIKA----ETKRKEQEMHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFA 1242

Query: 1105 LGSKL 1109
            + + L
Sbjct: 1243 ISNYL 1247

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 61/119 (51%), Gaps = 14/119 (11%)

Query: 37  TAFLHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKG-FIDGVTNG------QISAQNTP 89
           T  L QKRH SSS+  TP  ++ K+RV         G F+D  +NG      Q S QNTP
Sbjct: 60  TKNLGQKRHGSSSYYITP--NYIKKRVAKNSYNSATGNFLDSGSNGGGDISNQTSLQNTP 117

Query: 90  SKVDDVSRRPSISRKVMESTPQAKTASISTMDVPKSPYYVNRTAVARNMEVVSKESYDE 148
                 S +PSI++  + +T      +  T D   SP+ +N + +  N+++VS E+ ++
Sbjct: 118 L----ASPKPSIAKNNIINTSTTPQPTYITQDSMTSPFVLN-SNLPSNLDIVSNENLED 171

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/1030 (46%), Positives = 641/1030 (62%), Gaps = 124/1030 (12%)

Query: 205  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264
            +  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTT+LK+LW IY++N +LI NY+ FI TA
Sbjct: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357

Query: 265  LLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324
            LL++Q   DL +G+EI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS
Sbjct: 358  LLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417

Query: 325  VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384
            +S ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE WY E+MK+ Y  GKLY
Sbjct: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477

Query: 385  YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETA 444
            YH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R       N   
Sbjct: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER-------NNGN 530

Query: 445  HKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFG---------------KDFNG 489
            ++N QLI+YLKH+EVMLLP+FLEN +LQ VVL+YF+ KFG                  N 
Sbjct: 531  NRNLQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNN 590

Query: 490  N----DVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ------ 539
            N    D+F ++DMF QNPE L+Y+FRHAPAFAES +LQL+GFG+PKNPFALLF+      
Sbjct: 591  NTRTIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLK 650

Query: 540  -------XXXXXXXXXXXXXXXRSSATETPQ----------------YRDPFHDKKSPES 576
                                   S+A +                   + D   ++ + E 
Sbjct: 651  ERKDKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEE 710

Query: 577  YFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWL 636
            +FQNI+ L  ++  IP +L IW+ SLNHIN+ S++CS+ VL KFLH P +IALPH L W 
Sbjct: 711  FFQNIEQLRFDY-FIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWC 769

Query: 637  YFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCYMLDN----------- 685
            YF+++IL + E +  +    FWI  L+   PWN +++  NVL+ Y LDN           
Sbjct: 770  YFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVND 829

Query: 686  -----LHPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIKK-----CDV 735
                 ++ F+      + +    DL++HFNENE+LPE+WKCWG+LWFD I        D 
Sbjct: 830  TKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADS 889

Query: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDLGLKVNFQA 795
             E  G++DH+F D P+DGI +  +DE GE FW R++R I L KGIA+ F  LGLKV++ A
Sbjct: 890  FENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNA 949

Query: 796  PVFCRRNDIPQDYFLRKFTFK--------LDAY--DEGXXXXXXXXXXXYETIEINEKID 845
                R N++P D  L+ F+FK        +DA   DE             E ++I E I 
Sbjct: 950  GTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIH 1009

Query: 846  NVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGVPI 905
              NL+    P  S++  E IF+YTGY +L P+   FDKNG F+S  IY+ W    + + +
Sbjct: 1010 ETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLIL 1069

Query: 906  DVSNEPIYDVTDNDLSLHWEKIFFDRIA-AAYKNCDENDNCTI--------------YFV 950
              +N    + TD    L    +  D ++    K  +  D  T+              YFV
Sbjct: 1070 AQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFV 1129

Query: 951  VDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLY 1010
             DATSWLRHFAHI+KLA N +L FA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY
Sbjct: 1130 FDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLY 1189

Query: 1011 DERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMI----- 1065
             +  ++P+RFTGN+AT +EE+LEFEEQITW++HVDEFVI+A+ K  + F   + +     
Sbjct: 1190 SDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEG 1249

Query: 1066 ---------------AENKNKNK--QFAVLVTXXXXXXXXXXXXXIKTCNTKYLFSLGSK 1108
                           AE + K+   ++ VL+T             I T  T+ +FS+ S 
Sbjct: 1250 TSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSM 1309

Query: 1109 LGINSGLCTN 1118
            +GI+ G+CTN
Sbjct: 1310 MGIDEGVCTN 1319

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (54%), Gaps = 12/108 (11%)

Query: 40  LHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGVTNGQ--------ISAQNTPSK 91
           + QKRHSS+S+++   +   KRR+    E V   +ID +  G         I  Q TPSK
Sbjct: 52  IRQKRHSSNSYSNAKNNPAVKRRI-AKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSK 110

Query: 92  VDDVSRRPSISRKVMESTPQAKTASISTMDVPKSPYYVNRTAVARNME 139
              +SRRPS+ +K M STPQ  +  +S  +VP SP+Y+   + + N E
Sbjct: 111 -GTLSRRPSLIKKQMNSTPQPMSYVVS--EVPASPFYLPANSFSNNYE 155

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/976 (47%), Positives = 643/976 (65%), Gaps = 71/976 (7%)

Query: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257
            +P    +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT++K+LW IY++N ELI NY
Sbjct: 237  VPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNY 296

Query: 258  INFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            I+FI TALL +QP  DL++GQEI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQF
Sbjct: 297  ISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQF 356

Query: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + F+S+SNML D+P +YSI W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++ Y 
Sbjct: 357  ISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYT 416

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSG 437
            YG GKLYYH++TVQQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF +R    
Sbjct: 417  YGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGS 476

Query: 438  TNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKD 497
            +       +N  +++YLKH+EVMLLPSFLE+ +LQ VVL +F+ +FG   N  D FD K 
Sbjct: 477  S-------RNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQ 529

Query: 498  MFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSS 557
            +F Q+ E LRY+F HAPAFAES +LQL+GFG+P+NPFA+LF+               R  
Sbjct: 530  IFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAILFE--LPKFLKERKERKERRR 587

Query: 558  ATETPQYRDPFHDKKSPES-----YFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQC 612
            +  +P       D     S     YF+NID+    +   P ++ IW +SL+++N+TS++C
Sbjct: 588  SKSSPPLPTNLDDGNGSSSISVDHYFENIDSHRVPY-SFPQDIQIWQQSLSYLNLTSMEC 646

Query: 613  SIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMV 672
            S+ VL KFLHAP + ALPH L W +FLV++  R+ +++S  +  FW+ F+RR  PWNS+V
Sbjct: 647  SMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLV 706

Query: 673  SLANVLVCYMLDNLHPF--LKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAI 730
            S  N L+ ++LDN      ++K  E +   +L  L+EHF  +E LPE+WKCWG+LWFD I
Sbjct: 707  SFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTI 766

Query: 731  K-----KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFP 785
                  K   ++  G++DHLF D+P+DGI FD+ DE G +FW R+ R I + KG+AK+F 
Sbjct: 767  SNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEF- 825

Query: 786  DLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXYETIEINEKID 845
              G++V+   P+  RR D+   + L++F+FK +   +            +  I++ E I 
Sbjct: 826  HYGIRVS-DTPISTRR-DVTTLHALKRFSFKFEELPQEWDNEVFLQSDNF--IKVFEPIS 881

Query: 846  NVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW--------- 896
             +N +  A P+LS++ GESIFE+ GY R+ PDY+CF+KNG   +  +Y+           
Sbjct: 882  PINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQG 941

Query: 897  -------SNVGNGVPIDVSNEPI--YDVTDNDLSLHWEKIFFD--------------RIA 933
                    +V NGV +   N P+   + T   +  + E+ + +              R  
Sbjct: 942  GDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFP 1001

Query: 934  AAYKNCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDD 993
                 C+ + N T YFV+DATSWLRHFAH++KLA N++L FAICLTTFQELR+LR SKD+
Sbjct: 1002 HGDLACNADSNVT-YFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDE 1060

Query: 994  NVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIA 1053
            +VVEAATR+VIT RQLY ERK++P+RFTGNIATH+EE+LEFEEQITW++HVDEFVI+A+ 
Sbjct: 1061 SVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVY 1120

Query: 1054 KLNQNFQTERMIAENKNKNK-----------QFAVLVTXXXXXXXXXXXXXIKTCNTKYL 1102
            K  + F+   + A ++ +              F VLVT             I   +++++
Sbjct: 1121 KSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFM 1180

Query: 1103 FSLGSKLGINSGLCTN 1118
            F+  ++LG N  +C N
Sbjct: 1181 FAFCNQLGYNQKVCIN 1196

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 62/116 (53%), Gaps = 9/116 (7%)

Query: 40  LHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGKGFIDGVTNGQISAQN-TPSKVDDVSRR 98
           LHQKRH+S+S+ D  +S +AKRR   + + V +      +       N TPSK  + +  
Sbjct: 30  LHQKRHNSNSY-DYYDSGYAKRRPNTLSQNVSQNDELAASAACFLDSNLTPSKHQECT-- 86

Query: 99  PSISRKVMESTPQAKTASISTMDVPKSPYYVNRTAVARNMEVVSKESYDENANPQM 154
           PS  ++  + TPQ         D P+SP+Y+  T+ + N+E  SK   ++N++ Q+
Sbjct: 87  PSSFQRATDETPQP----FYPADTPQSPFYLPTTS-SSNLEAASKVITNDNSSVQL 137

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/945 (49%), Positives = 622/945 (65%), Gaps = 55/945 (5%)

Query: 206  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265
              I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IY++NT+L+ NY+ FI TAL
Sbjct: 274  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333

Query: 266  LTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325
            L +QP +DL++GQEI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+
Sbjct: 334  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393

Query: 326  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKYIY  GKLYY
Sbjct: 394  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453

Query: 386  HIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETAH 445
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R       N    
Sbjct: 454  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER-------NNGNL 506

Query: 446  KNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQNPES 505
            +NS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF  KFG D NG ++F+ +DMF QNP+ 
Sbjct: 507  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDF 566

Query: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSS-------A 558
             +Y+FRH P+FA+S +LQ++GFG PKNPFA+LF+               +SS        
Sbjct: 567  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTE 626

Query: 559  TETPQYRDPFHDKK---SPESYFQNIDALSSNFDDI--------PTNLN--IWLESLNHI 605
            + T   R+   D     S  +   + D L+  F+DI        P+ L    WLE+L  +
Sbjct: 627  SSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLETLKFL 686

Query: 606  NMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRT 665
            NMTS++C I VL KFLH P  IALPH L W+YF+++I  +   ++      FW+  ++R 
Sbjct: 687  NMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRA 746

Query: 666  MPWNSMVSLANVLVCYMLDNL--HPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWG 723
             PW++MV+  NVL+ Y+LDN   +  +    + +    L +L+E FNE E LPEI  CWG
Sbjct: 747  FPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWG 806

Query: 724  SLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAIS 775
            +LWFD I + +   I         G++D++  DSP DGI+FDEKDE GE+FW R+ R I 
Sbjct: 807  TLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIF 866

Query: 776  LLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXY 835
            L + +++ FP +G+ +     ++  R+       L    FKL+                 
Sbjct: 867  LFRELSRSFP-IGVIIRNDPLIY--RSSFQNTNILGSLVFKLEPLC-NIHNNIPVLGALE 922

Query: 836  ETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQ 895
              I+I+E     N DL A P LSV  G++IF Y GY +L  DY CFDKNG F SA +Y+ 
Sbjct: 923  SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTT 982

Query: 896  WSNVGNGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATS 955
            W      VP + +N  I D  + +     E +F + I + Y    E D  T YFV DATS
Sbjct: 983  WY-----VP-NSNNTNIEDNINYNSEKENEGLFLECIKSDYP---EIDFKTTYFVFDATS 1033

Query: 956  WLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKI 1015
            WLRH A IFKLA+N +L FAICLTTFQELR+LR SKD+NV+EAATR +ITIRQLY E K+
Sbjct: 1034 WLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKV 1093

Query: 1016 IPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQF 1075
            +P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI+++ K  +  ++    +E +   ++F
Sbjct: 1094 LPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESA---SEPRLSPRRF 1150

Query: 1076 --AVLVTXXXXXXXXXXXXXIKTCNTKYLFSLGSKLGINSGLCTN 1118
               VL++             IKT +T+++FSL +KLG    LCT+
Sbjct: 1151 NYVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD 1195

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/1255 (39%), Positives = 704/1255 (56%), Gaps = 182/1255 (14%)

Query: 34   PTTTAFLHQKRHSSSSHNDTPESSFAKRRVPGVVE--PVGKGFIDGVTNGQISAQN--TP 89
            P  T  LHQKRH+SS++N T ++   KRR+P   +  P+G  F+D  +      Q   TP
Sbjct: 40   PGFTQGLHQKRHNSSANNHTRDT-IVKRRLPVQSDENPIG-NFLDSFSKNSSPLQQCRTP 97

Query: 90   SK--------------VDDVSRRPSIS-----RKVMESTPQAKTA--------------- 115
                             D V R  +I        +   +P    A               
Sbjct: 98   GSRPHSVTKKTSNIDNTDMVGRSNAIGGYSDNANMSNKSPAEFNAGPVNKNHTGNSLLDN 157

Query: 116  ---SISTMDVPKSPYYVNRTAVARNME----------VVSKESYDENANPQMRIDESLVA 162
               S + +D+P SP+Y+     +  +E          V S E   E+  P++ + E    
Sbjct: 158  IANSANRVDIPGSPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIGPELNLIEEQYN 217

Query: 163  SN----GIYNNSQPQSQVTLPDIRKXXXXXXXXXXXXRQ--------LPSA--QPNQTFI 208
            SN     I  N++     +LP                R         LP+   +  Q  I
Sbjct: 218  SNLENGEINYNTEVSDFESLPTKDANSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQALI 277

Query: 209  KKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALLTT 268
             KLQ+IYK I+VQE ELQ  C  +T+SQTT+LK +W +Y++N EL+ NY+ FI TALL +
Sbjct: 278  SKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTALLPS 337

Query: 269  QPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVSNM 328
            Q   DL++GQEI+D+Y +E+RLWVYG ITFLDVLK+FSNFMDPE+CCQFII+ FIS++NM
Sbjct: 338  QSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIANM 397

Query: 329  LEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYHIA 388
             + IP K+SI W  RLGDLSRMA +LYP G  DW+LSAEYWY E+MKY YG GKLYYH+A
Sbjct: 398  SDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYHMA 457

Query: 389  TVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETAHKNS 448
            TVQQNSL AF+NLGKSVFC+D F P+QQ LQL+I+NIYQ A+I RG       E +  N 
Sbjct: 458  TVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRG-------EESSSNV 510

Query: 449  QLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQNPESLRY 508
            Q++DYLKH E+M+LP+F+EN +LQ +  +YF  KFG+DF GN+ FDT+ MF QN ES+++
Sbjct: 511  QILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKF 570

Query: 509  YFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSS------ATETP 562
            YFRH+P FA++ +LQ++G+GN  N FALL++               +S       + +T 
Sbjct: 571  YFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTL 630

Query: 563  QYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHVLTKFLH 622
             ++   ++      YF +++ +   F  +P N++IW++SL + N T I C + VL KFL 
Sbjct: 631  SFQVSGNEIHDVGEYFNSLENIDKEF-TLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQ 689

Query: 623  APFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCYM 682
             PFV ALPH L W+YFL+++  ++ET+       FW  F+RR  PWN++++  NVL+ ++
Sbjct: 690  GPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFL 749

Query: 683  LDNLH--PFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIK-KCDV---- 735
             DN      + +  E++    LD+++ +F+ENE LPE+W CWGSLWFD IK K +     
Sbjct: 750  KDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSG 809

Query: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDLGLKV---- 791
            ++  G++D  F D+P DGIVFDE+D+ G +FW R+ R + L KG A+KF D GL++    
Sbjct: 810  LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKF-DQGLRLTNIN 868

Query: 792  ---NFQAPVFCRRNDIPQDYFLRKF--TFKLDAYDEGXXXXXXXXXXXYETIEINEKIDN 846
               + +  +F ++ +     FL KF  T+ L   DE             E +   E I  
Sbjct: 869  SLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISE 928

Query: 847  VNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW---SNVGNGV 903
             N+ L A P LSV+ GESIF+Y GY +L P Y+ +DKNG  N   IYS W   + +GNG+
Sbjct: 929  NNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGL 988

Query: 904  PIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDEN--------------------- 942
               + N   + +   D S ++E I   R+ A Y  CDE+                     
Sbjct: 989  KPRMENGSSFIIDGLDDSKNFE-IREKRLFAKYLECDESQESSDHLAEVEREGDETEDET 1047

Query: 943  ----------------DNCTIYFVVDATSWLR-----------------HFAHIFKLAKN 969
                            D  TI+  +     +R                 HFAHI+K+A +
Sbjct: 1048 EETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYS 1107

Query: 970  SILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVE 1029
             +L+F ICLTTFQELR+LR S+D+NV+EAATR+VI IR LY  +K+IP+RF G IA+H+E
Sbjct: 1108 GLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIE 1167

Query: 1030 ENLEFEEQITWKTHVDEFVIDAIAKLNQN--------------FQTERMIAENKNKNKQ- 1074
            E+LEFEEQITW++HV+EFVI+A+AK  +N              F  E M   +    KQ 
Sbjct: 1168 EHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQR 1227

Query: 1075 -----------FAVLVTXXXXXXXXXXXXXIKTCNTKYLFSLGSKLGINSGLCTN 1118
                        +VLVT             I+TC+T+++FS+ S+LG+  G+CTN
Sbjct: 1228 GNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/990 (47%), Positives = 641/990 (64%), Gaps = 98/990 (9%)

Query: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257
            +P  + +Q  ++KLQ+IYK IV QE ELQ+RC  LT SQTTELK+LW IYR+N+EL+ NY
Sbjct: 375  VPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNY 434

Query: 258  INFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            I FI TA+  TQP +D  +G+EI++IY +E+RLWVYG ITFLD+LKNFSNFMDPEVCCQF
Sbjct: 435  ITFITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQF 494

Query: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + FIS+SNML DIP KY + W Q+LGDLSRMAI+LYPS FIDW+LSAE WY  +M++ 
Sbjct: 495  IFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFT 554

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSG 437
            YG GKLYYH++TVQQN+LEAFVNLGKS+FC++ F PSQQ LQL+I NIYQ A+ D     
Sbjct: 555  YGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYAD----- 609

Query: 438  TNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFN--GNDVFDT 495
            +NN+     +  L+DY+KH EV LLP+F E+ +LQ VVLMYF +KFG D+N   N++F +
Sbjct: 610  SNNSNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFIS 669

Query: 496  KDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXR 555
            + MF QN +  + ++R++ AFAESQ+LQ++G+GN K+PF+LLF+               +
Sbjct: 670  RKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRK 729

Query: 556  SSATETPQYRDP--FHDKK--------------SPESYFQNIDALSSNFDD-IPTNLNIW 598
                   +   P  +H                 + E +F+NID +  N+   +P +++IW
Sbjct: 730  PKTMLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTI--NYPSFMPNSVDIW 787

Query: 599  LESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFW 658
              SL + N  SI+CS+ V  KFLHAPF+IALPH L W YF+++I+ +L+   +  +  FW
Sbjct: 788  NHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFW 847

Query: 659  IHFLRRTMPWNSMVSLANVLVCYMLDNL-HPFLKKELESFY-SFELDDLIEHFNENENLP 716
            + F+RR  PWNS+V   NVL+ YM+DN     +  EL  FY S  LD+L+ +FNENE LP
Sbjct: 848  VEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELP 907

Query: 717  EIWKCWGSLWFDAI---------KKCDVMEIP----------GVQDHLFFDSPLDGIVFD 757
            E+WKC GSLWFD I         K  +V+             GV+D+ FFD P+DG  FD
Sbjct: 908  EVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFD 967

Query: 758  EKDEIGERFWVRSVRAISLLKGIAKKFPDLG-LKVNFQAPVFCRRND------IPQDYFL 810
            E DEIGERFW R+ R I L K +A+ +  LG L ++++APVF RR D      + Q+  L
Sbjct: 968  ESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQE--L 1025

Query: 811  RKFTFKLDAYDEGXXXXXXXXXXXYETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTG 870
             +F+FKL+A  +G            + IE  E  D VN D   TP LS+V G+SIF+Y G
Sbjct: 1026 LEFSFKLNASSDGVMLD--------DIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVG 1077

Query: 871  YTRLAPDYHCFDKNGGFNSAFIYSQWS--NVGNGVPID----VSNEPIYDVTDNDLS--- 921
            Y R+ P+++ FDKNG F S   ++ WS  N+ N +  +    ++++ I   + ND +   
Sbjct: 1078 YKRVCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAAS 1137

Query: 922  -----LHWEKIFFDRIAAAYKNCDE----------NDNCTI----YFVVDATSWLRHFAH 962
                 ++   +F +     YK  +E            N ++    YF++DATSWLRHFAH
Sbjct: 1138 TNNDPMNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAH 1197

Query: 963  IFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRFTG 1022
            I+K+A + IL FAICLTTFQELRYLR SKD NVVEAATR++IT+RQLY E  ++P+RFTG
Sbjct: 1198 IYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTG 1257

Query: 1023 NIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTER-----MIAENKNKNKQFAV 1077
            N+ATH+EE+LEFEEQITW++HVDEFVI+A+ K  +  +T+R     M  + K K+    +
Sbjct: 1258 NVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEK-RTDRLNDINMDTDEKEKSIFGII 1316

Query: 1078 LVTXXXXXXXXXXXXXIKTCNTKYLFSLGS 1107
            LVT             IKT +T+++FS+ +
Sbjct: 1317 LVTDDITMKNKAMDRKIKTFSTRFIFSMAN 1346

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/978 (47%), Positives = 622/978 (63%), Gaps = 97/978 (9%)

Query: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259
            + Q +Q  ++KLQEIY+ IV QETELQQRC  LTTSQTT+LK+LW IY++N ELI NY  
Sbjct: 278  AKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFM 337

Query: 260  FIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319
            FI TALL TQP  DL++G+EI+++Y +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQFII
Sbjct: 338  FITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFII 397

Query: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379
            Y FIS+SNML DIP K+SI+W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++KY +G
Sbjct: 398  YVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFG 457

Query: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTN 439
             GKLYYH++TVQQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R      
Sbjct: 458  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER------ 511

Query: 440  NNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMF 499
             N   H+N+ L++YLKHTEVMLLPSFLE+ +LQ VVL +F+ KFG   N  D FD + +F
Sbjct: 512  -NSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVF 569

Query: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSSAT 559
             Q+ E L+++FRHA  +AES LLQL+GFG+P+NPFALLF+               +S ++
Sbjct: 570  VQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSS 629

Query: 560  ETPQYRDPFHDK---KSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHV 616
             + QY     D     +P  +F+ ID+    +   P ++NIW ESL++ N+T+++CS+ V
Sbjct: 630  TSTQYDTSIDDDCAFAAPSEFFETIDSTKYIY-KFPDDINIWKESLSYANVTAMKCSMIV 688

Query: 617  LTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLAN 676
            L KFLH P + ALPH L W YFL A   R+ TI   ++  FW+  +R+  P+N++++  N
Sbjct: 689  LRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLN 748

Query: 677  VLVCYMLDNLH---PFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIKKC 733
            VL+ YM +      PF  +  E F    L DL+ +F ENE LPE+W+CWG+LWFDA+   
Sbjct: 749  VLLLYMNNQTQANFPF-DEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTK 807

Query: 734  DVMEI-----PGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDLG 788
             +  +      GV+DH+F DSP+DGI FD  DE GE+FW R  R I L + +A + P +G
Sbjct: 808  HITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECP-VG 866

Query: 789  LK-----VNFQAPVFCRRNDIPQ---DYFLRKFTFKLDAYDEGXXXXXXXXXXXYETIEI 840
            L+      N+++ VF +  + P    D +L  FT   D +                    
Sbjct: 867  LREISGGRNWRSLVF-KFEEPPSEWCDMYLEPFTLVFDTF-------------------- 905

Query: 841  NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900
             E+I  VNLD RATP   +     I    GY  L PDY+CF++NG   +  +Y+  +   
Sbjct: 906  -EQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLES 964

Query: 901  NGVP---------------------------IDVSNEPIYDV----TDNDLSLHWEKIFF 929
            +G+                            ID   +PI D     T     + WE++  
Sbjct: 965  SGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQM-- 1022

Query: 930  DRIAAAYKNCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRG 989
              +     +C  + + T YFV+DAT+WLRHF H++KLA N+IL FAICLTTFQELR+LR 
Sbjct: 1023 --LPRGDLHCFADTHVT-YFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRK 1079

Query: 990  SKDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVI 1049
            SKD++V+EAATR+VIT+RQLY ERK++P+RFTGN+A H+EE+LE EEQ+TW++HVDEFVI
Sbjct: 1080 SKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVI 1139

Query: 1050 DAIAKLNQNFQ---------TERMIAENKNKNKQFAVLVTXXXXXXXXXXXXXIKTCNTK 1100
            +AI K    F          +   I    ++   F  LVT             IK  +T+
Sbjct: 1140 EAIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTR 1199

Query: 1101 YLFSLGSKLGINSGLCTN 1118
            ++FS+ ++LG    +CTN
Sbjct: 1200 FMFSVCNELGHAKNVCTN 1217

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/970 (47%), Positives = 627/970 (64%), Gaps = 79/970 (8%)

Query: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259
            S+Q +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT+LK+LW IY++NTELI NY+ 
Sbjct: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266

Query: 260  FIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319
            FI TALL +QP  DL++GQEI++IY +E+RLWV+G ITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326

Query: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379
            + FIS+SNML D+P K++  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WYT+++ +I+G
Sbjct: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386

Query: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTN 439
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R      
Sbjct: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER------ 440

Query: 440  NNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMF 499
             N    +NS +++YLKH+EVMLL SFLE+ +LQ VVL +F+NKFG   N  D F  + +F
Sbjct: 441  -NGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499

Query: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRS--- 556
             Q+ E  +Y+FRHAPAFAES +LQ++GFGNPKNPFALLF+               +S   
Sbjct: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSS 559

Query: 557  ---SATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCS 613
               ++ E P          SP  Y +++D+    + + PT+L IW +SL+HIN TSI+CS
Sbjct: 560  NSFTSMEAP-------SPTSPIEYLESVDSPRFVY-EFPTDLAIWQQSLSHINTTSIKCS 611

Query: 614  IHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVS 673
              VL KFLH P V A  H L W YFL+++  R++ + S ++  FWI   R+  PWNS+V+
Sbjct: 612  AVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVN 671

Query: 674  LANVLVCYMLDNL--HPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIK 731
              N+++ + LDN      +    E F S ++  L++HF++NE+LPE+WKCWG+LWFD I 
Sbjct: 672  FLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVIS 731

Query: 732  -KCDVMEIPG----VQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPD 786
             K DV++       VQDH+F D P+DGI FDE DE G RFW R+ R + + KGIA++F +
Sbjct: 732  DKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF-N 790

Query: 787  LGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXYETIEINEKIDN 846
            +GL +    P+  RR+ +   + L+ F FK     E               +   E I  
Sbjct: 791  MGLTLA-SVPLQSRRS-LAAGHPLQNFCFKF----EDPPVDSESYALISTQMPAFENISE 844

Query: 847  VNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGVPI- 905
             NLD  A P  S++ G+S+FE  GY +L  D+ CF+K G   +  +Y+  S +  G PI 
Sbjct: 845  RNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGS-LEKG-PIH 902

Query: 906  --DVSNEPIYDVTD----------NDLSLHWEKIFFDR------IAAAYK---------- 937
              D  N   Y  +D           +L    E+++ D       I   Y           
Sbjct: 903  GGDDFNTERYSRSDELNKADNPQIKELD-KMERMWLDTCMNPEFIEQTYDMKFPFGDLSC 961

Query: 938  NCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVE 997
            NCD       YFV DATSWLRHFAH++KLA N +L FAICLTTFQELR+LR SKD++VVE
Sbjct: 962  NCDSG---VSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVE 1018

Query: 998  AATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQ 1057
            AATR+VIT+RQLY E++++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K   
Sbjct: 1019 AATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQN 1078

Query: 1058 NFQT---------ERMIAENKNKNKQFAVLVTXXXXXXXXXXXXXIKTCNTKYLFSLGSK 1108
             F+             I   + +   F  LV+             I+T +++++F++ ++
Sbjct: 1079 KFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQ 1138

Query: 1109 LGINSGLCTN 1118
            +G+    CTN
Sbjct: 1139 IGLAHHACTN 1148

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/973 (46%), Positives = 633/973 (65%), Gaps = 82/973 (8%)

Query: 199  PSAQP-NQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257
            PS+ P +Q  ++KLQ+IY+ IV QE ELQ+RC  LTTSQTT+LK+LW IY++N ELI NY
Sbjct: 235  PSSSPTSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNY 294

Query: 258  INFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            + FI TALL +QP  DL++GQEI++IY +E+RLWV+G ITFLDVLKNFSNFMDPEVCCQF
Sbjct: 295  VAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQF 354

Query: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + FIS+S ML D+P K+S  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++ +I
Sbjct: 355  ITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHI 414

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSG 437
            +G GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R    
Sbjct: 415  FGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAER---- 470

Query: 438  TNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKD 497
               N   H+NS +++YLKH+EVMLL SFLE+ +LQ VVL +F++KFG   +  D F+ +D
Sbjct: 471  ---NGGNHRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRD 527

Query: 498  MFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRS- 556
            MF Q+ E ++Y+FRHAPAFAES +LQ +GFG+PKNPFALLF+               +S 
Sbjct: 528  MFLQDGERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSK 587

Query: 557  -----SATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQ 611
                 ++ ET  +        SP  Y +N+D+    + + P +L IW ESL+HIN+TS +
Sbjct: 588  SSHSFTSIETTSHL-------SPSEYLENVDSPRYAY-EFPEDLAIWRESLSHINITSAR 639

Query: 612  CSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSM 671
            CS  V  KFL  P V+A+ H L W YFL+++  +++++ S ++ +FWI  +R+  PWNS+
Sbjct: 640  CSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSI 699

Query: 672  VSLANVLVCYMLDN---LHPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFD 728
            V   N+L+ ++LDN     P +    E   S +   L+EHF+E+E+LPEIW+CWG+LWFD
Sbjct: 700  VDFLNMLMAFVLDNNWKTSP-IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFD 758

Query: 729  AI------KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAK 782
             I      +  DV+   G +DH F+D P DGI FDE DE+GE+FW R+ R I + KGIA+
Sbjct: 759  VIADKSNGEDGDVIN-SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQ 817

Query: 783  KFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXYETIEINE 842
            +F  LGL ++  AP    R  +   + L+ F+F      E               I + E
Sbjct: 818  EF-SLGLTLSAFAPQ--SRRPMTAGHPLQNFSFNF----EEIPAQSQIQSFVRNQIPLFE 870

Query: 843  KIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNG 902
            +I   NLD    P  S++ GESIF++ GY ++  DY CF+K+G   S  +Y+    +  G
Sbjct: 871  EIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTS-GKLERG 929

Query: 903  VPI----DVSNEPIYDVTDNDLSLHWEKIFFDR--------------IAAAYK------- 937
             PI    D + E      D++   + +    +R              I  AY+       
Sbjct: 930  -PIQGGDDFNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGD 988

Query: 938  ---NCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDN 994
               NCD       YFV+DATSWLRHFAH+FKLA N++L F ICLTTFQELR+LR SKD++
Sbjct: 989  LSCNCDSG---VSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDES 1045

Query: 995  VVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAK 1054
            VVEAATR+VIT+RQLY ++K++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K
Sbjct: 1046 VVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYK 1105

Query: 1055 LNQNFQT---------ERMIAENKNKNKQFAVLVTXXXXXXXXXXXXXIKTCNTKYLFSL 1105
              + F+             IA    +   F  LV+             I+T +T+++F++
Sbjct: 1106 AQKKFEAINAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAV 1165

Query: 1106 GSKLGINSGLCTN 1118
             +++G+    CTN
Sbjct: 1166 CNQIGLAHQACTN 1178

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/979 (46%), Positives = 623/979 (63%), Gaps = 93/979 (9%)

Query: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257
            +PS   +QT ++KLQEIYK IV QETELQ+RC  LTTSQTT+LK+LW IY+LN ELI NY
Sbjct: 314  VPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNY 373

Query: 258  INFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
              FI TALL TQP  DL++GQEI+++Y +E+RLW+YG ITFLDVLKNFSNFMDPEVCCQF
Sbjct: 374  FTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQF 433

Query: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I+Y FIS+SN+L +IP  +S++W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++KY 
Sbjct: 434  IVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYN 493

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSG 437
            +G GKLYYH++TVQQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R    
Sbjct: 494  FGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER---- 549

Query: 438  TNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKD 497
               N   H+ S +++YLKHTEVMLLPSFLEN++ Q VVL +F  KFG   + N  FD   
Sbjct: 550  ---NSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSAN-FFDPSL 605

Query: 498  MFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSS 557
            +F Q+ E L+++FRHA  +AES +LQL+GFG+P+NPFALLF+               +S 
Sbjct: 606  IFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSK 665

Query: 558  ATETPQYRDPFHDK--KSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIH 615
            +T + Q      D     P  +F+ +++  + +     +LNIW ESLN++N TS++CS+ 
Sbjct: 666  STASNQSDMSIDDTFLGDPVQFFETLNSTKTAY-RFSQDLNIWKESLNYVNKTSMRCSMV 724

Query: 616  VLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLA 675
            VL KFL++  + ALPH L W YFLVA+  RL+ I ++    FWI F+R+  PW S+ +  
Sbjct: 725  VLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFL 784

Query: 676  NVLVCYMLDNLHPF---LKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIKK 732
            NVL+ Y+ D   P    + + + ++ +  L +L+E+F ENE+LPE+W CWG+LWFD I  
Sbjct: 785  NVLLLYINDQ-KPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINS 843

Query: 733  CDVMEI-----PGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFP-- 785
              V  +      GV+DH+F D+P+DGI FD  DE GE+FW R VR I L +GIA +FP  
Sbjct: 844  KHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFG 903

Query: 786  --DLGLKVNFQAPVFCRRNDIPQDY---FLRKFTFKLDAYDEGXXXXXXXXXXXYETIEI 840
              +     ++++ VF + N+ P ++   +L  F+ +   +                    
Sbjct: 904  FTEFNGSDDWKSLVF-KFNEPPAEWKEQYLGSFSKEYGEF-------------------- 942

Query: 841  NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIY-SQWSNV 899
             E I  VN DL++ P+  +V G  I    GY +L PDY CF+KNG   +  +Y S  S  
Sbjct: 943  -ESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEG 1001

Query: 900  GNGVPID----------VSNEPIYDVTDNDLS--------------LHWEKIFFDRIAAA 935
            G+GVP D          + NE +      D +              L W    +    + 
Sbjct: 1002 GSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWR---YSSTNSR 1058

Query: 936  YKNCDE-------NDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLR 988
            ++ C          D    YFV+DAT+WLRHF H++KLA +++L FAICLTTFQELR+LR
Sbjct: 1059 WEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLR 1118

Query: 989  GSKDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFV 1048
             SKD++V+EAATR+VIT+RQLY ERK++P+RFTGN+A H+EE+LE EEQ+TW++HVDEFV
Sbjct: 1119 KSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFV 1178

Query: 1049 IDAIAKLNQNFQTERMIAENKNKNK---------QFAVLVTXXXXXXXXXXXXXIKTCNT 1099
            I+AI K    F      A+   +            F  LVT             I+  +T
Sbjct: 1179 IEAIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFST 1238

Query: 1100 KYLFSLGSKLGINSGLCTN 1118
            K++F++  ++G++  +CT+
Sbjct: 1239 KFMFAICHEIGLSKKVCTD 1257

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/971 (46%), Positives = 609/971 (62%), Gaps = 84/971 (8%)

Query: 207  FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALL 266
             ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI FI TALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 267  TTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVS 326
             +Q  + L +GQEI+D+Y +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y FI++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 327  NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 386
            NMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G GKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 387  IATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETAHK 446
            ++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R SSG   N T H 
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSG---NRTNH- 519

Query: 447  NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQNPESL 506
               ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF++KFG   +GN  FD   +F Q+ E L
Sbjct: 520  ---IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFIQDAERL 575

Query: 507  RYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRSSATETPQYRD 566
            +++FRH+  F++S +LQL GFG+PKNPFA+LF+               +S+ + +    D
Sbjct: 576  KHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLD 635

Query: 567  PF----HDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHVLTKFLH 622
            P       + S E +F  ID+    + + P +L +W  SL++IN+TS++C + VL +FL+
Sbjct: 636  PVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLY 694

Query: 623  APFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCY- 681
             P V ALPH L WL F+++I  RL+ +N   +  FWI F+RR  PW+S+++  N L+ Y 
Sbjct: 695  GPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYC 754

Query: 682  MLDNLHPF-LKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAI-KKCDV---- 735
            M+     F +   + ++     ++L+    ENENLPE W CWGSLWF+ I KK D+    
Sbjct: 755  MVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTT 814

Query: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAK-----KFPDLGLK 790
            +E  G+ D LF DSP +GI FD+ DE G ++W R  R + L   I +      +     K
Sbjct: 815  LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKK 874

Query: 791  VNFQAP----VFCRRNDIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXYETIEINEKIDN 846
            +N +A     +  R ND   D         ++ Y E            +E  EI   I N
Sbjct: 875  LNPEATSWKNLVFRFNDDTND------QLSVELYPE------ENESFPFEKFEI---ISN 919

Query: 847  VNL-DLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SNVGN 901
            +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N+  
Sbjct: 920  LNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQG 979

Query: 902  GVPID-----------VSNEPIYDVTDNDLSLHWEKIF----------FDRIAAAYKNCD 940
            G   +           V +   Y    + L   W + F           +R      NC 
Sbjct: 980  GDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQ 1039

Query: 941  ENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAAT 1000
             + N T +FV+DAT+WLRHFAHI+KLA +S+L FAICLTTFQELR+LR SKD++V+EAAT
Sbjct: 1040 ADTNVT-FFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAAT 1098

Query: 1001 RSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQ 1060
            R+VI +RQLY ERK++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK    F 
Sbjct: 1099 RAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFN 1158

Query: 1061 TERMIAENKNKNK-------------QFAVLVTXXXXXXXXXXXXXIKTCNTKYLFSLGS 1107
                 A  K K+               F  LVT             I+T +T+++F++  
Sbjct: 1159 VLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICR 1218

Query: 1108 KLGINSGLCTN 1118
            +LG  +G+CTN
Sbjct: 1219 ELGRETGVCTN 1229

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 66/140 (47%), Gaps = 15/140 (10%)

Query: 40  LHQKRHSSSSHNDTPESSFAKRRVP-GVVEPVGKGFI----DGVTNGQISAQNTPSKVDD 94
           LHQKRH+S+S  D  +S+  KRR   GV E V         +       S   +PSK+  
Sbjct: 14  LHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSPSKIRH 72

Query: 95  VSRRPSISRK---VMESTPQAKTASISTMDVPKSPYYVNRTAVARNMEVVSKESYDENAN 151
             + PSI++     ME TPQ +    S  + P+SP+Y+  T+   N E  +      N N
Sbjct: 73  HEKTPSITKPHTLQMEQTPQPRGVDTSG-EFPQSPFYLPTTS-QTNFEAATT----VNEN 126

Query: 152 PQMRIDESLVASNGIYNNSQ 171
             +R  +S+     + NN+Q
Sbjct: 127 SSIRRSDSVTRLTTVGNNTQ 146

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  447 bits (1149), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 226/378 (59%), Positives = 281/378 (74%), Gaps = 50/378 (13%)

Query: 205 QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264
           Q  I+KLQ+IYK+IV QE +LQ RC  LTTSQTT+LK+LW IY++N +LI NYINFI  A
Sbjct: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455

Query: 265 LLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324
           LL TQ  NDL +G+EI++IY +E+RLWVYG ITFLDVLK+FSNFMDPEVCCQFI + FI+
Sbjct: 456 LLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515

Query: 325 VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384
           +S +L DIP+KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575

Query: 385 YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETA 444
           YH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R       N   
Sbjct: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER-------NNGN 628

Query: 445 HKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFG-------------------- 484
           H+N QLI+YLKHTEVMLLP+FLE++DLQ+VVL+YF+ KFG                    
Sbjct: 629 HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGA 688

Query: 485 -----------------------KDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQL 521
                                  + F   D+F  +DMF QNP+ L+Y+FRH+  FA+S +
Sbjct: 689 NVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHI 748

Query: 522 LQLIGFGNPKNPFALLFQ 539
           LQL+GFG+PKNPFALLF+
Sbjct: 749 LQLVGFGDPKNPFALLFE 766

 Score =  416 bits (1068), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 234/584 (40%), Positives = 329/584 (56%), Gaps = 95/584 (16%)

Query: 575  ESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLT 634
            E +F+NID L   +  IP  + IWLESL +IN+ S++CSI VL KFL+ P +IALPH LT
Sbjct: 866  EEFFENIDLLQFPYK-IPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLT 924

Query: 635  WLYFLVAILKRLE-TINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCYMLDNLHP----- 688
            W++F+++IL ++E +I   Q   FW  FL+  +PWNS+V+  NVL+ Y+LDN++      
Sbjct: 925  WIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKL 984

Query: 689  --FLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIKKCDV----------- 735
               L  +  S  S  L+++++ FN+NENLPEIWKCWG+LWFD I   ++           
Sbjct: 985  IISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNN 1044

Query: 736  ------------------------MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSV 771
                                    +   G++DH   D PLDGI F   DE G  F+ RS+
Sbjct: 1045 NNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSI 1104

Query: 772  RAISLLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKL-DAYD--------- 821
            R I L K + + FP+LGLK++ +   +CR   IPQ++ L  F FKL + YD         
Sbjct: 1105 RLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQT 1164

Query: 822  ------------EGXXXXXXXXXXXYETIEINEKIDNVNLDLRATPNLSVVFG-ESIFEY 868
                        +             E  +I+E I+ +NL+L+  P LS++ G E+IF Y
Sbjct: 1165 EQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNY 1224

Query: 869  TGYTRLAPDYHCFDKNGGFNSAFIYSQW-----------------SNVGNGVPIDVSNEP 911
             GY RL  +   F +NG   S  IYS W                  ++ N   +   N  
Sbjct: 1225 LGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVT 1284

Query: 912  IYDVTDNDLSL-HWEKIFFDRIAAAYKNCDENDNC----------TIYFVVDATSWLRHF 960
            + D+T  D S   + K+ F    +   N  +  N             +FV DATSWLRHF
Sbjct: 1285 VGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHF 1344

Query: 961  AHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRF 1020
            AHI+KL+KN  L FA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY E K++P+RF
Sbjct: 1345 AHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRF 1404

Query: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERM 1064
            TGN+AT +EE+LEFEEQITW++HVDEFVI+AI +  + F+T+ +
Sbjct: 1405 TGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSI 1448

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 65/160 (40%), Gaps = 47/160 (29%)

Query: 22  NNNYSQTVTDM-RPTTTAFLHQKRHSSSSHNDTPESSFAKRRVPGVVEPVGK-------- 72
           NNN + ++ ++ RP        KRHSS+S+N+     F KRR+     P+          
Sbjct: 68  NNNITNSIGNIARP--------KRHSSNSYNNYKTIPFTKRRI-AACTPININNNNDNYN 118

Query: 73  -------------------GFIDGV---------TNGQISAQNTPSKVDDVSRRPS-ISR 103
                               FID +         TN    AQ TPSK   +SRRPS I R
Sbjct: 119 NNENMILMNNNNNNNNINNSFIDNLDYLSNTNNNTNMSTMAQYTPSKGTTISRRPSIIIR 178

Query: 104 KVMESTPQAKTASISTMDVPKSPYYVNRTAVARNMEVVSK 143
           K  +   Q+   + +T+  P +   VN T  A N +  S+
Sbjct: 179 KQQQQQQQSHFTTATTIKSPSNHTSVNITPQASNYDPASE 218

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  404 bits (1039), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 210/407 (51%), Positives = 273/407 (67%), Gaps = 69/407 (16%)

Query: 202 QPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFI 261
           + NQ  I+KLQ IYK+IV QE ELQ +C  L+TSQ+T+LK LW+IY+LN +LI NYI FI
Sbjct: 264 KSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFI 323

Query: 262 ITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYA 321
           +T+L  +Q IND ++G+EIL+IY +E+RLW+YG ITFLD+LKNF+NFMDPE+  QFI + 
Sbjct: 324 LTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHV 383

Query: 322 FISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 381
           F S+SNM+ D+P+ +   W QRLGDLSRMAI+LYPS FIDW+LS+EYWY ESMK+ +  G
Sbjct: 384 FESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHG 443

Query: 382 KLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNN- 440
           KLYYHI+TVQQN LEAFVNLGKSVFC D F PSQ+ +QL+I+NIYQ AFI+R S+ +++ 
Sbjct: 444 KLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSN 503

Query: 441 ------------NETAHKNSQ---LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGK 485
                         +  KN Q   LI+YLKH+EVMLLP+FLEN  L+ VVL YF N FGK
Sbjct: 504 NAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGK 563

Query: 486 ----------------------------------------------------DFNGNDVF 493
                                                                 N  ++F
Sbjct: 564 IAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLF 623

Query: 494 DTKDMFCQ-NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQ 539
           + +++F Q N + L+Y+F+++  FAES +LQLIGFG+PKNPFALLFQ
Sbjct: 624 NFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQ 670

 Score =  222 bits (565), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 155/249 (62%), Gaps = 44/249 (17%)

Query: 848  NLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGVPIDV 907
            N DL   P LS++  ES+FEY GY R  PD+  FDKNG   S  +Y+  S + + +    
Sbjct: 1157 NTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYT--STIIDTINGSS 1214

Query: 908  SNEPIYDVTDN-------------------------------DLSLHWEKIFFDRIAAAY 936
            SN  I + T N                               +L L  ++IF   +   Y
Sbjct: 1215 SNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKILDPDY 1274

Query: 937  KNCDE-------NDNCT----IYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELR 985
            KN DE       +D        YFV+DATSWLRHFAH++KLA N IL FAICLTTFQELR
Sbjct: 1275 KNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELR 1334

Query: 986  YLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVD 1045
            +LR SKD+NV+EAATR++IT+RQLY E++++P+RFTGNIATH+EE+LEFEEQITW++HVD
Sbjct: 1335 FLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVD 1394

Query: 1046 EFVIDAIAK 1054
            EFVI+AI +
Sbjct: 1395 EFVIEAIKR 1403

 Score =  212 bits (540), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 106/263 (40%), Positives = 162/263 (61%), Gaps = 11/263 (4%)

Query: 565  RDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHVLTKFLHAP 624
             D   D  SP+ +F N+++L  +F  +P +L IW ESL +IN+ S+ CSI VL KFL+ P
Sbjct: 779  EDEMLDNLSPQDFFNNLESLKLSFF-LPNSLEIWNESLKYINIISLNCSIIVLKKFLNGP 837

Query: 625  FVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCYMLD 684
              ++LPH L W YF++++  R+E++ + +   FW+ F+R+  PWNS+VS  NV++  +LD
Sbjct: 838  LFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLD 897

Query: 685  NLH--PFLKKELESFYSFELDDLIEHFNENE-NLPEIWKCWGSLWFDAIKKC------DV 735
            N +    + K + ++ +  LD+L+  FNENE  LPE+WKC+GSLWFD I +       D 
Sbjct: 898  NCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDC 957

Query: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDL-GLKVNFQ 794
             +   ++D    + P+DG+ FDE +E G  FW RS R I L K +  +F    GL ++  
Sbjct: 958  SKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSN 1017

Query: 795  APVFCRRNDIPQDYFLRKFTFKL 817
              V+C R+DIP ++ LR F FKL
Sbjct: 1018 TSVYCNRSDIPNNHILRTFAFKL 1040

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  142 bits (357), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 174/845 (20%), Positives = 344/845 (40%), Gaps = 157/845 (18%)

Query: 227  QRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGM 286
            Q  L+L  ++      L  +++L+T+++  Y  FI  AL       DLI G+E +    +
Sbjct: 128  QALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRL 187

Query: 287  EKRLWVYGIITFLDVLKNFSNFM----------DPEVCCQFIIYAFISVSNMLEDIPLKY 336
             +RL  + +   L++++N+ N M          + +   +FI    I +++MLE+IPLK+
Sbjct: 188  NERLINHCLKPLLEIIENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKF 247

Query: 337  SILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TESMKYIYGCGK--------- 382
               W   +GDL+R+ + L       +RL++ + Y       ++ Y    GK         
Sbjct: 248  HYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMC 307

Query: 383  -LYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNN 441
              Y++++ VQ +SL   V L K +  ++     +   QL I+ I         +   N  
Sbjct: 308  NYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAIDKIISKLL----NKQVNLK 363

Query: 442  ETAHKNSQLIDYLKHTEVMLLPSFLENMD-LQHVVLMYFKNKFGKDFNGNDVFDTKDMFC 500
            ++    + L+ Y     +    +    +  ++   L YF N+F  +++ N     K + C
Sbjct: 364  QSMGGTTILMKYFTLLSLFFGSTSSSQLSGMERSSLHYFWNEFANEYHLNYSSLRKPVNC 423

Query: 501  QNPES----LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQXXXXXXXXXXXXXXXRS 556
            +  +       +YF +AP F+   +++ I      NPF  +++                 
Sbjct: 424  KYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVYKS---------------- 467

Query: 557  SATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHV 616
                                        S +F+    +L+ W   +  ++ T +  +  +
Sbjct: 468  ----------------------------SDDFEIKSVSLSNWKILIEQMDDTLLHSNKLL 499

Query: 617  LTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLAN 676
              KFL     I+ P  L WL F +++   +  +  + V+  W   L+  +PW+ +V+  N
Sbjct: 500  FKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVTYLN 559

Query: 677  VLVCYMLDNLHPFLKKELESFY----SFELDDLIEHFNENENLPEIWKCWGSLWFDA--- 729
              +  +  N H    K L +      S  L DL+ +     N  EI  C G +WFD+   
Sbjct: 560  ESIDMV--NKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLAS 617

Query: 730  -IKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDLG 788
             IK+  +     +     +++  D +++D+ D++  + W R++  I L+K +   +P+L 
Sbjct: 618  KIKQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRALLIILLIKNVINDYPEL- 676

Query: 789  LKVNFQAPVF----CRRN-DIPQDYFLRKFTFKLDAYDEGXXXXXXXXXXXYETIEINEK 843
            + V+ +        C +N D   + +L  + F+L+  +                + I++ 
Sbjct: 677  IDVSIRGQSLTNSSCIKNSDSLTNDYLFDWGFELNNNN---------------AVIIDDT 721

Query: 844  IDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGV 903
            +   N                IF+++      PD+  FDKNG     + YS  SN     
Sbjct: 722  LHGRN---------------RIFKFS----YIPDFQDFDKNGDI--TWGYSLISN----- 755

Query: 904  PIDVSNEPIYD-VTDNDLSLHWEKIFFD----RIAAAYKNCDENDNCTI-------YFVV 951
                     YD +  ND +   +  FF     R+ +A+ +  E+ +          YF+V
Sbjct: 756  ---------YDYIYSNDFNSEEDGNFFQRYSRRLLSAHNDYSEDKSKKYLPKLENNYFMV 806

Query: 952  DATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRG-SKDDNVVEAATRSVITIRQLY 1010
            D  +WL+H   + +      +   + ++   +L  L+  S+ ++V  +A+R +I I  LY
Sbjct: 807  DTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLY 866

Query: 1011 DERKI 1015
               +I
Sbjct: 867  AMNQI 871

>KLTH0F09592g Chr6 (830181..832910) [2730 bp, 909 aa] {ON} similar
           to uniprot|P53119 Saccharomyces cerevisiae YGL141W
          Length = 909

 Score = 32.7 bits (73), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 18/91 (19%)

Query: 564 YRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINM-------TSIQCSIHV 616
           YR+  H  +S E   +N + L    D       I  E L+H+ +       T     + +
Sbjct: 451 YREKLHSSQSEEDEAENFNLLERKRD-------IRQEFLSHLELSFSNRPSTRQFRKLGI 503

Query: 617 LTKFLHAPFVIALPHFLTWLYFLVAI-LKRL 646
           LTK   APF I     + WLYFL+++  KRL
Sbjct: 504 LTK---APFFIPFRQRVEWLYFLISLDRKRL 531

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 123,080,585
Number of extensions: 5663987
Number of successful extensions: 17720
Number of sequences better than 10.0: 45
Number of HSP's gapped: 18064
Number of HSP's successfully gapped: 73
Length of query: 1118
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 998
Effective length of database: 39,721,479
Effective search space: 39642036042
Effective search space used: 39642036042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)