Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.175.707ON25125110711e-149
Skud_9.165.707ON2262337691e-103
Suva_9.365.707ON2242337621e-102
YIL152W5.707ON2352357182e-95
TPHA0E001805.707ON165971212e-07
TDEL0B021305.707ON2081101081e-05
TBLA0I016905.707ON3201001031e-04
NCAS0G002105.707ON2881461021e-04
ZYRO0B16434g5.707ON237119910.003
NDAI0F002705.707ON298110890.006
KNAG0L021605.707ON209102840.020
Kpol_1043.745.707ON17724750.25
KLTH0E00946g5.707ON215133740.49
KAFR0D022005.707ON182108691.8
SAKL0B09526g7.101ON109976667.3
NOTE: 4 genes in the same pillar as Smik_9.17 were not hit in these BLAST results
LIST: Kwal_55.19675 KLLA0A00506g Cgla_YGOB_Anc_5.707 SAKL0E15026g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.17
         (251 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)    417   e-149
Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)    300   e-103
Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)    298   e-102
YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...   281   2e-95
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    51   2e-07
TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.70...    46   1e-05
TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...    44   1e-04
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    44   1e-04
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    40   0.003
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    39   0.006
KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {O...    37   0.020
Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {...    33   0.25 
KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved...    33   0.49 
KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.70...    31   1.8  
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    30   7.3  

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score =  417 bits (1071), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 212/251 (84%), Positives = 212/251 (84%)

Query: 1   MIIHTNNEVKEASVPCKQMSHKRRGLVIYQDQKXXXXXXXXXXXXXXXXXXXXPHHPLKQ 60
           MIIHTNNEVKEASVPCKQMSHKRRGLVIYQDQK                    PHHPLKQ
Sbjct: 1   MIIHTNNEVKEASVPCKQMSHKRRGLVIYQDQKQQQRPSGQSISSISWSPKQRPHHPLKQ 60

Query: 61  QSTNNFTAILSKSTVQQDVQQDRSHLPISSLVLKXXXXXXXXXXXXXXXXXXXSGPPLRK 120
           QSTNNFTAILSKSTVQQDVQQDRSHLPISSLVLK                   SGPPLRK
Sbjct: 61  QSTNNFTAILSKSTVQQDVQQDRSHLPISSLVLKQEQHQQNEEQRRRNMQQQNSGPPLRK 120

Query: 121 LVQESQWTSSTSHCHSRKQEKIPQGFYSSDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIH 180
           LVQESQWTSSTSHCHSRKQEKIPQGFYSSDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIH
Sbjct: 121 LVQESQWTSSTSHCHSRKQEKIPQGFYSSDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIH 180

Query: 181 DLSRTTILSSNELLIKLPMEETIILHSRTPTINEEWLHNKVSNPGASLVIDSRSFLILCN 240
           DLSRTTILSSNELLIKLPMEETIILHSRTPTINEEWLHNKVSNPGASLVIDSRSFLILCN
Sbjct: 181 DLSRTTILSSNELLIKLPMEETIILHSRTPTINEEWLHNKVSNPGASLVIDSRSFLILCN 240

Query: 241 NIKWYLHWKFI 251
           NIKWYLHWKFI
Sbjct: 241 NIKWYLHWKFI 251

>Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)
          Length = 226

 Score =  300 bits (769), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 163/233 (69%), Positives = 175/233 (75%), Gaps = 7/233 (3%)

Query: 19  MSHKRRGLVIYQDQKXXXXXXXXXXXXXXXXXXXXPHHPLKQQSTNNFTAILSKSTVQQD 78
           MSHKRRGLVIYQDQK                     HHPLKQQS+N+FT ILSKS+VQQD
Sbjct: 1   MSHKRRGLVIYQDQKQQQQPSGQSLSSISWSPTRRHHHPLKQQSSNSFTEILSKSSVQQD 60

Query: 79  VQQDRSHLPISSLVLKXXXXXXXXXXXXXXXXXXXSGPPLRKLVQESQWTSSTSHCHSRK 138
           V+QD SHLPISSLVLK                   SGPPLRK+VQ+SQWTSST HC SRK
Sbjct: 61  VRQDSSHLPISSLVLKQQQQRRNMPSQN-------SGPPLRKVVQDSQWTSSTIHCPSRK 113

Query: 139 QEKIPQGFYSSDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIHDLSRTTILSSNELLIKLP 198
           QEK    FY +DSKLVSQLH+SVKDLD I+QTHKP+FDTIIHDLS T ILSSNELLIKLP
Sbjct: 114 QEKQSLTFYRTDSKLVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIKLP 173

Query: 199 MEETIILHSRTPTINEEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251
           M +TIILHSR P IN EWLHNK S+P ASLVIDSRSFLILCNNIKWYLHWKFI
Sbjct: 174 MNDTIILHSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score =  298 bits (762), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 161/233 (69%), Positives = 172/233 (73%), Gaps = 9/233 (3%)

Query: 19  MSHKRRGLVIYQDQKXXXXXXXXXXXXXXXXXXXXPHHPLKQQSTNNFTAILSKSTVQQD 78
           M HKRRGLVIYQDQK                      HPLKQQSTN+FTAILSKS ++QD
Sbjct: 1   MGHKRRGLVIYQDQKQQQHSPGKSISSLAWSAAQ--QHPLKQQSTNSFTAILSKSCLRQD 58

Query: 79  VQQDRSHLPISSLVLKXXXXXXXXXXXXXXXXXXXSGPPLRKLVQESQWTSSTSHCHSRK 138
           VQQD SHLPISSLVLK                   SGPPLRKLVQ SQWTSS +H  S K
Sbjct: 59  VQQDSSHLPISSLVLKQQQQQQQHPSQS-------SGPPLRKLVQNSQWTSSATHRPSWK 111

Query: 139 QEKIPQGFYSSDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIHDLSRTTILSSNELLIKLP 198
           QEK P+ FY +DS+LVSQLHSSVKDLD I+QTHKP+FDTIIHDLS TTILS NELLIKL 
Sbjct: 112 QEKQPKAFYHTDSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLH 171

Query: 199 MEETIILHSRTPTINEEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251
            E+TIILHSRTP IN EWL NKVSN GASLVIDSRSFLILC+NIKWYLHWKFI
Sbjct: 172 TEDTIILHSRTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score =  281 bits (718), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 156/235 (66%), Positives = 172/235 (73%), Gaps = 2/235 (0%)

Query: 19  MSHKRRGLVIYQDQKXXXXXXXXXXXXXXX-XXXXXPHHPLKQQSTNNFTAILSKSTVQQ 77
           MSHKRRGLVIYQDQK                     PHHPLKQQSTN+F+ ILSKS+VQ 
Sbjct: 1   MSHKRRGLVIYQDQKQQQQHPPGQSLSSISWSPTRRPHHPLKQQSTNSFSEILSKSSVQP 60

Query: 78  DVQQDRSHLPISSLVLKXXX-XXXXXXXXXXXXXXXXSGPPLRKLVQESQWTSSTSHCHS 136
           +VQ D +H+PIS LVLK                    S PPLR+LVQESQWTSS S+   
Sbjct: 61  NVQHDGNHMPISLLVLKQEHHKQQQQQQQRQNIRSQNSTPPLRQLVQESQWTSSASNSSL 120

Query: 137 RKQEKIPQGFYSSDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIHDLSRTTILSSNELLIK 196
           +KQEK PQ FY++DSKLVSQLHSSVKDLDAIIQTHKPKFDTII D S+ TILSSNELLIK
Sbjct: 121 KKQEKQPQTFYNTDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIK 180

Query: 197 LPMEETIILHSRTPTINEEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251
           LP ++TIILHSR P IN EWL NKV++P ASLVIDSRSFL LCNNIKWYLHWKFI
Sbjct: 181 LPKDQTIILHSRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 4/97 (4%)

Query: 154 VSQLHSSVKDLDAIIQTHKPKFDTIIHDLSRTTILSSNELLIKLPMEETIILHSRTPTIN 213
           VS L  S+   + +++    K+D I HD++    LS NE ++     +T+ILHS    + 
Sbjct: 59  VSDLRLSINKFNMLLKASSNKYDEI-HDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVV 117

Query: 214 EEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKF 250
                N  +     + I+S+ +L L N++ WYL WKF
Sbjct: 118 NS---NNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151

>TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.707
           YIL152W
          Length = 208

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 9/110 (8%)

Query: 144 QGFYSS-DSKLVSQLHSSVKDLDAIIQTHKPKFDTIIHDLSRTTILSSNELLIKLPMEET 202
           QG  +S D  L + +  ++  L+  IQ    + D ++    R  +LS +ELL+ +   + 
Sbjct: 106 QGLETSRDKSLSTAVSVALSHLNTRIQVLSGELDQLMA-FERLVLLSQHELLV-VTQRKI 163

Query: 203 IILHSRTPTINEEWLHNKVSNPGA-SLVIDSRSFLILCNNIKWYLHWKFI 251
            +LHS  P   E      VS  GA  L ++S+ + +L N++ W++ WKF 
Sbjct: 164 FVLHSVIPLTRE-----GVSRFGALKLAVNSQCYYVLYNDVVWFMRWKFF 208

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 5/100 (5%)

Query: 153 LVSQLHSSVKDLDAIIQTHKP-KFDTIIHDLSRTTILSSNELLIKLPMEETIILHSRTPT 211
           LV+ LH+ + +L+  I + +  KFD I   +S+ T LS  ELL+      +++LHS + T
Sbjct: 225 LVNGLHTILSNLNTRIHSSRNLKFDKIFQ-ISKLTKLSDTELLVITNTNSSLLLHSDS-T 282

Query: 212 INEEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251
           I +   +N        +  +S S L +  ++ WYL WKFI
Sbjct: 283 IGQSEFNNYT--LKEKVATNSISILKITEDLNWYLKWKFI 320

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 71/146 (48%), Gaps = 22/146 (15%)

Query: 117 PLRKLVQESQWTSSTSHCHSRKQEKIPQGFYSSDSKLVSQLHSSVKDLDAIIQTHKPKFD 176
           PL K +  +  +  +S  +S  + KI           V+ L   + DLD +++T K    
Sbjct: 151 PLPKKLSRTSTSDVSSRDNSNNEPKI----------FVTSLQKYLCDLDTMMKTSKKFSY 200

Query: 177 TIIHDLSRTTILSSNELLIKLPME-ETIILHSRTPTINE----EWLHNKVSN------PG 225
             +  ++  T LS  EL +   M  + IILH++T +IN     +++H+   N        
Sbjct: 201 DSVWTINSITKLSDFELQVTTQMSPQLIILHNKT-SINNIPILKFIHDVSINTKIQVTES 259

Query: 226 ASLVIDSRSFLILCNNIKWYLHWKFI 251
             L I+S+SF+ + ++I WY+ WKFI
Sbjct: 260 LKLAINSKSFIKVSDDINWYIDWKFI 285

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 54/119 (45%), Gaps = 18/119 (15%)

Query: 140 EKIPQGFYSSDSKLVSQLHSSVKDLDAIIQT--HKPKFDTIIHDLSRTTILSSNELLIKL 197
           EK         + LV+QL  ++ D + +++T      +D ++ D+     LS        
Sbjct: 130 EKCASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILV-DIRHAIWLS-------- 180

Query: 198 PMEETIILHSRTPTINEEWLHN-----KVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251
           P E  I++ S  P +    LH+     K  N  + L I S+  L L N++ WYL WKF+
Sbjct: 181 PFE--IMVISDDPRVKRAILHSHKAIPKFVNSPSRLAICSKCCLTLYNDMNWYLKWKFL 237

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 13/110 (11%)

Query: 151 SKLVSQLHSSVKDLDAIIQTHKP-KFDTIIHDLSRTTILSSNELLIK--------LPMEE 201
           S L+  L  S+ DLD  ++T     +DT++  ++   +LS +E+ I            + 
Sbjct: 193 SALLQSLQKSLCDLDTSLKTLSYHSYDTLL-TVTSFEMLSDHEIKINSVKNYTAGFTTDV 251

Query: 202 TIILHSRTPTINEEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251
           T++LHS+  ++N    +N   +    L +DS+ +L L  N+KWYL WKFI
Sbjct: 252 TMLLHSKI-SLNVPLPNN--LHKDYKLALDSKVYLELAPNVKWYLVWKFI 298

>KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {ON}
           Anc_5.707 YIL152W
          Length = 209

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 55/102 (53%), Gaps = 6/102 (5%)

Query: 153 LVSQLHSSVKDLDAIIQT--HKPKFDTIIHDLSRTTILSSNELLIKLP-MEETIILHSRT 209
           LV QL  S+  L+ ++ T  H   +D ++  ++    LSS+EL+++     +  +LHS  
Sbjct: 107 LVQQLQRSLGRLNQLVLTTGHSRHYDALV-GVTGCLKLSSHELMLETGHSSKRYVLHSNG 165

Query: 210 PTINEEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251
           P     +L +++++ G ++ + S+  + +  ++ W L WK +
Sbjct: 166 PV--HGFLLDQIASGGYTVALYSKLAVRVTPDLYWCLQWKLV 205

>Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {ON}
           complement(158958..159491) [534 nt, 178 aa]
          Length = 177

 Score = 33.5 bits (75), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 226 ASLVIDSRSFLILCNNIKWYLHWK 249
           A + I+S SF+ L  N+ WYLHW+
Sbjct: 152 AKIAINSNSFVHLYGNVNWYLHWR 175

>KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved
           hypothetical protein
          Length = 215

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 59/133 (44%), Gaps = 18/133 (13%)

Query: 128 TSSTSHCHSRKQEKIPQGFYSSDS------KLVSQLHSSVKDLDAIIQTHKPKFDTIIHD 181
           T +  H  +R +++    F +  +      K VS   ++ +     + TH+  +D  +H 
Sbjct: 92  TPTKPHYRARAKKRYDLAFPAGKALVNRLLKCVSAFETNRRLQRHGLSTHE--YDRKLH- 148

Query: 182 LSRTTILSSNELLI--KLPM-EETIILHSRTPTINEEWLHNKVSNPGASLVIDSRSFLIL 238
           +  T +LS  ELL     P+  E +ILH    T + E         G+ L++ S +  +L
Sbjct: 149 VQYTKLLSPTELLAVAAGPLGREVLILHMLPSTKDAE------PKSGSQLLLSSNASALL 202

Query: 239 CNNIKWYLHWKFI 251
              ++WY  W+ I
Sbjct: 203 YPGLRWYFEWRVI 215

>KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.707
           YIL152W
          Length = 182

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 19/108 (17%)

Query: 153 LVSQLHSSVKDLDAIIQTHK--PKFDTIIHDLSRTTILSSNELLIKLPMEETI--ILHS- 207
           L   L  S+ DL+A++   K   K+D +I  ++    LSS E+LI    +E +  ILH  
Sbjct: 84  LAISLQKSLWDLNALVTVSKNNKKYDLLIK-VASARRLSSTEMLIIPSTDEAMRYILHKP 142

Query: 208 ---RTPTINEEWLHNKVSN-PGASLVIDSRSFLILCNNIKWYLHWKFI 251
              RT         N V N  GA L ++S+    L + + W L+WK +
Sbjct: 143 LTFRT---------NSVDNFTGAHLALNSKISFRLDDTLIWCLNWKLL 181

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 8/76 (10%)

Query: 118 LRKLVQESQWTSSTSHCHSRKQEKIPQGFYSSDSKLVSQLHSSVKDLDAIIQTHKPKFDT 177
           L K+ +E Q  S+  + +  +  K+ QG      +L SQL +  +DL+ + +  + +FD+
Sbjct: 351 LEKIREEIQKNSAQINYYRGRSAKLKQGI----EELESQLENQREDLNGLKEPEQGEFDS 406

Query: 178 IIHDLSRTTILSSNEL 193
           I  D  RT +  S+EL
Sbjct: 407 I--DTERTKL--SDEL 418

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.129    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,157,628
Number of extensions: 802319
Number of successful extensions: 2642
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2712
Number of HSP's successfully gapped: 29
Length of query: 251
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 144
Effective length of database: 41,212,137
Effective search space: 5934547728
Effective search space used: 5934547728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)