Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.1687.196ON43143122760.0
YIL022W (TIM44)7.196ON43143121640.0
Skud_9.1477.196ON43143121300.0
Suva_9.1777.196ON43543521230.0
TDEL0H025107.196ON41841617750.0
Kpol_1063.97.196ON41739817660.0
CAGL0J02442g7.196ON41240617510.0
NDAI0B017807.196ON43443217460.0
NCAS0A125207.196ON43240417420.0
SAKL0F07502g7.196ON41240417300.0
TPHA0C045307.196ON41640817050.0
KLLA0D16214g7.196ON41838617020.0
Kwal_55.203687.196ON41240516840.0
ZYRO0D15840g7.196ON40739816700.0
KLTH0E04554g7.196ON47938716750.0
KNAG0H026907.196ON41940416640.0
Ecym_43807.196ON41839716180.0
KAFR0A026407.196ON42142115950.0
ADL118C7.196ON41839415870.0
TBLA0J015007.196ON42142313740.0
NCAS0F025005.296ON831144731.9
TPHA0E033901.162ON68594713.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.168
         (431 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W ...   881   0.0  
YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}  TIM44Essen...   838   0.0  
Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W ...   825   0.0  
Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W ...   822   0.0  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...   688   0.0  
Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON} (26537.....   684   0.0  
CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa] ...   679   0.0  
NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {O...   677   0.0  
NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa] ...   675   0.0  
SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {...   671   0.0  
TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {O...   661   0.0  
KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]...   660   0.0  
Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022...   653   0.0  
ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]...   647   0.0  
KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} simila...   649   0.0  
KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...   645   0.0  
Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar t...   627   0.0  
KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.1...   619   0.0  
ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON} S...   615   0.0  
TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7....   533   0.0  
NCAS0F02500 Chr6 complement(491248..492601,492690..493831) [2496...    33   1.9  
TPHA0E03390 Chr5 (719360..721417) [2058 bp, 685 aa] {ON} Anc_1.1...    32   3.8  

>Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/431 (100%), Positives = 431/431 (100%)

Query: 1   MYRSTFIRSSGTSSRTIAARYRSGDTGLMIARVLFSTSATRTQGGNPRSPLQIFRDTFKK 60
           MYRSTFIRSSGTSSRTIAARYRSGDTGLMIARVLFSTSATRTQGGNPRSPLQIFRDTFKK
Sbjct: 1   MYRSTFIRSSGTSSRTIAARYRSGDTGLMIARVLFSTSATRTQGGNPRSPLQIFRDTFKK 60

Query: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA 120
           EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA
Sbjct: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA 120

Query: 121 TKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180
           TKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR
Sbjct: 121 TKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180

Query: 181 RLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN 240
           RLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN
Sbjct: 181 RLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN 240

Query: 241 KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPE 300
           KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPE
Sbjct: 241 KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPE 300

Query: 301 ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQ 360
           ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQ
Sbjct: 301 ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQ 360

Query: 361 DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420
           DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL
Sbjct: 361 DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420

Query: 421 EFVRGGSRQFT 431
           EFVRGGSRQFT
Sbjct: 421 EFVRGGSRQFT 431

>YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}
           TIM44Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); tethers the
           import motor and regulatory factors (PAM complex) to the
           translocation channel (Tim23p-Tim17p core complex)
          Length = 431

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/431 (96%), Positives = 426/431 (98%)

Query: 1   MYRSTFIRSSGTSSRTIAARYRSGDTGLMIARVLFSTSATRTQGGNPRSPLQIFRDTFKK 60
           M+RSTFIR+SGTSSRT+ ARYRS  TGL++ARVLFSTS TR QGGNPRSPLQIFRDTFKK
Sbjct: 1   MHRSTFIRTSGTSSRTLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKK 60

Query: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA 120
           EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA
Sbjct: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA 120

Query: 121 TKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180
           TKAWESELGKNTRKAA+ATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR
Sbjct: 121 TKAWESELGKNTRKAAAATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180

Query: 181 RLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN 240
           RLKRE+DLASGKRHRAVKSN++AGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN
Sbjct: 181 RLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN 240

Query: 241 KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPE 300
           KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFK+MDPTFSNESFTRHLREYIVPE
Sbjct: 241 KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPE 300

Query: 301 ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQ 360
           ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVE+VSAKLLAPQ
Sbjct: 301 ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQ 360

Query: 361 DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420
           DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL
Sbjct: 361 DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420

Query: 421 EFVRGGSRQFT 431
           EFVRGGSRQFT
Sbjct: 421 EFVRGGSRQFT 431

>Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/431 (92%), Positives = 420/431 (97%)

Query: 1   MYRSTFIRSSGTSSRTIAARYRSGDTGLMIARVLFSTSATRTQGGNPRSPLQIFRDTFKK 60
           MYRST I++S   +RT AA YRS D GL++ARVLFSTSATR QGGNPRSPLQIFRDTFKK
Sbjct: 1   MYRSTLIKTSAAGTRTAAAGYRSQDAGLLVARVLFSTSATRAQGGNPRSPLQIFRDTFKK 60

Query: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA 120
           EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYL+AQRGSTIVGKTLKKTGETMEHIA
Sbjct: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLRAQRGSTIVGKTLKKTGETMEHIA 120

Query: 121 TKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180
           TKAWESELGKNTRKAASATAK+LDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR
Sbjct: 121 TKAWESELGKNTRKAASATAKRLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180

Query: 181 RLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN 240
           RLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDF+EKT +GRSIQSLKN
Sbjct: 181 RLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFREKTAMGRSIQSLKN 240

Query: 241 KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPE 300
           +LWDESENPLIV+MRK+TNKVGGFFAETESSRV+SQFK+MDPTFSNESFTRHLR+YIVPE
Sbjct: 241 RLWDESENPLIVIMRKVTNKVGGFFAETESSRVHSQFKLMDPTFSNESFTRHLRDYIVPE 300

Query: 301 ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQ 360
           ILEAYVK DVKVLKKWFSEAP+NVYAAQQKIF+EQDVYADGRILDIRGVE+VSAKLLAPQ
Sbjct: 301 ILEAYVKADVKVLKKWFSEAPYNVYAAQQKIFREQDVYADGRILDIRGVEIVSAKLLAPQ 360

Query: 361 DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420
           DIPVLVVGCRAQEINLYRK+KTGEIAAG+EANILMSSYAMVFTRDPEQIDDDETEGWKIL
Sbjct: 361 DIPVLVVGCRAQEINLYRKRKTGEIAAGNEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420

Query: 421 EFVRGGSRQFT 431
           EFVRGGSRQFT
Sbjct: 421 EFVRGGSRQFT 431

>Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W
           (REAL)
          Length = 435

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/435 (92%), Positives = 417/435 (95%), Gaps = 4/435 (0%)

Query: 1   MYRSTFIRSSGT----SSRTIAARYRSGDTGLMIARVLFSTSATRTQGGNPRSPLQIFRD 56
           MYRST   ++       SRT+AA  R  D GL+IAR LFSTSATR QGGNPRSPLQIFRD
Sbjct: 1   MYRSTLTTTTAAAAAAGSRTLAAGCRPQDAGLLIARALFSTSATRAQGGNPRSPLQIFRD 60

Query: 57  TFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETM 116
           TFKKEW+KSQELQENIKTLQDASGKLGESEAYKKAREAYL+AQRGSTIVGKTLKKTGET+
Sbjct: 61  TFKKEWDKSQELQENIKTLQDASGKLGESEAYKKAREAYLRAQRGSTIVGKTLKKTGETV 120

Query: 117 EHIATKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFIT 176
           EHIAT+AW+SELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFIT
Sbjct: 121 EHIATRAWDSELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFIT 180

Query: 177 KEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQ 236
           KEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKT VGRSIQ
Sbjct: 181 KEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTAVGRSIQ 240

Query: 237 SLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREY 296
           SLKN+LWDESENPLIV+MRK+TNKVGGFFAETESSRVYSQFKMMDPTFSNE+FTRHLREY
Sbjct: 241 SLKNRLWDESENPLIVIMRKVTNKVGGFFAETESSRVYSQFKMMDPTFSNENFTRHLREY 300

Query: 297 IVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEVVSAKL 356
           IVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDV+ADGRILDIRGVE+VSAKL
Sbjct: 301 IVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVFADGRILDIRGVEIVSAKL 360

Query: 357 LAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEG 416
           LAPQDIPVLVVGCRAQEINLYRK+KTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEG
Sbjct: 361 LAPQDIPVLVVGCRAQEINLYRKRKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEG 420

Query: 417 WKILEFVRGGSRQFT 431
           WKILEFVRGGSRQFT
Sbjct: 421 WKILEFVRGGSRQFT 435

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/416 (78%), Positives = 379/416 (91%), Gaps = 2/416 (0%)

Query: 16  TIAARYRSGDTGLMIARVLFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTL 75
           T+ +R      G +  R LFSTS+   Q  NPRSP+QIFRDTFKKEW+KSQELQ+NIKTL
Sbjct: 5   TVVSRSSVIAEGRLAGRALFSTSSGSLQ--NPRSPVQIFRDTFKKEWKKSQELQDNIKTL 62

Query: 76  QDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKA 135
           QDASG+LGESEAYK+AREAY++AQ+GSTIVGKTLKKTGET+E+IA+KAW+SE+ +NTR+A
Sbjct: 63  QDASGRLGESEAYKRAREAYVRAQKGSTIVGKTLKKTGETVENIASKAWDSEIARNTREA 122

Query: 136 ASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHR 195
           AS TAKK+DE FEPVRQTKIYK+VSEV+DDG SSRYGGFITKEQRRLKRE+D+ SGKR +
Sbjct: 123 ASKTAKKIDEGFEPVRQTKIYKDVSEVMDDGNSSRYGGFITKEQRRLKREQDMLSGKRAK 182

Query: 196 AVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMR 255
           AVK N++AGTA+VAT+IE+K+SFGKKVEDFKEKTV+GR++  LKN LWDES NPLIV +R
Sbjct: 183 AVKGNEDAGTALVATDIEAKQSFGKKVEDFKEKTVLGRTLHRLKNSLWDESVNPLIVFLR 242

Query: 256 KITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKK 315
           KIT K+GGFFAETE++RV  QFKMMDPTF+NESFTRHLREY++PEILEAYVKGD KVLKK
Sbjct: 243 KITRKIGGFFAETEAARVLGQFKMMDPTFTNESFTRHLREYVIPEILEAYVKGDEKVLKK 302

Query: 316 WFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEIN 375
           WFSEAP+NVYAAQQK F+EQ ++ADG+ILDIRGVE+VSAK+L PQDIPVLVVGCRAQEI+
Sbjct: 303 WFSEAPYNVYAAQQKAFREQQLFADGKILDIRGVEIVSAKMLPPQDIPVLVVGCRAQEIH 362

Query: 376 LYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           LYRK KTGE+AAG E+NI+MSSYAMVFTRDPEQIDD+ETEGW+ILEFVRGGSRQFT
Sbjct: 363 LYRKAKTGEVAAGHESNIMMSSYAMVFTRDPEQIDDEETEGWRILEFVRGGSRQFT 418

>Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON}
           (26537..27790) [1254 nt, 418 aa]
          Length = 417

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/398 (81%), Positives = 371/398 (93%), Gaps = 2/398 (0%)

Query: 34  LFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKARE 93
           LFSTS+   QG  PR+P+QIFRDTFKKEWEKS++LQ+NIK LQDASG+LGESEAYKKARE
Sbjct: 22  LFSTSSRVLQG--PRTPIQIFRDTFKKEWEKSKDLQDNIKALQDASGRLGESEAYKKARE 79

Query: 94  AYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESFEPVRQT 153
           AYLKAQ+GSTIVGKTL+KTGET+E IA+KAW+SE+GK+TRKAASATA+K+DESFEPVR+T
Sbjct: 80  AYLKAQKGSTIVGKTLQKTGETVEDIASKAWDSEIGKSTRKAASATARKIDESFEPVRKT 139

Query: 154 KIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIE 213
           ++YK+VS+VIDDG+SSRYGGFI KEQRRLKRE DL SGKR RAVKSNDEAGT++VATNIE
Sbjct: 140 QVYKDVSDVIDDGDSSRYGGFIGKEQRRLKRESDLVSGKRVRAVKSNDEAGTSIVATNIE 199

Query: 214 SKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRV 273
           +KES GKK+EDFKE T  GR+I  +K KLWDE+ENPLIV +RK++ K+GGFFAETESSRV
Sbjct: 200 AKESLGKKMEDFKENTTAGRTIHGVKVKLWDENENPLIVFLRKVSGKIGGFFAETESSRV 259

Query: 274 YSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFK 333
            SQFK+MDPTFSN+SFT+HLREYI+PE+LEAYVKGD  VLKKWFSEAP+NVYAAQQK F+
Sbjct: 260 LSQFKLMDPTFSNDSFTKHLREYIIPEVLEAYVKGDEAVLKKWFSEAPYNVYAAQQKEFR 319

Query: 334 EQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANI 393
           +Q ++ DGRILDIRGVE+VSAKLLAPQDIPVLVVGCRAQEI+LYRK KTGEIAAGDE+NI
Sbjct: 320 KQQLFPDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKVKTGEIAAGDESNI 379

Query: 394 LMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           LMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT
Sbjct: 380 LMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 417

>CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022w TIM44
          Length = 412

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/406 (80%), Positives = 371/406 (91%), Gaps = 3/406 (0%)

Query: 26  TGLMIARVLFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGES 85
           +G+++AR  F T +      NPRSPLQIFR+TFKKEWEKSQELQ+NIKTLQDASG+LGES
Sbjct: 8   SGVLVARRCFGTRSVLL--SNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGES 65

Query: 86  EAYKKAREAYLKAQRGS-TIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLD 144
           EAYKKAREAYLKA +GS TIVGKTL+KTGET+E +ATKAW+S++ K TR  AS TAKKLD
Sbjct: 66  EAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLD 125

Query: 145 ESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAG 204
           ESFEPVRQTKIYK+VSEVIDDG+SS YGGFITKEQRRLKREKDLASGKR RAVKSNDEAG
Sbjct: 126 ESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAG 185

Query: 205 TAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGF 264
           +A+VAT+IE+KES GKK+EDFKEKT VGR+++S+K  LWDESENPLIV +RKIT K+GGF
Sbjct: 186 SALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGF 245

Query: 265 FAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNV 324
           FAETES+RVY QFKM+DPTF+N  FT+HLR+YIVPE+LEAYVKGD KVLKKWFSEAPFNV
Sbjct: 246 FAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNV 305

Query: 325 YAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGE 384
           Y AQQKIFK+Q++++DG+ILDIRGVEVVSAKLL PQDIPVLVVGCRAQEI+LYRK KTGE
Sbjct: 306 YNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGE 365

Query: 385 IAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQF 430
           IAAGDE+NILMSSYAMVFTRDPEQIDDDETEGWKILEF+RG SR F
Sbjct: 366 IAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPF 411

>NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {ON}
           Anc_7.196 YIL022W
          Length = 434

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/432 (74%), Positives = 381/432 (88%), Gaps = 2/432 (0%)

Query: 1   MYRSTFIRSSGTSSRTIAARYRSGDTGLMIARVLFSTSAT--RTQGGNPRSPLQIFRDTF 58
           ++  + I+SS         R  S  +   + +VLFST+ T     GG  R+P+QIFRDTF
Sbjct: 2   LHNRSIIQSSSYVRLLNVQRSSSVPSSYTVGKVLFSTTRTTLNNNGGGGRTPIQIFRDTF 61

Query: 59  KKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEH 118
           KKEWEKSQELQ+NIK L DASGKL ESE +K A++AYLKA +GSTIV KTLKKTGET+E 
Sbjct: 62  KKEWEKSQELQDNIKALHDASGKLSESETFKMAKDAYLKAHKGSTIVSKTLKKTGETVET 121

Query: 119 IATKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKE 178
           +A+KAW+SE+GKNTR AA  TA+ +D+SFEPVR+T+IYK+VSEVIDDG+SSRYGGFITKE
Sbjct: 122 MASKAWDSEIGKNTRIAAKKTAETIDKSFEPVRKTQIYKDVSEVIDDGDSSRYGGFITKE 181

Query: 179 QRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSL 238
           +R+LKRE+DLASGKR RAVKSNDEAGTA+VATNIE+KESFGKKVEDFKEKTVVG++++++
Sbjct: 182 ERKLKRERDLASGKRQRAVKSNDEAGTALVATNIEAKESFGKKVEDFKEKTVVGKTMKTV 241

Query: 239 KNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREYIV 298
           K KLWDESENPLIV +RKI+NK+ GFF ETES++VY+QFK+MD TF+N+ FTRHLR+YIV
Sbjct: 242 KMKLWDESENPLIVTLRKISNKISGFFDETESAKVYTQFKLMDTTFTNDGFTRHLRDYIV 301

Query: 299 PEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLA 358
           PEILEAY+KGD KVLKKWFSEAPFNVYAAQQK+F+EQ +++DGRILDIRGVE+VSAKLLA
Sbjct: 302 PEILEAYIKGDEKVLKKWFSEAPFNVYAAQQKVFREQGLFSDGRILDIRGVEIVSAKLLA 361

Query: 359 PQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWK 418
           PQDIPVLVVGCRAQEINLY+K K+GEIAAGDE+NI+MSSYAMVFTRDPEQIDDDETEGWK
Sbjct: 362 PQDIPVLVVGCRAQEINLYKKAKSGEIAAGDESNIVMSSYAMVFTRDPEQIDDDETEGWK 421

Query: 419 ILEFVRGGSRQF 430
           ILEFVRGGSR F
Sbjct: 422 ILEFVRGGSRPF 433

>NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa]
           {ON} Anc_7.196 YIL022W
          Length = 432

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/404 (78%), Positives = 373/404 (92%), Gaps = 1/404 (0%)

Query: 29  MIARVLFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAY 88
           ++ + LFST+  R+ GG  R+P+QIFRDTFKKEW+KSQELQENIK L DASGKL ESE +
Sbjct: 29  VVNKGLFSTTTARSNGGGGRTPIQIFRDTFKKEWDKSQELQENIKALHDASGKLSESETF 88

Query: 89  KKAREAYLKAQRGS-TIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESF 147
           K A++AYLKA +GS TI+ KT++KTGET+E++A+KAW+SE+ K+TR+AA  TA  LD+SF
Sbjct: 89  KMAKDAYLKAHKGSSTILSKTMQKTGETVENMASKAWDSEIAKSTREAAKKTADTLDKSF 148

Query: 148 EPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAV 207
           EPVR+T++YK++SEVIDDG+SSRYGGFITKE+RRLKRE DLASGKR RA+KSN+EAGTA+
Sbjct: 149 EPVRKTQVYKDISEVIDDGDSSRYGGFITKEERRLKRESDLASGKRQRAIKSNEEAGTAL 208

Query: 208 VATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAE 267
           VAT+IE+K+SFGKKVEDFKEKTVVG+++ S+K KLWDESENPLIV +RKITNK+GGFF E
Sbjct: 209 VATDIEAKQSFGKKVEDFKEKTVVGKTMSSVKVKLWDESENPLIVFLRKITNKIGGFFDE 268

Query: 268 TESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAA 327
           TES+RVY+QFKMMD TF+NE FTRHLREYIVPE+LEAY+KGD KVLKKWFSEAPFNVY+A
Sbjct: 269 TESARVYTQFKMMDATFTNEGFTRHLREYIVPELLEAYIKGDEKVLKKWFSEAPFNVYSA 328

Query: 328 QQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAA 387
           QQK+F+EQ +++DGRILDIRGVE+VSAKLLAPQDIPVLVVGCRAQEINLYRK KTGEIAA
Sbjct: 329 QQKVFREQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKVKTGEIAA 388

Query: 388 GDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           GD++NILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT
Sbjct: 389 GDQSNILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 432

>SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {ON}
           highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 412

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/404 (79%), Positives = 367/404 (90%), Gaps = 2/404 (0%)

Query: 28  LMIARVLFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEA 87
           ++ +R   S++    QG   RSPLQIFR+TFK+EWEKS+ELQ+NIKTLQDASGKLGES+A
Sbjct: 11  VLASRRTISSTVRLPQG--QRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDA 68

Query: 88  YKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESF 147
           YKKAREAYL+AQ+GSTIVGKTLKKTGET+E IA KAWESELGK TRKA +ATA+K+DESF
Sbjct: 69  YKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESF 128

Query: 148 EPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAV 207
           EPVRQTK+YK+VSEVIDDGESSRYGGFITKEQRRLK+E+DLASGKR +AVKSNDEAGTA+
Sbjct: 129 EPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTAL 188

Query: 208 VATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAE 267
           VATNIE+KESF KK+EDFKEKT  GR I  +K +LWDESENPLIV++R I NKVGG FAE
Sbjct: 189 VATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAE 248

Query: 268 TESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAA 327
           TES+RV  QFKM+DP F+ ESFT+HLREYI+PEILEAYVKGD  VLK+WFSEAP+NVYAA
Sbjct: 249 TESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAA 308

Query: 328 QQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAA 387
           QQK F++Q+++ADGRILDIRGVE+VSAKLLAPQDIPVLVVGCRAQEI+LYRK KTGEIAA
Sbjct: 309 QQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAA 368

Query: 388 GDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           G E+NIL+SSYAMVFTRDPE +DD ETEGW+ILEFVRGGSRQFT
Sbjct: 369 GTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412

>TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {ON}
           Anc_7.196 YIL022W
          Length = 416

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/408 (76%), Positives = 367/408 (89%), Gaps = 3/408 (0%)

Query: 26  TGLMIAR--VLFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLG 83
           T L++      FSTS     GG  ++P+QIFR+TFKKEWEKSQELQ+NIKTLQDASG+LG
Sbjct: 10  TNLLLGHNVAYFSTSTVLRNGGG-KTPIQIFRETFKKEWEKSQELQDNIKTLQDASGRLG 68

Query: 84  ESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKL 143
           +SEAYKKA+EAY+KAQ+ STIV KTLKKTGET+E +A K W+SE+GK+TRK  S  AKK+
Sbjct: 69  QSEAYKKAKEAYVKAQQSSTIVSKTLKKTGETVEDLAKKTWDSEIGKSTRKVVSQGAKKI 128

Query: 144 DESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEA 203
           DESFEPVRQT++YKEVSEVIDDGESSRYGGFI+KEQRR KRE DLASGKR RA KSN+EA
Sbjct: 129 DESFEPVRQTQVYKEVSEVIDDGESSRYGGFISKEQRRKKREADLASGKRVRATKSNEEA 188

Query: 204 GTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGG 263
           GTA+VATN+ESKESFGKK++DFKEKTVVG++++S K ++WDE+ENPLIVV+R I+NK+ G
Sbjct: 189 GTAIVATNVESKESFGKKIDDFKEKTVVGKTMKSFKVRVWDENENPLIVVLRTISNKISG 248

Query: 264 FFAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFN 323
           FFAETESSRVYSQFK+MDPTFSN +FT+HLR+YI+PE+LEAYVKGD  VLKKWFSEAPFN
Sbjct: 249 FFAETESSRVYSQFKLMDPTFSNAAFTKHLRDYIIPEVLEAYVKGDEVVLKKWFSEAPFN 308

Query: 324 VYAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTG 383
           VYAAQQK  ++Q ++ DGRILDIRGV++VSAKLLAPQDIPVLVVGCRAQE++LYRK KTG
Sbjct: 309 VYAAQQKELRKQQLFTDGRILDIRGVDIVSAKLLAPQDIPVLVVGCRAQELHLYRKVKTG 368

Query: 384 EIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           E+ AGDE+NI+MSSYAMVFTRDP+ IDDDETEGWKILEFVRGGSRQFT
Sbjct: 369 ELGAGDESNIMMSSYAMVFTRDPDNIDDDETEGWKILEFVRGGSRQFT 416

>KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 418

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/386 (80%), Positives = 355/386 (91%)

Query: 46  NPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIV 105
           NPRSPLQIFR+TFK+EWEKS+ELQ+NIK LQDASGKLGESEAYKKAREAY+KAQ+GSTIV
Sbjct: 33  NPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGSTIV 92

Query: 106 GKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDD 165
           GKTLKKTGET+E IA+KAW+SE+ K+TRK  + TA KLDESFEPVR+TK+YK+VSEVIDD
Sbjct: 93  GKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEVIDD 152

Query: 166 GESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDF 225
           G+SSRYGGFITKEQRRL +E+ +ASGKR RAVKSND AGTA+VATNIESKESFGKK+EDF
Sbjct: 153 GDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKIEDF 212

Query: 226 KEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFS 285
           KEKT VGR +   K KLWDESENPL+V++R ++ K+GG FAETES+RVY QFKMMDPTF+
Sbjct: 213 KEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDPTFN 272

Query: 286 NESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILD 345
            E FT+HLREYI+PEILEAYVKGD  VLK+WFSEAP+NVYAAQQK F+EQ+++ADG+ILD
Sbjct: 273 TEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGKILD 332

Query: 346 IRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRD 405
           IRGVE+VSAKLL PQDIPVLVVGCRAQEI+LYRK KTGEIAAG E++ILMSSYAMVFTRD
Sbjct: 333 IRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVFTRD 392

Query: 406 PEQIDDDETEGWKILEFVRGGSRQFT 431
           PE +DD ETEGWKILEFVRGGSRQFT
Sbjct: 393 PETVDDKETEGWKILEFVRGGSRQFT 418

>Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022W
           (TIM44) - 48.8 kDa protein involved in mitochondrial
           protein import [contig 149] FULL
          Length = 412

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/405 (76%), Positives = 361/405 (89%), Gaps = 3/405 (0%)

Query: 30  IARVLFS---TSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESE 86
           +  V+FS   +   R   GNPRSPLQIFR+TFK+EW+KSQELQ+NIK LQDASGKLGES+
Sbjct: 8   VGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESD 67

Query: 87  AYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDES 146
           AYKKAREAYLKAQ+GSTIVGKT+KKTG+++E IA KAWESE+ K+TRKA + TA KLDES
Sbjct: 68  AYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDES 127

Query: 147 FEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTA 206
           FEPVR T++YK+VSEV++ G SSRYGGFITKEQRRLK E+D+ASGKR +AV+SNDEAGTA
Sbjct: 128 FEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTA 187

Query: 207 VVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFA 266
           +VATNIE+KESFGKKV+DFKEKTVVGR +   K KLWDESENPLIV++R I NK+GG FA
Sbjct: 188 LVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFA 247

Query: 267 ETESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYA 326
           ETES+RV  QFKMMD  F++ESF  HLREYI+PE+LEAYVKGD KVLK+WFSEAP+NVYA
Sbjct: 248 ETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYA 307

Query: 327 AQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIA 386
           AQQK+F+EQ ++ADGRILDIRGV++VSAKLLAPQD+PVLVVGCRAQEI+LYR  KTGE+A
Sbjct: 308 AQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVA 367

Query: 387 AGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           AG ++NILMSSYAMVFTRDPE ID+ ETEGWKILEFVRGGSRQFT
Sbjct: 368 AGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412

>ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 407

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/398 (75%), Positives = 364/398 (91%), Gaps = 3/398 (0%)

Query: 34  LFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKARE 93
           LFSTS+   QG   RSPLQIFRDTFKKEWEKSQELQENIKTLQDASG+LG+SE  K+ARE
Sbjct: 13  LFSTSSRSLQG---RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRARE 69

Query: 94  AYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESFEPVRQT 153
           AYL+AQ+GSTIVGKTL+KTGET+E IA+KAWESE+ K+TR AASATAKKLD+SFEPVR T
Sbjct: 70  AYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIAKSTRSAASATAKKLDKSFEPVRNT 129

Query: 154 KIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIE 213
           KIYK+VSEV++D ++SRYGGF+TKEQR++KRE+++ASGKR RA++SN+EAGTA+VATNIE
Sbjct: 130 KIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNIE 189

Query: 214 SKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRV 273
           +KES GKKVEDF+EKT +GR+IQ LK +LW+E+ENPLIV++RKITNKVGGFFAETE+++V
Sbjct: 190 AKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAKV 249

Query: 274 YSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFK 333
             QFK++DP+F++E FTR LR+Y++PE+LEAY KGD K LKKWFSEAPFNVYAAQQK F+
Sbjct: 250 IGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFFR 309

Query: 334 EQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANI 393
           +Q ++AD RILDIRGV++VSAKLL PQDIPVL+VGCRAQEI LYR  K+GE+AAG E+NI
Sbjct: 310 DQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESNI 369

Query: 394 LMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           LMSSYAMVFTRDPE ++D+ETEGW+I+EFVRGGSRQFT
Sbjct: 370 LMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407

>KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} similar
           to uniprot|Q01852 Saccharomyces cerevisiae YIL022W TIM44
           48.8 kDa protein involved in mitochondrial protein
           import
          Length = 479

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/387 (78%), Positives = 353/387 (91%)

Query: 45  GNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTI 104
           GNPRSPLQIFR+TFK+EW+KSQELQ+NIK LQDASGK+GESEAYKKAREAYL AQ+GSTI
Sbjct: 93  GNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSAQKGSTI 152

Query: 105 VGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVID 164
           VGKTLKKTG+++E IA KAWESE+GK+TR+A + TA KLDESFEPVR T++YK+VSEV+D
Sbjct: 153 VGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYKDVSEVMD 212

Query: 165 DGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVED 224
              SSRYGGFI+KEQRRLK E+D+ASGKR +AVKSN+EAGTA+VAT IE+KESFGKKV+D
Sbjct: 213 SSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKESFGKKVDD 272

Query: 225 FKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTF 284
           FKEKTVVGR +Q +K KLWDESENPLIV+MR I NKVGG FAETES+RV  QFKMMD  F
Sbjct: 273 FKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQFKMMDGNF 332

Query: 285 SNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRIL 344
           ++ESF  HLREYI+PE+LEAYVKG+ +VLK+WFSEAP+NVYAAQQK+F+EQ ++ADGRIL
Sbjct: 333 NSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGLFADGRIL 392

Query: 345 DIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTR 404
           DIRGV++VSAKLL PQD+PVLVVGCRAQEI+LYR  KTGE+AAG ++NILMSSYAMVFTR
Sbjct: 393 DIRGVDIVSAKLLPPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILMSSYAMVFTR 452

Query: 405 DPEQIDDDETEGWKILEFVRGGSRQFT 431
           DPE IDD ETEGWKILEFVRGGSRQFT
Sbjct: 453 DPENIDDKETEGWKILEFVRGGSRQFT 479

>KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.196
           YIL022W
          Length = 419

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/404 (76%), Positives = 365/404 (90%), Gaps = 1/404 (0%)

Query: 29  MIARVLFSTSATRTQGG-NPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEA 87
           ++AR    T+     GG +PRSPL IFRDTFKKEWEKSQELQENI+TLQDASGK+GE+EA
Sbjct: 16  VVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEA 75

Query: 88  YKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESF 147
           Y+KAREA+L+AQ+GSTIVGKTLKKTGET+E IA+KAW+SE+ K +RKAA  TA+KLDE F
Sbjct: 76  YRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGF 135

Query: 148 EPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAV 207
           EPVRQT++YK+VSEVIDDG+S+ YGGF T+E+R+ +REK LASG+R RAVKSNDEAGTA+
Sbjct: 136 EPVRQTQLYKDVSEVIDDGDSTSYGGFFTREERQRRREKALASGERVRAVKSNDEAGTAL 195

Query: 208 VATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAE 267
           VAT +ESKES GKK+EDFKEKT VGRS+  LK++LWDESENPLIV MRK++ KVG FFAE
Sbjct: 196 VATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAE 255

Query: 268 TESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAA 327
           TES RVY+QFK+MDP F++ +FT+HLREY+VPEILEAYV+GD KVLKKWFSEAP+NVYAA
Sbjct: 256 TESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAA 315

Query: 328 QQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAA 387
           QQK+FKE+ ++ADGRILDIRGVE+VSAKLL PQD+PVLVVGCRAQEINLY+K KTGEIAA
Sbjct: 316 QQKMFKEKALFADGRILDIRGVEIVSAKLLQPQDLPVLVVGCRAQEINLYKKVKTGEIAA 375

Query: 388 GDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           G E+NILMSSYAMVFTRDPEQ+ D+ETEGWKILEFVRGGSRQFT
Sbjct: 376 GSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419

>Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar to
           Ashbya gossypii ADL118C
          Length = 418

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/397 (73%), Positives = 349/397 (87%), Gaps = 2/397 (0%)

Query: 35  FSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREA 94
           FST+     G   +SPLQIFR+TFK EW+KSQELQ+NIK LQDASG+LGES+AYKKAREA
Sbjct: 24  FSTTGLSWNG--QKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREA 81

Query: 95  YLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESFEPVRQTK 154
           YLKAQRGST+VGKTLKKTGET+E++  KAW+S++GKNTR+  S TA+KLDESFEPVR T+
Sbjct: 82  YLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHTR 141

Query: 155 IYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIES 214
           +YK++SE+IDDGESSRYGGFI KE RR KRE DLASG+R  AV+SNDEAGTA+VATN E 
Sbjct: 142 VYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKEG 201

Query: 215 KESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVY 274
           KESFGKK++DFKEKT +GR +   K KLWDE+ENPLI ++R I+NK+GG FAETES+RV+
Sbjct: 202 KESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARVF 261

Query: 275 SQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKE 334
           +QFK++DPTF++E FT+HLREYI+PE+LEAYVKGD  VLK+W SEAP+NVYAAQQK F+E
Sbjct: 262 AQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFRE 321

Query: 335 QDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANIL 394
           Q+++ DGR+LDIRGVE+VSAKLL PQD+P LVVGCR QEI+LYRK KTGEIAAG E+NI+
Sbjct: 322 QELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESNIM 381

Query: 395 MSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           MSSYAMV TRDPE + D ETEGWK+LEF+RGGSRQFT
Sbjct: 382 MSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418

>KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/421 (72%), Positives = 356/421 (84%), Gaps = 6/421 (1%)

Query: 17  IAARYRSGDTG----LMIARVLFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENI 72
           +  R R G +G    L  A  L S   +R  G   R+PLQIFR+TFKKEWEKS ELQ +I
Sbjct: 1   MLVRSRVGVSGKPYYLKSAIQLVSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSI 60

Query: 73  KTLQDASGKLGESEAYKKAREAYLKAQRGS-TIVGKTLKKTGETMEHIATKAWESELGKN 131
           K LQDASGK+ ESEAYKKAR+AYLKA RGS TI+ KTLKKTG+T+E IATKAWESE+ KN
Sbjct: 61  KELQDASGKISESEAYKKARDAYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKN 120

Query: 132 TRKAASATAKKLDESFEPVRQTKIYKEVSEVI-DDGESSRYGGFITKEQRRLKREKDLAS 190
           TR+ AS TAKKLDESFEPVR TKIYK+VSEV+ DDG+S RYGGFI K++RRLKRE  L S
Sbjct: 121 TRQMASETAKKLDESFEPVRNTKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKS 180

Query: 191 GKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPL 250
           GKR RAVKSNDEAGTA+VATN++S ES G+K E+FKE+T+VG+ + + K   WDESENPL
Sbjct: 181 GKRVRAVKSNDEAGTALVATNVQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPL 240

Query: 251 IVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDV 310
           IV++RKIT K+ GFF ETESSRVYSQFK++D TF+ ESFTRHLREYIVPEILEAY+KGD 
Sbjct: 241 IVLLRKITLKITGFFGETESSRVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDE 300

Query: 311 KVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCR 370
           KVLK WFSEAPFNVY+AQQK+F++Q+++ DG ILDIR VE+VSAKLL PQDIPVLVV CR
Sbjct: 301 KVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCR 360

Query: 371 AQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQF 430
           AQEIN+YRK KTGE+AAG+ ++ILMS+YAMVFTRDPE+ID+DETEGW+ILEFVRG SRQF
Sbjct: 361 AQEINIYRKIKTGEVAAGNASDILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQF 420

Query: 431 T 431
           T
Sbjct: 421 T 421

>ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL022W
           (TIM44)
          Length = 418

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/394 (73%), Positives = 354/394 (89%)

Query: 38  SATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLK 97
           SATR  G  P+SPLQ+FR+TFK+EW+KSQELQ+NIK LQDA G+LGES+AYKKAREAYLK
Sbjct: 25  SATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKKAREAYLK 84

Query: 98  AQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYK 157
           AQ+GSTIVGKTLK+TGET+EHI  +AWESE+GK TRK  S TA+KLDESFEPVRQTK+YK
Sbjct: 85  AQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEPVRQTKVYK 144

Query: 158 EVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKES 217
           ++SE+IDDGESSRYGGF+ KE+RR KRE+DLA+GKR   V+SN+EAG+A+VAT+ E+ ES
Sbjct: 145 DMSEIIDDGESSRYGGFMEKERRREKRERDLATGKRATPVRSNEEAGSALVATDKEASES 204

Query: 218 FGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQF 277
            GKK++DFKEKTVVGR +  +K +LWDE+ENPLI ++R I+NKVGG FAETES+RV++QF
Sbjct: 205 LGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETESARVFAQF 264

Query: 278 KMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDV 337
           K++DPTF+ E FT+HLREYI+PE+LEAYVKGD +VLK+WFSEAP+NVY+AQQK  ++Q++
Sbjct: 265 KLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIRQQEL 324

Query: 338 YADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSS 397
           +ADGRILDIRGVE++SAKLL PQD+P +VVGCRAQEI+L+RK  TGEIAAG E+NI++SS
Sbjct: 325 FADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHESNIMLSS 384

Query: 398 YAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431
           YAMV TRDPE++DD ETEGWKILEFVRGGSR FT
Sbjct: 385 YAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418

>TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/423 (59%), Positives = 337/423 (79%), Gaps = 10/423 (2%)

Query: 14  SRTIAARYRSGDTGLMIARVLFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIK 73
           SR++  R     + L+I+         ++   N ++P+QIFR+TFK+EWEKS  LQ+ IK
Sbjct: 4   SRSLIQRNALHPSKLLISSFHSYPVVLQSNDSN-KTPIQIFRETFKQEWEKSATLQDQIK 62

Query: 74  TLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTR 133
           TL DAS ++ +S+A+KKA++AY      +TI+ KT+ KTG  +   A KAW+S+L + T+
Sbjct: 63  TLTDASDRINQSDAFKKAKDAYKNVSNQTTILSKTISKTGTKLNDAALKAWDSDLAQKTK 122

Query: 134 KAASATAKKLDESFEPVRQTKIYKEVSEVIDDGESS-RYGGFITKEQRRLKREKDLASGK 192
            AA    KKLD+SFEPVR TKIYK+VSEVIDD ++S +YGGFI+KE+RR KR  DL +GK
Sbjct: 123 LAA----KKLDDSFEPVRNTKIYKDVSEVIDDKDNSYKYGGFISKEERRSKRISDLQTGK 178

Query: 193 RHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIV 252
           R + +KSNDEAGTA++AT+++SKES  +K+ DFKEKTVVG+++ S+K K+WDE++NPLIV
Sbjct: 179 RMKPIKSNDEAGTALIATDLKSKESINEKLNDFKEKTVVGQTMTSIKTKVWDENDNPLIV 238

Query: 253 VMRKITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKV 312
            MRK+T     FFAETESSRV +QFK++DP F+NESF R LREYI+PE+LEAY+KGD K+
Sbjct: 239 GMRKVTGVFNRFFAETESSRVLTQFKLIDPNFNNESFLRSLREYIIPEVLEAYIKGDEKI 298

Query: 313 LKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQ 372
           LK WFSEAP+NVY+AQQK  ++Q +++DGR+LDIRGV++V+AK+L PQDIPV+VV CRAQ
Sbjct: 299 LKNWFSEAPYNVYSAQQKELRKQKIFSDGRVLDIRGVDIVTAKMLPPQDIPVIVVSCRAQ 358

Query: 373 EINLYRK----KKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSR 428
           EIN+Y+K    K+T +I AG ++NILMS+YAMVFTRDPEQ+D+DETEGWKILEFVRGGSR
Sbjct: 359 EINIYKKFNVEKQTNDIVAGHDSNILMSTYAMVFTRDPEQLDNDETEGWKILEFVRGGSR 418

Query: 429 QFT 431
           +FT
Sbjct: 419 KFT 421

>NCAS0F02500 Chr6 complement(491248..492601,492690..493831) [2496
           bp, 831 aa] {ON} Anc_5.296 YDR285W
          Length = 831

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 60/144 (41%), Gaps = 15/144 (10%)

Query: 177 KEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQ 236
           KE   LKRE D  SG+       N         T    KE+F  + ED KEKT    S++
Sbjct: 289 KEIEYLKREVDDTSGQLSEEKIKNCSLLQEFTKTRETLKENFESQKEDLKEKTT---SME 345

Query: 237 SLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREY 296
           +    L+ +     +  + KI+N+    + E  S  + ++FK M  T   E F++  + +
Sbjct: 346 NCLRTLFKDEMTKQLTEIEKISNQNFEAYLEENSKSLTTEFKNMFETHEGEEFSKMAKHH 405

Query: 297 I------------VPEILEAYVKG 308
                        V +IL A+ K 
Sbjct: 406 EEELEQFLEQKINVSQILNAFEKN 429

>TPHA0E03390 Chr5 (719360..721417) [2058 bp, 685 aa] {ON} Anc_1.162
           YKL179C
          Length = 685

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 7/94 (7%)

Query: 33  VLFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAR 92
           +LF+  A  ++  +P+  LQ   + F    E S+EL+E +++LQD   KL +   Y+  +
Sbjct: 89  ILFNVYARLSETPDPKPLLQNSIEKFSN-VEDSKELKEQVESLQD---KLAKYADYESIK 144

Query: 93  EAYLKAQRGSTIVGKTLKKTGETMEHIATKAWES 126
              L  ++ S +V   L K     E   T  WE+
Sbjct: 145 SRLLDLEQSSAVV---LTKRLTAQEKELTSVWEA 175

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,955,336
Number of extensions: 1820452
Number of successful extensions: 6025
Number of sequences better than 10.0: 143
Number of HSP's gapped: 6301
Number of HSP's successfully gapped: 146
Length of query: 431
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 319
Effective length of database: 40,638,807
Effective search space: 12963779433
Effective search space used: 12963779433
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)