Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.165.709ON39339321170.0
YIL153W (RRD1)5.709ON39339318930.0
Skud_9.155.709ON40239318580.0
Suva_9.355.709ON39339318380.0
TDEL0B021105.709ON38934710561e-142
NCAS0G002005.709ON43837210601e-142
NDAI0F002405.709ON46432810441e-139
SAKL0E15070g5.709ON38536010361e-139
KLTH0E00880g5.709ON37136510251e-138
ZYRO0B16478g5.709ON39135210211e-137
Kpol_2001.775.709ON41334710091e-135
Kwal_55.196615.709ON3713779861e-132
Ecym_40125.709ON3953769581e-127
KAFR0D021905.709ON4263749331e-123
TBLA0E016905.709ON4883359331e-122
TPHA0D046505.709ON4213369201e-121
CAGL0H06655g5.709ON4243489011e-118
KLLA0A00462g5.709ON3533498901e-117
KNAG0L021705.709ON3963968901e-117
AFR293C5.709ON3653248841e-116
NDAI0E024108.674ON3592494091e-45
NCAS0C016908.674ON3593144021e-44
TPHA0D012408.674ON3593013942e-43
ZYRO0F07326g8.674ON3522443891e-42
Smik_6.3498.674ON3582493881e-42
KAFR0H024408.674ON3532683872e-42
ACR139C8.674ON3592703862e-42
Ecym_23998.674ON3512603853e-42
TDEL0A062008.674ON3552613837e-42
KLTH0D11176g8.674ON3532433821e-41
Kpol_1013.48.674ON3582493802e-41
SAKL0H06622g8.674ON3552543783e-41
CAGL0M02255g8.674ON3582603784e-41
YPL152W (RRD2)8.674ON3582893785e-41
Skud_16.1308.674ON3582433776e-41
KNAG0J016908.674ON3632483732e-40
KLLA0F11187g8.674ON3602463723e-40
TBLA0C018608.674ON3563113706e-40
Suva_16.1588.674ON3582533697e-40
Kwal_26.87838.674ON3552483611e-38
Suva_7.2864.138ON746148750.97
KLLA0E06139g7.457ON40367741.1
CAGL0I06985g3.530ON8431671.6
TDEL0H021607.228ON304127703.0
Skud_7.513.530ON10942663.4
YGL220W (FRA2)3.530ON12052664.8
ZYRO0D16698g7.228ON305126669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.16
         (393 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   820   0.0  
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   733   0.0  
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   720   0.0  
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   712   0.0  
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   411   e-142
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      412   e-142
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      406   e-139
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   403   e-139
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   399   e-138
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   397   e-137
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   393   e-135
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   384   e-132
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   373   e-127
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   363   e-123
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   363   e-122
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   358   e-121
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   351   e-118
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   347   e-117
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   347   e-117
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   345   e-116
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   162   1e-45
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   159   1e-44
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   156   2e-43
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   154   1e-42
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   154   1e-42
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   153   2e-42
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   153   2e-42
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   152   3e-42
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   152   7e-42
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   151   1e-41
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   150   2e-41
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   150   3e-41
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   150   4e-41
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   150   5e-41
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   149   6e-41
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   148   2e-40
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   147   3e-40
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   147   6e-40
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   146   7e-40
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   143   1e-38
Suva_7.286 Chr7 (491878..494118) [2241 bp, 746 aa] {ON} YGR003W ...    33   0.97 
KLLA0E06139g Chr5 complement(555427..556638) [1212 bp, 403 aa] {...    33   1.1  
CAGL0I06985g Chr9 (672970..673224) [255 bp, 84 aa] {ON} highly s...    30   1.6  
TDEL0H02160 Chr8 (367235..368149) [915 bp, 304 aa] {ON} Anc_7.22...    32   3.0  
Skud_7.51 Chr7 (87670..87711,87715..87741,87745..88002) [327 bp,...    30   3.4  
YGL220W Chr7 (82374..82736) [363 bp, 120 aa] {ON}  FRA2Protein i...    30   4.8  
ZYRO0D16698g Chr4 complement(1382235..1383152) [918 bp, 305 aa] ...    30   9.6  

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/393 (100%), Positives = 393/393 (100%)

Query: 1   MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV 60
           MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV
Sbjct: 1   MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV 60

Query: 61  ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE 120
           ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE
Sbjct: 61  ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE 120

Query: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKY 180
           YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKY
Sbjct: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKY 180

Query: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240
           YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR
Sbjct: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240

Query: 241 EYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           EYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP
Sbjct: 241 EYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300

Query: 301 VVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASMSMPPP 360
           VVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASMSMPPP
Sbjct: 301 VVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASMSMPPP 360

Query: 361 ITPLSGSNINYLLSHQNHSQRNQPSSPRDRLRR 393
           ITPLSGSNINYLLSHQNHSQRNQPSSPRDRLRR
Sbjct: 361 ITPLSGSNINYLLSHQNHSQRNQPSSPRDRLRR 393

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/393 (91%), Positives = 370/393 (94%)

Query: 1   MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV 60
           MSLD VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTL+SHC+DPDP A 
Sbjct: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60

Query: 61  ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE 120
           ASSI M NGLM VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWL+EMLP E
Sbjct: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120

Query: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKY 180
           YH VVPELQYYLGNSFGSSTRLDYGTGHELSFMATV ALD+LGMFPH+RG DVFLLFNKY
Sbjct: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKY 180

Query: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240
           YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR
Sbjct: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240

Query: 241 EYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           EYK+TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP
Sbjct: 241 EYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300

Query: 301 VVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASMSMPPP 360
           VVQHFWFGTGFFPWVNIQNGT+LPVFEEKEEE+IEQANAG PG E TSTRFP S SMPPP
Sbjct: 301 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMPPP 360

Query: 361 ITPLSGSNINYLLSHQNHSQRNQPSSPRDRLRR 393
             P SG+NINYLLSHQN S RNQ S  RDRLRR
Sbjct: 361 GVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/393 (90%), Positives = 368/393 (93%)

Query: 1   MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV 60
           MSLDHVDW HATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHC DPD  A 
Sbjct: 10  MSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAA 69

Query: 61  ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE 120
           +SSI M NGLM VLDKLA LIDETPPLPGPRRYGNLACREWH+KLDE L QWL+EMLP E
Sbjct: 70  SSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAE 129

Query: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKY 180
           YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATV ALDLLG+FPHLRG DVFLLFNKY
Sbjct: 130 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKY 189

Query: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240
           YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA+APLQPRE+LDKSLV 
Sbjct: 190 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVH 249

Query: 241 EYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           +YK+TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP
Sbjct: 250 DYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 309

Query: 301 VVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASMSMPPP 360
           VVQHFWFGTGFFPWVNIQNGT+LPVFEEKE+ETIEQANA  PGP HTSTRFP S+SMPPP
Sbjct: 310 VVQHFWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTSTRFPGSLSMPPP 369

Query: 361 ITPLSGSNINYLLSHQNHSQRNQPSSPRDRLRR 393
           + P SGS+INYLLSHQN S RNQ SS +DRLRR
Sbjct: 370 MGPPSGSSINYLLSHQNSSHRNQASSSKDRLRR 402

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/393 (87%), Positives = 365/393 (92%)

Query: 1   MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV 60
           MSLDHVDWPHA FSTPVKRIFDTQTT DFQSSLAIHRIKYHLHKYTTLMSHCADPDP A 
Sbjct: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60

Query: 61  ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE 120
           ASSIPM NGLM VLD+ A LID+TPPLPGPRRYGNLACREWH+KLD  L QWLRE+LP +
Sbjct: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120

Query: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKY 180
           YH VVPELQYYLGNSFGSSTRLDYGTGHELSFMATV ALDLLG+FPHLRGTDVFLLF+KY
Sbjct: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKY 180

Query: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240
           Y IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPR++LDKSLVR
Sbjct: 181 YAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVR 240

Query: 241 EYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           EY++TNFYCQGINFIN+VKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVL+KFP
Sbjct: 241 EYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFP 300

Query: 301 VVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASMSMPPP 360
           VVQHFWFGTGFFPW+N+QNGT+LPVFEEKEEE+I+QANA    P+ TSTRFPAS SMPPP
Sbjct: 301 VVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTRFPASTSMPPP 360

Query: 361 ITPLSGSNINYLLSHQNHSQRNQPSSPRDRLRR 393
           + P S +N+N LLSHQNH+ RNQ SS RDRLRR
Sbjct: 361 MAPPSANNVNSLLSHQNHTHRNQTSSSRDRLRR 393

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  411 bits (1056), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 198/347 (57%), Positives = 250/347 (72%), Gaps = 11/347 (3%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVA---S 62
           +D     F +PVK IFD+Q   DFQ S+AI R+KYHL KY  ++        Q +    S
Sbjct: 7   IDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHG------QPIVHEPS 60

Query: 63  SIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYH 122
            I + N ++ +L +L+ L+DETPP  GPRRYGNLACR+WH KLD  L + L+++LP +YH
Sbjct: 61  GIEVVNRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYH 120

Query: 123 VVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMF-PHLRGTDVFLLFNKYY 181
             +PEL YYLGNSFGSSTRLDYGTGHELSF+A + ALD+LG++     G DV LLF+ YY
Sbjct: 121 KCIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYY 180

Query: 182 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVRE 241
            ++R+LILTYTLEPAGSHGVWGLDDHFH++YILGSSQW   D   P+ PR++ +K LV++
Sbjct: 181 KLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSS-DPAVPMTPRDVKNKVLVQD 239

Query: 242 YKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
           Y +TN YCQ I+FI  VK GPF EHS +LYDIA TV  WSKV  GLLKMY VEVLKKFPV
Sbjct: 240 YADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPV 299

Query: 302 VQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTS 348
           VQHFWFG GF+PW++ +NG  LP++E  E E  +  +     P +T+
Sbjct: 300 VQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTT 346

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  412 bits (1060), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 202/372 (54%), Positives = 261/372 (70%), Gaps = 23/372 (6%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIP 65
           +D     FS P KRIFD+QTT DFQSS+A++R+++ L KY +++++   P P+   SS+ 
Sbjct: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTP-PEGTLSSVT 91

Query: 66  MDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPP------ 119
           + N ++Q+L+ L+ LIDETPPL GPRRYGNLACR+WH K++ +LP  L E+L P      
Sbjct: 92  LVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151

Query: 120 ----EYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPH-LRGTDVF 174
                 H  + EL YY+ N+FGSSTRLD+GTGHELSFMA + A+D+LG++   ++GTD+ 
Sbjct: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDIL 211

Query: 175 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREIL 234
           LLFN YY ++R+LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      AP++PR++ 
Sbjct: 212 LLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI---RNAPMRPRDVK 268

Query: 235 DKSLVREYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294
           D SLV++Y  +N YCQ I FI +VK GPF EHSPILYDIA +V  WSKV +GL+KMY  E
Sbjct: 269 DISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328

Query: 295 VLKKFPVVQHFWFGTGFFPWVNIQNGTNLPVFE--------EKEEETIEQANAGPPGPEH 346
           VLKKFPVVQHFWFG GF+PW+N   G  LP++E        E+E E  + A        H
Sbjct: 329 VLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWHKENAH 388

Query: 347 TSTRFPASMSMP 358
             T  P   +MP
Sbjct: 389 VRTAKPGITAMP 400

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  406 bits (1044), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 190/328 (57%), Positives = 241/328 (73%), Gaps = 5/328 (1%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCA-DPDPQAVASSI 64
           +D     FS PVKRIFD+QTT DFQSS+A+ R+++ L +Y  L+++    P P +  S I
Sbjct: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73

Query: 65  PMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLP-PEYHV 123
            M N ++ +L++L+ ++ +TPPL GPRRYGNLACR+WH K++  LP+ L + +P P+   
Sbjct: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133

Query: 124 VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKYYTI 183
            + EL YY+ NSFGSSTRLDYGTGHELSFMA + ALD+LG+FP L G D+ ++FN YY++
Sbjct: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYYSL 193

Query: 184 MRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYK 243
           +R LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      APL P+EI +  LV++Y 
Sbjct: 194 VRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWL---NNAPLTPKEITNSRLVKDYS 250

Query: 244 NTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQ 303
             N YCQ I F+  VK GPF EHSPILYDI+ +V  W KV +GL+KMY  EVL KFPVVQ
Sbjct: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310

Query: 304 HFWFGTGFFPWVNIQNGTNLPVFEEKEE 331
           HFWFGTGF+PW+N Q    LPV+E   E
Sbjct: 311 HFWFGTGFYPWINFQTLRELPVYEHSPE 338

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  403 bits (1036), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 251/360 (69%), Gaps = 10/360 (2%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIP 65
           +D  H  F+ PVK+IFDTQ T DFQSS+ ++R++ +LHKY TL+     P      S+  
Sbjct: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPS----TSNND 65

Query: 66  MDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVV 125
             N   Q++D L+  IDETPPLPGPRR+GN ACR WH K+   L   L+  +P +YHV +
Sbjct: 66  AVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCI 125

Query: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMF-PHLRGTDVFLLFNKYYTIM 184
            E++YYLGN+FGS  RLDYGTGHELSF+A V+A+D+L ++  +  G D+  LFN YYT++
Sbjct: 126 VEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLV 185

Query: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKN 244
           ++LI TYTLEPAGSHGVWGLDDHFHL YILGSSQ   + +  PL+P +ILD+  V +Y  
Sbjct: 186 KKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPI-SHNPLRPSDILDRHTVEDYAK 244

Query: 245 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 304
           TN Y Q I FI++VK G F EHSP+LYDIA TV  WSKV +GLLKMYS EVL KFPVVQH
Sbjct: 245 TNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQH 304

Query: 305 FWFGTGFFPWVNIQNGTNLPVFEEKEEET--IEQANAGPPGPEHTSTRFPA--SMSMPPP 360
           FWFGTGFFPWVN+++G  LP +E  +EE        +    P  T +  PA  S +MPPP
Sbjct: 305 FWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATKSVLPATSSTTMPPP 364

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  399 bits (1025), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 198/365 (54%), Positives = 255/365 (69%), Gaps = 16/365 (4%)

Query: 1   MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV 60
           MSL+ +D   ATF+ P KRIFD++ +  FQSS+A+ R+K +LHKY + MS    P+    
Sbjct: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE---- 56

Query: 61  ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE 120
            S+        ++L  L+ L+D TP LPGPRRYGNLACR WH K+DE L   L + LP  
Sbjct: 57  TSTNHEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEP 116

Query: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMF-PHLRGTDVFLLFNK 179
            H  + ELQYYLGN+FGS  RLDYGTGHELSF A + ALD+LG++    + +DV  LF+K
Sbjct: 117 CHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDK 176

Query: 180 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQ-APLQPREILDKSL 238
           YY ++R+L+LTYTLEPAGSHGVWGLDDHFHL+YI G+SQW  +D + AP+ PRE+ DK +
Sbjct: 177 YYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQW--VDGKCAPIAPREVQDKLI 234

Query: 239 VREYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 298
           V EY  TNFYCQ I+FI +VK GPF EHSP+L+DI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 235 VDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNK 294

Query: 299 FPVVQHFWFGTGFFPWVNIQNGTNLPVFEEKEE---ETIEQANAGPPGPEHTSTRFPASM 355
           FPVVQHFWFGTG FPW ++ +G  LP +E  +E   + ++   A  P P + ++   A  
Sbjct: 295 FPVVQHFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTA--PAPTNLNS---ARR 349

Query: 356 SMPPP 360
            M PP
Sbjct: 350 QMNPP 354

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  397 bits (1021), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 191/352 (54%), Positives = 256/352 (72%), Gaps = 10/352 (2%)

Query: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPMDNGLMQ 72
           F+TPVKRIFD+Q TL+FQ+S+AI R+KY + KY  +++    P      S I + N  + 
Sbjct: 11  FNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQG---PSRISVVNEFVG 67

Query: 73  VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVVPELQYYL 132
           VL+ ++ L+D+TPPL GPRRYGNLACR+WH K+DE++P   R++LP  +H  + EL +YL
Sbjct: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYL 127

Query: 133 GNSFGSSTRLDYGTGHELSFMATVTALDLLGMFP-HLRGTDVFLLFNKYYTIMRRLILTY 191
           GNSFGS+TRLDYGTGHELSF+A V A+D+LG+F    +G D  L+ N YY ++R+LILTY
Sbjct: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187

Query: 192 TLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNTNFYCQG 251
           TLEPAGSHGVWGLDDHFHL Y+ GS+QW     +APL+PR+IL+  LV+EY + N YCQ 
Sbjct: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYK-EAPLRPRDILNHHLVQEYAHLNLYCQT 246

Query: 252 INFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGTGF 311
           I FI +VK GPF EHS +LYD+A TV  W+K+  GL+KMY+VEVL KFPVVQHFWFGTGF
Sbjct: 247 IGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGF 306

Query: 312 FPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASMSMPPPITP 363
           +PWV+ Q G  L +++  +    ++ N    G ++ +  F +S++ P P  P
Sbjct: 307 YPWVDNQTGKQLLIYDPADA---DRRNTSSTGGKYAA--FVSSINSPVPHFP 353

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  393 bits (1009), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 247/347 (71%), Gaps = 11/347 (3%)

Query: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPMDNGLMQ 72
           F  PVKRI+D+Q T  FQSS+AI R+KY + KY  L+ +   PD ++  S IP  N L++
Sbjct: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPD-ESYVSEIPTVNKLVK 73

Query: 73  VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVV-------V 125
           ++ +L+ L+DETPP PGPRR+GNL+CREWH K+D  L   L +ML  +   +       V
Sbjct: 74  LISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSV 133

Query: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFP-HLRGTDVFLLFNKYYTIM 184
            EL YYLGNSFGSSTRLDYGTGHELSF+A +  +D+LG++  +++G D+ ++FN+YY +M
Sbjct: 134 VELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLM 193

Query: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKN 244
           ++LILTYTLEPAGSHGVWGLDDHFH  YILGS+QW   +   PL+P +I++K LV EY N
Sbjct: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETN-NPPLKPMDIVNKDLVCEYAN 252

Query: 245 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 304
           TN YC  I FI+ VK GPF EHSP+LYDI+ +V  WSKV  GLLKMY VEVL KFPVVQH
Sbjct: 253 TNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQH 312

Query: 305 FWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGP-PGPEHTSTR 350
           FWFGTG FPW++     +LP++E   ++T       P P P   STR
Sbjct: 313 FWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTR 359

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  384 bits (986), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 196/377 (51%), Positives = 256/377 (67%), Gaps = 14/377 (3%)

Query: 1   MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV 60
           M  D +D    TF+ PVKRIFD++ T  FQSS+A+ R+K HLHKY  ++S    P     
Sbjct: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPS---- 56

Query: 61  ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE 120
            +S P    L ++L   + L+DETP LPGPRRYGNLACR+WH K++E++ + L+E LP +
Sbjct: 57  ETSNPNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEK 116

Query: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMF-PHLRGTDVFLLFNK 179
           Y+  + EL YYLGN+FGS  RLDYGTGHELSF + + ALD+LG++    +  D+  LFN+
Sbjct: 117 YYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNE 176

Query: 180 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQW-QLLDAQAPLQPREILDKSL 238
           YY+++R+LI  Y+LEPAGSHGVWGLDDHFHL+YI G+SQW    DA+A   PREI  K +
Sbjct: 177 YYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEA--SPREIQSKMI 234

Query: 239 VREYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 298
           V EY  +NFYCQ I+FI +VK GPF EHSP+LYDI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 235 VDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNK 294

Query: 299 FPVVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASMSMP 358
           FPVVQHFWFGT  FPW +   G  LP + E  +ET  QA   P   +H     P+   + 
Sbjct: 295 FPVVQHFWFGTALFPWTSTDGGDVLPTY-EVSQETDTQAQL-PRMTQHQ----PSMTKLR 348

Query: 359 PPITPLSGSNINYLLSH 375
            P+ P    N++  ++H
Sbjct: 349 HPMNPPHLRNVSRFIAH 365

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  373 bits (958), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/376 (49%), Positives = 246/376 (65%), Gaps = 24/376 (6%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIP 65
           V+     FS PVKRIFD+  T DFQ SL ++R++ HL +Y  L+ +   P    V+++  
Sbjct: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVP---KVSTNGS 59

Query: 66  MDNGLMQVLDKLAHLIDETPPLPG-PRRYGNLACREWHHKLDERLPQWLREMLPPE---- 120
           + + +   LD+   LIDETPP    PRR+GN+ACR+WH K+ E +    R  LP E    
Sbjct: 60  VSSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAA 119

Query: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFP------HLRGTDVF 174
           Y   + EL+YYLGN+FGS  RLDYGTGHELSF+A V A+D+LG++        L GTD+ 
Sbjct: 120 YENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLL 179

Query: 175 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREIL 234
            L+NKYY+I+ +LILTYTLEPAGSHGVWGLDDH HL YI+G+SQW   D  AP+Q  +IL
Sbjct: 180 YLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDIL 239

Query: 235 DKSLVREYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294
           D   + +Y++TN YC  I F+ +VK GPF +HSP+LYDI+ TVP WSK   GL+KMY VE
Sbjct: 240 DMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVE 299

Query: 295 VLKKFPVVQHFWFGTGFFPWVNIQNGTNLPVFE----------EKEEETIEQANAGPPGP 344
           VL KFPVVQHFWFGTGFFPWV+++ G +LP +E            + +  E +    P  
Sbjct: 300 VLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTA 359

Query: 345 EHTSTRFPASMSMPPP 360
             +S +   S +MPPP
Sbjct: 360 TGSSGKLTTSAAMPPP 375

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  363 bits (933), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 192/374 (51%), Positives = 240/374 (64%), Gaps = 14/374 (3%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIP 65
           VD   + FS P KRIFD+QTT  FQ S+A +R+KY  +KY  L+     P P +   ++ 
Sbjct: 10  VDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGV--PLPVSRNITMT 67

Query: 66  MDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPP----EY 121
           +   ++ +LDK +  IDETPPL  PRR+GNL+CR WH K++  LP  L+ ++      E 
Sbjct: 68  ITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN 127

Query: 122 HVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKYY 181
             +  EL YYL NSFGS TRLDYGTGHELSF+A ++ +D++ M   +   D  L++  YY
Sbjct: 128 ENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYY 187

Query: 182 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVRE 241
            + R+LILTYTLEPAGSHGVWGLDDHFHL YI GSSQ  L+   + L P++IL K +V E
Sbjct: 188 NLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQ--LISDISHLAPKDILKKDVVAE 245

Query: 242 YKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
           +K  N YCQ INFI  VK GPF EHSPILYDI+  V  WSKV KGLLKMY+ EVL KFPV
Sbjct: 246 HKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPV 305

Query: 302 VQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQA-NAGPPGPEHTSTRFPASMSMPPP 360
           VQHFWFG GFFPW +  +G +LPVFE  E E+   A     P    T   F  + S   P
Sbjct: 306 VQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSSKSP 365

Query: 361 ITPLSGSNINYLLS 374
           I      N NY +S
Sbjct: 366 IM-----NPNYKMS 374

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  363 bits (933), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 175/335 (52%), Positives = 227/335 (67%), Gaps = 18/335 (5%)

Query: 10  HATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPMDNG 69
           +  FS P K+IFD+Q T  F  S+A HRI+Y + KYT L+     P P    SS    +G
Sbjct: 12  NCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIP-PTDYTSSNDTISG 70

Query: 70  LMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPP-----EYHVV 124
           + ++++ L  L++ETPPLPGPRRYGNL+CR+WH ++D+ + +   + L           +
Sbjct: 71  VSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKYYTIM 184
             EL YY   S GS TRLDYGTGHELSF+A + ALD+L +   + GTD+  +FN+YY ++
Sbjct: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFNEYYRLI 190

Query: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDA------------QAPLQPRE 232
           R+LIL YTLEPAGSHGVWGLDDHFHL+YI GSSQW   +A            +AP++P +
Sbjct: 191 RKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVD 250

Query: 233 ILDKSLVREYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYS 292
           IL+K+L+ ++K++NFYCQ I FI  VK GPF EHSPIL+DIA  V  W KV  GLLKMY 
Sbjct: 251 ILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310

Query: 293 VEVLKKFPVVQHFWFGTGFFPWVNIQNGTNLPVFE 327
           VEVL KFPVVQHFWFGTGF+PW+N      LP +E
Sbjct: 311 VEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYE 345

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  358 bits (920), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 175/336 (52%), Positives = 232/336 (69%), Gaps = 14/336 (4%)

Query: 3   LDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVAS 62
           L  ++    +FS P+KRI+D+Q+T  FQSS+AI+R+KY+LHKY  ++ +   PD   V S
Sbjct: 4   LSTINIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYV-S 62

Query: 63  SIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYH 122
            I + N +  +L +L++ ID  PP  GPRRYGNLACR WH  +D ++P  L ++L    H
Sbjct: 63  EITIVNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNH 122

Query: 123 V-----------VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFP-HLRG 170
                        + EL YYL NS GS+TRLDYGTGHELSF+A + A+D+LG++  + +G
Sbjct: 123 ATEKGEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKG 182

Query: 171 TDVFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQP 230
            D+  +F+ YY ++++LI+TYTLEPAGSHGVWGLDDHFHL YILGSSQ    +   P  P
Sbjct: 183 VDLLHMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSE-NPNPPFSP 241

Query: 231 REILDKSLVREYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKM 290
            +I++K +V EY + NFYC  I+FI +VK GPF EHSPILYDI+ TV  W KV  GL+KM
Sbjct: 242 SDIINKKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKM 301

Query: 291 YSVEVLKKFPVVQHFWFGTGFFPWVNIQNGTNLPVF 326
           Y VEVL KFPVVQHFWFG GF+PW N++    L V+
Sbjct: 302 YMVEVLNKFPVVQHFWFGEGFYPWKNVKTHKLLDVY 337

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  351 bits (901), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 235/348 (67%), Gaps = 17/348 (4%)

Query: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPMDNGLMQ 72
           FS PVKRI+D+Q    FQSS AI R++  + KYT L+      D +       +    ++
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSGVVGGV----VK 57

Query: 73  VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREML----PPEYHVVVPEL 128
           VLD+L  L+ ETPP+PGPRRYGN+ACR+WH K++  +P  L +++    P E   VV EL
Sbjct: 58  VLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVV-EL 116

Query: 129 QYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKYYTIMRRLI 188
           +YYL NSFGS+TRLD+GTGHELSF+ATV ALD+LG      G  V  +F++YY+++ RLI
Sbjct: 117 RYYLANSFGSATRLDFGTGHELSFLATVAALDMLG--ASFDGDQVLYIFDRYYSLVHRLI 174

Query: 189 LTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNTNFY 248
           L+YTLEPAGSHGVWGLDDHFHL YILGSSQW     +  ++P ++ D  LV +Y  TN +
Sbjct: 175 LSYTLEPAGSHGVWGLDDHFHLAYILGSSQW-CNRKKLAMEPNDLSDPVLVEQYSRTNIF 233

Query: 249 CQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFG 308
           C+ +NF+  VK G F EHSP+L+DI+ +V  W+KV KGL KMY  EVL KFPV+QHFWFG
Sbjct: 234 CKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFG 293

Query: 309 TGFFPWVNIQNGTNLPVFE-----EKEEETIEQANAGPPGPEHTSTRF 351
           TGF+PWV+ +NG  LP +E     ++  +   QA A   G     +RF
Sbjct: 294 TGFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRF 341

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  347 bits (890), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 173/349 (49%), Positives = 231/349 (66%), Gaps = 12/349 (3%)

Query: 7   DWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPM 66
           D+ +A FS P KRIFD+Q TLDFQ+S+A+ RI+YHL KY TL      PD   +  S   
Sbjct: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPD--TIKESF-F 60

Query: 67  DNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVVP 126
            N ++++L +L+ LIDETPP     RYGNL+ R+W  K   +L  WL E+LP +Y+  + 
Sbjct: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSII 120

Query: 127 ELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKYYTIMRR 186
           EL YY+ N+FGS  R+DYGTGHELSF+A +  LD+L +   ++G  +   FN YY ++++
Sbjct: 121 ELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI-ETIKGPALLYCFNSYYDVIQK 179

Query: 187 LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNTN 246
           LILTY LEPAGSHGVWGLDDHFH  YILG++Q  LLD    L P++I +  L+ +  ++N
Sbjct: 180 LILTYKLEPAGSHGVWGLDDHFHFSYILGATQ--LLDVNTSLIPKDISNTRLMEQNSSSN 237

Query: 247 FYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFW 306
            +C+ I FIN VK GPF  HSP+LY+I+ +V  W K+ +GL+KMY VEVL KFPVVQHFW
Sbjct: 238 LFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFW 297

Query: 307 FGTGFFPWVNIQNGTNLPVFEEKEEE------TIEQANAGPPGPEHTST 349
           FGT FFPW +  N  +LP+++  E        T   A    P P  TST
Sbjct: 298 FGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLSTST 346

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  347 bits (890), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 183/396 (46%), Positives = 249/396 (62%), Gaps = 23/396 (5%)

Query: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIP 65
           +D  HA F  P KRIFD+QTT  FQ S+A+ RI++H+ KY  +M          +++S+ 
Sbjct: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTS---GGISASVA 72

Query: 66  MDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVV 125
               ++Q+LD+L  L+DETPPL GPRRYGNLACR+WH K+D  LP    ++         
Sbjct: 73  R---MLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGAC 129

Query: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKYYTIMR 185
            E +YYL NSFGS  RLDYGTGHELSF+A V ALD++     +   ++  L+++YY ++R
Sbjct: 130 IEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVR 189

Query: 186 RLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSL-VREYKN 244
           RLI+ Y LEPAGSHGVWGLDDHFHL Y+ G+SQ+   +    +QPR++L   +  R+   
Sbjct: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA--NNPVGVQPRDVLSGVIPGRDDAP 247

Query: 245 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 304
            NF  + I F+  VK GPF E+SP+L DI   V  W K+ +GL +MY+ EVL KFPVVQH
Sbjct: 248 ANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307

Query: 305 FWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAG-PPGPEHTS-----TRFPASM-SM 357
           FWFGT FFPW ++++GT LPV+E+  +   E  ++G PPGP  T+     T   AS+ S 
Sbjct: 308 FWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSGAPPGPGTTTLPALDTSTMASVPSR 367

Query: 358 PPPITPLSGSNINYLLSHQNHSQRNQPSSPRDRLRR 393
            P + P +G  +N  + H   S        RDRLRR
Sbjct: 368 RPAMGPPAGRQVNKFIQHTTASH-------RDRLRR 396

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  345 bits (884), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 217/324 (66%), Gaps = 8/324 (2%)

Query: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPMDNGLMQ 72
           FS PVKRIFDT  T DFQ SL ++R++ HL +Y  L+     P      + +      + 
Sbjct: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVVR----FVC 65

Query: 73  VLDKLAHLIDETPPLPG-PRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVVPELQYY 131
           +L++L  L+DETPP  G  RR+G+LACR+WH ++   L   L  +LP        EL+YY
Sbjct: 66  ILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYY 125

Query: 132 LGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPH--LRGTDVFLLFNKYYTIMRRLIL 189
           LG++FGS  RLDYGTGHEL+F+A V ALD+LG++      G D+  ++ +YY ++ RLIL
Sbjct: 126 LGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLIL 185

Query: 190 TYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNTNFYC 249
           TY LEPAGSHGVWGLDDH HL YILG+SQW   D   P+QP +ILD   V  Y  TN YC
Sbjct: 186 TYNLEPAGSHGVWGLDDHLHLAYILGASQWAQ-DRNVPMQPSDILDPKAVARYSETNLYC 244

Query: 250 QGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGT 309
             I F+  VK G F +HSP+L+DIA TVP WSKV  GL+KMY VEVL KFPVVQHFWFGT
Sbjct: 245 NSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGT 304

Query: 310 GFFPWVNIQNGTNLPVFEEKEEET 333
           GFFPWV++ +G +LP +E   E +
Sbjct: 305 GFFPWVDMAHGMSLPNYEAPSETS 328

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  162 bits (409), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 99/249 (39%), Positives = 140/249 (56%), Gaps = 11/249 (4%)

Query: 65  PMDNGLMQVLDKLAHLIDETPPLPGPR--RYGNLACREWHHKLDERLPQWLREMLPPEYH 122
           P  N L Q+L  +  +ID+ P L      R+G    R ++ +++E   + + E  P   H
Sbjct: 50  PAINTLEQILVSIDKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSLTH 109

Query: 123 VVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTAL---DLLGMFPHLRGTDVFLLFNK 179
             + +L  YL  S+G+  R+DYG+GHEL+FM  +  L   D+L +    R   V ++F K
Sbjct: 110 EQLEQLTIYLDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNM-VLIIFIK 168

Query: 180 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLV 239
           Y  IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I ++ LV
Sbjct: 169 YLDIMRSLETKYWLEPAGSHGVWGLDDYHFLPFLFGAYQ---LATHKHLKPLSIHNEELV 225

Query: 240 REYKNTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 298
             +     Y   I FIN VK       HSP+L DI+  V RWSKV +G++KMY+ EVL K
Sbjct: 226 EMFAKKYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSK 284

Query: 299 FPVVQHFWF 307
            P++QHF+F
Sbjct: 285 LPIMQHFYF 293

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  159 bits (402), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 103/314 (32%), Positives = 169/314 (53%), Gaps = 23/314 (7%)

Query: 56  DPQAVASSIPMDNGLMQVLDKLAHLIDETPPLPGPR--RYGNLACREWHHKLDERLPQWL 113
           + Q V    P    L  +LD++  L+D+ P +   +  R+G +  R+++ +L+E+    +
Sbjct: 41  NSQIVEPISPSIASLSSLLDEVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLI 100

Query: 114 REMLPPEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTD- 172
           +          + +L  YL  S+G+  R+DYG+GHEL+F+  +  L   G+F   +    
Sbjct: 101 KTRFSTLSDEQLEQLSIYLDESWGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAIN 160

Query: 173 -VFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPR 231
            V ++F KY  IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P 
Sbjct: 161 LVLVVFLKYLNIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LVPHKHLKPM 217

Query: 232 EILDKSLVREYKNTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKM 290
            I ++ LV  +K+   Y   I+FIN VK       HSP+L DI+  V +WSKV +G++KM
Sbjct: 218 SIHNEELVELFKDKFLYFGCISFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKM 276

Query: 291 YSVEVLKKFPVVQHFWFG------TGFFPWVN--IQNGTNLPVFEEKEEETIEQANAGPP 342
           Y+ EVL K P++QHF+F        G  P  +  I NGT+      +++E +++ +    
Sbjct: 277 YTAEVLGKLPIMQHFYFSEFLKCPEGISPARSNHIHNGTD------EDDECLQEGHTHST 330

Query: 343 GPEHTSTRFPASMS 356
             +    + P++++
Sbjct: 331 WGDCCGIKLPSAIA 344

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  156 bits (394), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 156/301 (51%), Gaps = 24/301 (7%)

Query: 69  GLMQVLDKLAHLIDETPPLPGPR--RYGNLACREWHHKLDERLPQWLREMLPPEYHVVVP 126
            +M++L K+  ++ + P +      R+G +  R+++  L  +    L+E  P      + 
Sbjct: 54  SMMKLLHKVQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQIE 113

Query: 127 ELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTD--VFLLFNKYYTIM 184
           +L  Y+  S+G+  R+DYG+GHEL+FM  +  L    +F   R     V  +F +Y  +M
Sbjct: 114 QLYVYVDESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVLKVFIQYLKLM 173

Query: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKN 244
           R L L Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I +  L+  + +
Sbjct: 174 RVLELQYWLEPAGSHGVWGLDDYHFLPFLFGAYQ---LSTHKHLKPSSIHNDDLIEMFAD 230

Query: 245 TNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQ 303
              Y   I FIN VK       HSP+L DI+  V +WSKV +G+ KMY  EV+KK P++Q
Sbjct: 231 KYLYFGCIEFINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPIMQ 289

Query: 304 HFWFGTGFF--------PWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASM 355
           HF+F   F         P  +I +G        +E+E + + +A     +    + P+++
Sbjct: 290 HFYFNDMFLICPENVSPPREHIHDGG-------EEDECLAEGHAHSTYGDCCGIKVPSAI 342

Query: 356 S 356
           +
Sbjct: 343 A 343

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  154 bits (389), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 94/244 (38%), Positives = 137/244 (56%), Gaps = 9/244 (3%)

Query: 71  MQVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVVPEL 128
           MQ+L K+  LID+ P +      R+G +  R+++  L     + +    P      V EL
Sbjct: 56  MQLLKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSLNKDQVEEL 115

Query: 129 QYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLR-GTDVFL-LFNKYYTIMRR 186
             YL  S+G+  R+DYG+GHEL+F+  +  L +  +F   R   D+ L +F +Y  IMR 
Sbjct: 116 AVYLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRIMRI 175

Query: 187 LILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNTN 246
           L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I ++ +V  + +  
Sbjct: 176 LETKYWLEPAGSHGVWGLDDYHFLPFLFGAHQ---LATHPHLRPKSIHNEEVVEMFMDKY 232

Query: 247 FYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHF 305
            Y   I FIN VK       HSP+L DI+  V  W+KV +G++KMY  EVL K P++QHF
Sbjct: 233 IYFGCIAFINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKLPIMQHF 291

Query: 306 WFGT 309
           +FG 
Sbjct: 292 YFGN 295

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  154 bits (388), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 140/249 (56%), Gaps = 10/249 (4%)

Query: 70  LMQVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVVPE 127
           +M +L  +  +I + P +      R+G +  R+++ ++ +   ++LR   P      + +
Sbjct: 55  MMNLLSYIRDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLRSEFPSLTDEQLEQ 114

Query: 128 LQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLL--FNKYYTIMR 185
           L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F     +   +L  F +Y  IMR
Sbjct: 115 LSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLKIMR 174

Query: 186 RLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNT 245
            L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L +   L+P  I +  LV  + N 
Sbjct: 175 ILETRYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTSHKHLKPISIHNNELVEMFANR 231

Query: 246 NFYCQGINFINEVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 304
             Y   I+FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P++QH
Sbjct: 232 YLYFGCIDFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQH 290

Query: 305 FWFGTGFFP 313
           F+F + F P
Sbjct: 291 FYF-SDFLP 298

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  153 bits (387), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 139/268 (51%), Gaps = 9/268 (3%)

Query: 46  TTLMSHCADPDPQAVASSIPMD-NGLMQVLDKLAHLIDETPPL-PGPRRYGNLACREWHH 103
           T L     D D       I  + +  + +LD +  ++DE P L     R+G    R ++ 
Sbjct: 32  TDLAEAVKDRDNTQFKEPISAEVSSTLALLDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQ 91

Query: 104 KLDERLPQWLREMLPPEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLG 163
            +       L +         + +L  Y   S+G+  R+DYG+GHEL+F+  +  L    
Sbjct: 92  DVKSNCHNLLSKAFDTLTTNQIEQLSIYFYESWGNEERIDYGSGHELNFICFLYGLYKYD 151

Query: 164 MFPHLRGTD--VFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQL 221
           +F   R +   V L+F KY  IMRRL   Y LEPAGSHGVWGLDD+  L ++ G+ Q   
Sbjct: 152 VFRLERDSTNIVILVFVKYLKIMRRLETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQ--- 208

Query: 222 LDAQAPLQPREILDKSLVREYKNTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRW 280
           L     L+P+ I +  +V  +K+   Y   I FIN VK       HSP+L DI+  V +W
Sbjct: 209 LSNHKHLKPKSIHNDEIVDMFKDKYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKKW 267

Query: 281 SKVCKGLLKMYSVEVLKKFPVVQHFWFG 308
           SKV +G++KMY  EVL K PV+QHF+F 
Sbjct: 268 SKVSEGMIKMYVAEVLSKLPVMQHFYFS 295

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  153 bits (386), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 146/270 (54%), Gaps = 12/270 (4%)

Query: 65  PMDNGLMQVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLREMLPPEYH 122
           P    L  +L+++  +    P L      R+G +  R++H ++  R    + ++ P    
Sbjct: 58  PAIEALEALLEEMQGIAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALVLQVDPSLTD 117

Query: 123 VVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFL-LFNKYY 181
               EL  YLGN++G   R+DYG+GHEL+F+  +  L   G+      T+  L +F KY 
Sbjct: 118 EQAQELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTNAVLRVFVKYM 177

Query: 182 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVRE 241
            +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I +  +V  
Sbjct: 178 DVMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LATHKHLKPKSIHNPEVVEL 234

Query: 242 YKNTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           ++N   Y   I FIN VK       HSP+L DI+  V  W+KV +G++KMY  EVL K P
Sbjct: 235 FENRYLYFGCIAFINRVKTTASLRWHSPMLDDIS-GVRSWTKVSEGMVKMYKAEVLGKLP 293

Query: 301 VVQHFWFGTGFFPWVNIQNGTNLPVFEEKE 330
           ++QHF+F + F P   + +G + P   E+E
Sbjct: 294 IMQHFFF-SRFLP---VPDGVSPPRTSEEE 319

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  152 bits (385), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 93/260 (35%), Positives = 143/260 (55%), Gaps = 12/260 (4%)

Query: 58  QAVASSIPMDNGLMQVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLRE 115
           Q ++S I     L  +LD +A ++D+ P +   G  R+G +  R+++ ++ E   + +  
Sbjct: 46  QPISSQI---ENLCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELISS 102

Query: 116 MLPPEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFL 175
           +        V EL  Y   S+G   R+DYG+GHEL+F+  +  L    +       ++ L
Sbjct: 103 LSSELTDEQVEELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVL 162

Query: 176 -LFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREIL 234
            +F KY  +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I 
Sbjct: 163 KVFIKYLDVMRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPKSIH 219

Query: 235 DKSLVREYKNTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSV 293
           +  +V  ++    Y + + FIN+VK       HSP+L DI+  V  WSKV +G++KMY  
Sbjct: 220 NPEIVEVFEKRYMYFECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKA 278

Query: 294 EVLKKFPVVQHFWFGTGFFP 313
           EVL K P++QHF+F T F P
Sbjct: 279 EVLGKLPIMQHFFFST-FLP 297

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  152 bits (383), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 139/261 (53%), Gaps = 14/261 (5%)

Query: 58  QAVASSIPMDNGLMQVLDKLA--HLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLRE 115
           Q +  SI     L++ +D+    H ++ T    GP R+G    R+ +  +  R    ++E
Sbjct: 47  QPIGGSIQSVEALIECVDQCIENHPVEST----GPSRFGKGEFRDLYDDISGRSSVLIKE 102

Query: 116 MLPPEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTD--V 173
                    V +L  Y   S+G  +R+DYG+GHEL+F+  +  L   G+F   +     V
Sbjct: 103 KFGSLTDEQVAQLSVYFNESWGDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNLV 162

Query: 174 FLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREI 233
            ++F KY   MR +   Y LEPAGSHGVWGLDD+  L ++ G+SQ   L     L+P+ I
Sbjct: 163 LIVFMKYLKTMRVIETVYWLEPAGSHGVWGLDDYHFLPFLFGASQ---LSTHRHLKPKSI 219

Query: 234 LDKSLVREYKNTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYS 292
            +  +V  +     Y   I+FIN VK       HSP+L DI+  V  W+KV +G++KMY 
Sbjct: 220 HNPEVVEMFSEKYLYFGCIDFINSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYD 278

Query: 293 VEVLKKFPVVQHFWFGTGFFP 313
            EVL K P++QHF+F + F P
Sbjct: 279 AEVLCKLPIMQHFYF-SEFLP 298

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  151 bits (382), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 89/243 (36%), Positives = 132/243 (54%), Gaps = 9/243 (3%)

Query: 72  QVLDKLAHLIDETPPLPGPR--RYGNLACREWHHKLDERLPQWLREMLPPEYHVVVPELQ 129
           Q+L+++A L ++ P        R+G +  R ++  L  +    ++            EL 
Sbjct: 57  QLLEEVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAFDALDGTQCEELS 116

Query: 130 YYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMF--PHLRGTDVFLLFNKYYTIMRRL 187
            Y   S+G  +R+DYG+GHEL+F+  +  L   G+F  P      V  LF KY  +MR L
Sbjct: 117 VYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVLKLFIKYLGVMRTL 176

Query: 188 ILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNTNF 247
              Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I +  +V  +     
Sbjct: 177 ETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSTHKHLKPKSIHNSEVVEMFGKRYL 233

Query: 248 YCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFW 306
           Y   I+FIN+VK       HSP+L DI+  V  W+KV +G++KMY  EVL K P++QHF+
Sbjct: 234 YFGCIDFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLNKLPIMQHFF 292

Query: 307 FGT 309
           FG+
Sbjct: 293 FGS 295

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  150 bits (380), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 137/249 (55%), Gaps = 9/249 (3%)

Query: 65  PMDNGLMQVLDKLAHLIDETPPLPGPR--RYGNLACREWHHKLDERLPQWLREMLPPEYH 122
           P     M +L  + ++ID+ P +   +  R+G +  R+++ +L  +    +    P    
Sbjct: 50  PQIESFMGLLKSVNNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAYPSLTE 109

Query: 123 VVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRG--TDVFLLFNKY 180
             + +L  YL  S+G+  R+DYG+GHEL+F+  +  L    +F   +     V  +F +Y
Sbjct: 110 DQLDQLYVYLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNMVLKIFIEY 169

Query: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240
             +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I ++ LV 
Sbjct: 170 LRVMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LATHKHLKPLSIHNEELVE 226

Query: 241 EYKNTNFYCQGINFINEVKMG-PFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKF 299
            +++   Y   + FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL K 
Sbjct: 227 MFQDKYLYFSCVAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKL 285

Query: 300 PVVQHFWFG 308
           P++QHF+FG
Sbjct: 286 PIMQHFYFG 294

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  150 bits (378), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 141/254 (55%), Gaps = 12/254 (4%)

Query: 60  VASSIPMDNGLMQVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLREML 117
           ++SSI   + L  +LDK+  ++   P +      R+G +  R+++  L  R  + +  + 
Sbjct: 48  ISSSI---DELCSLLDKVNKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLS 104

Query: 118 PPEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLR-GTDVFL- 175
                  V EL  Y   S+G+ TR+DYG+GHEL+F+  +  L+    F   +  T+V L 
Sbjct: 105 DKLSTPQVDELAAYFRKSWGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLR 164

Query: 176 LFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILD 235
           +F KY  +MR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I +
Sbjct: 165 VFIKYLDVMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LATHKHLKPKSIHN 221

Query: 236 KSLVREYKNTNFYCQGINFINEVKMG-PFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294
           K  V  ++    Y   I FIN VK       HSP+L DI+  V  WSKV +G++KMY  E
Sbjct: 222 KEFVEMFEKRYLYFGCIGFINSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAE 280

Query: 295 VLKKFPVVQHFWFG 308
           VL K P++QHF+FG
Sbjct: 281 VLGKLPIMQHFYFG 294

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  150 bits (378), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 140/260 (53%), Gaps = 16/260 (6%)

Query: 53  ADPDPQAVASSIPMDNGLMQVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLP 110
           ++P   +V S+I        VL ++  LI   P +      R+G +  R+++  + E+  
Sbjct: 45  SEPVSDSVQSTIA-------VLTEIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKAD 97

Query: 111 QWLREMLPPEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRG 170
             L    P      + +L  YL  S+G+  R+DYG+GHEL+F+  +  L    +F   R 
Sbjct: 98  DLLSSHFPALTSEQIEQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRD 157

Query: 171 TD--VFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPL 228
               V +LF +Y  IMR +   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L
Sbjct: 158 ARNLVLVLFIEYLKIMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LAPHKHL 214

Query: 229 QPREILDKSLVREYKNTNFYCQGINFINEVKMG-PFEEHSPILYDIAVTVPRWSKVCKGL 287
           +P+ I ++ LV  + +   Y   I FIN VK       HSP+L DI+  V +WSKV +G+
Sbjct: 215 KPKSIHNEELVEMFADKYLYFGCIAFINSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGM 273

Query: 288 LKMYSVEVLKKFPVVQHFWF 307
           +KMY  EVL K P++QHF+F
Sbjct: 274 IKMYKAEVLGKLPIMQHFYF 293

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  150 bits (378), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 151/289 (52%), Gaps = 13/289 (4%)

Query: 30  QSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPMDNGLMQVLDKLAHLIDETPPLPG 89
           +S    H  K+ +    ++  H      + ++ SI   N +M +L ++  +  + P +  
Sbjct: 18  ESPTRAHFTKFIIDLAESVKGHENSQYKEPISESI---NSMMNLLSQIKDITQKHPVIKD 74

Query: 90  P--RRYGNLACREWHHKLDERLPQWLREMLPPEYHVVVPELQYYLGNSFGSSTRLDYGTG 147
               R+G +  R+++ ++     + LR   P      + +L  YL  S+G+  R+DYG+G
Sbjct: 75  ADSSRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIYLDESWGNKRRIDYGSG 134

Query: 148 HELSFMATVTALDLLGMFPHLRGTD--VFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLD 205
           HEL+FM  +  L   G+F     +   V  +F +Y  IMR L   Y LEPAGSHGVWGLD
Sbjct: 135 HELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETKYWLEPAGSHGVWGLD 194

Query: 206 DHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNTNFYCQGINFINEVKM-GPFE 264
           D+  L ++ G+ Q   L     L+P  I +  LV  + +   Y   I FIN+VK      
Sbjct: 195 DYHFLPFLFGAFQ---LTTHKHLKPISIHNNELVEMFAHRYLYFGCIAFINKVKSSASLR 251

Query: 265 EHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGTGFFP 313
            HSP+L DI+  V  WSKV +G++KMY  EVL K P++QHF+F + F P
Sbjct: 252 WHSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYF-SEFLP 298

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  149 bits (377), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 136/243 (55%), Gaps = 9/243 (3%)

Query: 70  LMQVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVVPE 127
           +M +L ++  +I + P +      R+G +  R+++ ++ +   + LR   P      + +
Sbjct: 55  MMNLLSQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRSEFPHLTDEQLEQ 114

Query: 128 LQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLL--FNKYYTIMR 185
           L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F     +   +L  F +Y  IMR
Sbjct: 115 LSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQIMR 174

Query: 186 RLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNT 245
            L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I +  LV  + + 
Sbjct: 175 ILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPISIHNNELVEMFAHR 231

Query: 246 NFYCQGINFINEVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 304
             Y   I FIN+VK       HSP+L DI+  V  WSKV +G++KMY VEVL K P++QH
Sbjct: 232 YLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLSKLPIMQH 290

Query: 305 FWF 307
           F+F
Sbjct: 291 FYF 293

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  148 bits (373), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 94/248 (37%), Positives = 134/248 (54%), Gaps = 13/248 (5%)

Query: 68  NGLMQVLDKLAHLIDETPPLPG---PRRYGNLACREWHHKLDERLPQWLREMLPPEYHVV 124
             LM +L ++  +I+  P         R+G +  R+++ +L       +    P      
Sbjct: 56  EALMGLLQQVRGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQLTQNQ 115

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTD----VFLLFNKY 180
           V +LQ YL  S+G   R+DYG+GHEL+FM  +  L    +F  L GTD    V   F +Y
Sbjct: 116 VRQLQTYLEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVFD-LGGTDRANLVLKPFIEY 174

Query: 181 YTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVR 240
             IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I ++ +V 
Sbjct: 175 LKIMRVLETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSTHKHLKPLSIHNEEVVE 231

Query: 241 EYKNTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKF 299
            + +   Y   I+FIN VK       HSP+L DI+  V +WSKV +G++KMY  EVL K 
Sbjct: 232 LFADKYLYFGCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVLSKL 290

Query: 300 PVVQHFWF 307
           P++QHF+F
Sbjct: 291 PIMQHFYF 298

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  147 bits (372), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 90/246 (36%), Positives = 138/246 (56%), Gaps = 14/246 (5%)

Query: 72  QVLDKLAHLID--ETPPLPGPRRYGNLACREWHHKLDERLPQWLREML----PPEYHVVV 125
            +L K+  +I   E        R+G +  R+++  + E   + + ++      P+   + 
Sbjct: 56  NLLSKVTEIIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNELISKIFEGIEKPDTGKLD 115

Query: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTD--VFLLFNKYYTI 183
               Y++ NS+G  +R+DYG+GHEL+F+  +  L    +F     +   V +LF KY  I
Sbjct: 116 DICTYFI-NSWGDRSRIDYGSGHELNFICFLYCLTESKVFDLENDSSNIVLMLFIKYLGI 174

Query: 184 MRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYK 243
           MR L L Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P+ I +  +V  ++
Sbjct: 175 MRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSTHKHLKPKSIHNPEVVEMFQ 231

Query: 244 NTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVV 302
           +   Y   I FIN+VK       HSP+L DI+  V RWSKV +G++KMY  EVL+K P++
Sbjct: 232 DRYLYFGCIAFINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYKAEVLQKLPIM 290

Query: 303 QHFWFG 308
           QHF+FG
Sbjct: 291 QHFYFG 296

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  147 bits (370), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 159/311 (51%), Gaps = 19/311 (6%)

Query: 56  DPQAVASSIPMDNGLMQVLDKLAHLID-------ETPPLPGPRRYGNLACREWHHKLDER 108
           D Q    S+P+ + +      L  + D       E+       R+G +  + ++  +++ 
Sbjct: 37  DYQNSQLSLPLSDSINNAFSLLQDIRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQN 96

Query: 109 LPQWLREMLPPEYHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHL 168
             + ++          + EL  YL  S+G+  R+DYG+GHEL+F+  +  L    +F  L
Sbjct: 97  SEKLIKSHFNGLDPNQIQELSIYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLL 156

Query: 169 RGTD--VFLLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQA 226
             +   V  +F +Y  IMR +   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L    
Sbjct: 157 EDSTNLVLKIFMEYINIMRIIETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LSKHK 213

Query: 227 PLQPREILDKSLVREYKNTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCK 285
            L+P  I ++ +V  +K+   Y   I+FIN +K       HSP+L DI+  V +WSKV +
Sbjct: 214 HLKPISIHNEEMVEMFKDKYMYFGCIDFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSE 272

Query: 286 GLLKMYSVEVLKKFPVVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPE 345
           G++KMYS EVL K P++QHF+F + F P      G +LP    K +  IE+ +      +
Sbjct: 273 GMIKMYSAEVLGKLPIMQHFYF-SDFLP---CPQGVSLPHIHGK-DGNIEETHVHSTWGD 327

Query: 346 HTSTRFPASMS 356
               + P++++
Sbjct: 328 CCGIQIPSAIA 338

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  146 bits (369), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 93/253 (36%), Positives = 142/253 (56%), Gaps = 18/253 (7%)

Query: 70  LMQVLDKLAHLIDETPPL--PGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVVPE 127
           ++ +L ++  +I++ P +      R+G +  R+++    + + Q  R++L  E+ ++  E
Sbjct: 55  MLSLLSRVRDIIEKHPVVHDVDSSRFGKVEFRDFY----DEVSQNSRKLLKSEFSLLTDE 110

Query: 128 ----LQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLL--FNKYY 181
               L  YL  S+G+  R+DYG+GHEL+FM  +  L   G+F     +   +L  F +Y 
Sbjct: 111 QLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEYL 170

Query: 182 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVRE 241
            IMR L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   L     L+P  I +  LV  
Sbjct: 171 DIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQ---LTTHKHLKPISIHNSELVEM 227

Query: 242 YKNTNFYCQGINFINEVKM-GPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFP 300
           + +   Y   I FIN+VK       HSP+L DI+  V  WSKV +G++KMY  EVL K P
Sbjct: 228 FSDRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLP 286

Query: 301 VVQHFWFGTGFFP 313
           ++QHF+F + F P
Sbjct: 287 IMQHFYF-SEFLP 298

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  143 bits (361), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 127/248 (51%), Gaps = 16/248 (6%)

Query: 74  LDKLAHLIDETPPLPG---------PRRYGNLACREWHHKLDERLPQWLREMLPPEYHVV 124
           +DK   L+DE   +             R+G +  R ++  L  +    + +         
Sbjct: 52  IDKCCSLLDEVFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFDQLSQDQ 111

Query: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTD--VFLLFNKYYT 182
             EL  Y   S+G   R+DYG+GHEL+F+  +  L   G+F   R     V  +F  Y  
Sbjct: 112 AEELVAYFVESWGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYRNLVLKVFIHYLE 171

Query: 183 IMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREY 242
           +MR L  TY LEPAGSHGVWGLDD+  L ++ G+SQ   L     L+P+ I +  LV  +
Sbjct: 172 LMRVLETTYWLEPAGSHGVWGLDDYHFLPFLFGASQ---LAPHKHLKPKSIHNNELVDMF 228

Query: 243 KNTNFYCQGINFINEVK-MGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 301
            +   Y   I+FIN VK       HSP+L DI+     WSKV +G++KMY  EVL K P+
Sbjct: 229 ASRYLYFGCIDFINRVKTTASLRWHSPMLDDIS-GAKSWSKVAEGMIKMYRKEVLAKLPI 287

Query: 302 VQHFWFGT 309
           +QHF FG+
Sbjct: 288 MQHFLFGS 295

>Suva_7.286 Chr7 (491878..494118) [2241 bp, 746 aa] {ON} YGR003W
           (REAL)
          Length = 746

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 62/148 (41%), Gaps = 23/148 (15%)

Query: 252 INFINEVKMG---PFEEHSPILYDIAVTVP-RWSKVCKGLLKMYSVEVLKKFPVVQH--- 304
           +NF+ EV      PF+  +PI  D ++T+P R S++  G  + YS++  ++     H   
Sbjct: 500 MNFVPEVLTRTSWPFQSTNPI--DDSITLPPRMSQILMGFNEYYSLKYKERILKWAHHLS 557

Query: 305 -----FWFGTGFFPW-VNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFPASMSMP 358
                  F  G++    ++  G    +FE  EE T+E+ +     PE        SMS  
Sbjct: 558 VIEIGCQFNNGYYEISFSVYAGAIFLLFENYEELTLEEIHELTHIPEEDVKSLVMSMSTV 617

Query: 359 PPITPLSGS--------NINYLLSHQNH 378
           P    L  S        ++NY  S  N 
Sbjct: 618 PKCRILKRSSNTGDTKFSVNYFFSAPNR 645

>KLLA0E06139g Chr5 complement(555427..556638) [1212 bp, 403 aa] {ON}
           similar to uniprot|Q12199 Saccharomyces cerevisiae
           YPR040W TIP41 Protein involved in regulation of the TOR
           pathway
          Length = 403

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 9/67 (13%)

Query: 19  RIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCA----DP-----DPQAVASSIPMDNG 69
           +I DT+  ++F   L +   KY    Y T+++ C     DP     D   VAS +P+   
Sbjct: 328 KIIDTRIYVEFNEDLVVREWKYMEDDYKTVLNKCRLNSNDPKKSLRDSNWVASVLPLKER 387

Query: 70  LMQVLDK 76
           + +VL K
Sbjct: 388 VCEVLRK 394

>CAGL0I06985g Chr9 (672970..673224) [255 bp, 84 aa] {ON} highly
           similar to uniprot|P53082 Saccharomyces cerevisiae
           YGL220w
          Length = 84

 Score = 30.4 bits (67), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 106 DERLPQWLREMLPPEYHVVVPELQYYLGNSF 136
           +E L + L+  +P  YHV+V +L Y  G SF
Sbjct: 4   EEHLREKLKTSIPDVYHVIVTDLSYGCGQSF 34

>TDEL0H02160 Chr8 (367235..368149) [915 bp, 304 aa] {ON} Anc_7.228
           YER053C
          Length = 304

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 49/127 (38%), Gaps = 28/127 (22%)

Query: 177 FNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDK 236
           F K +T      + Y+L+ AG +G +    HF+                       +L  
Sbjct: 67  FGKVFTGFGATAIGYSLQGAGKYGGYEFFKHFY--------------------SNNVLSP 106

Query: 237 SLVREYKNTNFYCQG---INFINEVKMGPFEEHSPILYDIAVTVPRW-SKVCKGLLKMYS 292
            L   Y  T  Y        FI ++ + PFE    I      TVP + + V +GL K+YS
Sbjct: 107 ELASRY-TTGVYLAASATAEFIADIMLCPFE---AIKVRQQTTVPPFCNNVFQGLSKVYS 162

Query: 293 VEVLKKF 299
            E LK F
Sbjct: 163 TEGLKGF 169

>Skud_7.51 Chr7 (87670..87711,87715..87741,87745..88002) [327 bp,
           109 aa] {ON} YGL220W (REAL)
          Length = 109

 Score = 30.0 bits (66), Expect = 3.4,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 22/42 (52%)

Query: 106 DERLPQWLREMLPPEYHVVVPELQYYLGNSFGSSTRLDYGTG 147
           ++RL + +   +P  YH++V +L Y  G SF      D+  G
Sbjct: 29  EQRLRERIESTIPQVYHIIVTDLSYGCGQSFDIVVVSDFFQG 70

>YGL220W Chr7 (82374..82736) [363 bp, 120 aa] {ON}  FRA2Protein
           involved in negative regulation of transcription of iron
           regulon; forms an iron independent complex with Fra2p,
           Grx3p, and Grx4p; null mutant fails to repress iron
           regulon and is sensitive to nickel
          Length = 120

 Score = 30.0 bits (66), Expect = 4.8,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 99  REWHHKL---DERLPQWLREMLPPEYHVVVPELQYYLGNSFGSSTRLDYGTG 147
           R+ H+K+   ++ L + +   +P  YH++V +L Y  G SF      D+  G
Sbjct: 30  RQRHYKMPVTEQGLRERIESAIPQVYHIIVTDLSYGCGQSFDIVVVSDFFQG 81

>ZYRO0D16698g Chr4 complement(1382235..1383152) [918 bp, 305 aa]
           {ON} highly similar to uniprot|P40035 Saccharomyces
           cerevisiae YER053C PIC2 Mitochondrial phosphate carrier
           imports inorganic phosphate into mitochondria
           functionally redundant with Mir1p but less abundant than
           Mir1p under normal conditions expression is induced at
           high temperature
          Length = 305

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 52/126 (41%), Gaps = 26/126 (20%)

Query: 177 FNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDK 236
           F K +T +    + Y+L+ AG +G +    HF+                       ++  
Sbjct: 68  FKKIFTGIGATFIGYSLQGAGKYGGYEYFKHFY--------------------TNNVVSP 107

Query: 237 SLVREYKNTNFYCQGIN--FINEVKMGPFEEHSPILYDIAVTVPRW-SKVCKGLLKMYSV 293
            L + +  + + C      F+ ++ + PFE    I      T+P + + V +GL K+YS+
Sbjct: 108 DLAKRHLTSVYLCASATAEFLADIMLCPFE---AIKVRQQTTIPPFCNNVFQGLSKVYSM 164

Query: 294 EVLKKF 299
           E L  F
Sbjct: 165 EGLSGF 170

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,078,412
Number of extensions: 2200471
Number of successful extensions: 5462
Number of sequences better than 10.0: 56
Number of HSP's gapped: 5514
Number of HSP's successfully gapped: 56
Length of query: 393
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 281
Effective length of database: 40,638,807
Effective search space: 11419504767
Effective search space used: 11419504767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)