Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.145.711ON65265233020.0
YIL155C (GUT2)5.711ON64962731910.0
Skud_9.135.711ON64962931540.0
Suva_9.325.711ON53853828010.0
KAFR0D021705.711ON66060721830.0
SAKL0E15114g5.711ON64963321510.0
Kwal_55.196495.711ON64162721460.0
KLTH0E00836g5.711ON64163121430.0
CAGL0H06699g5.711ON65062421410.0
NCAS0G001805.711ON65460021410.0
KLLA0A00418g5.711ON64259721040.0
TDEL0B020905.711ON64362120930.0
NDAI0F002105.711ON65360120840.0
TPHA0E001505.711ON64659620570.0
Ecym_40105.711ON64461620470.0
AFR295W5.711ON63161920370.0
Kpol_1043.775.711ON65762820370.0
TBLA0E017505.711ON66560720350.0
ZYRO0B16522g5.711ON64359620020.0
KNAG0L021905.711ON64559918710.0
Smik_13.4086.294ON25698770.73
Kpol_1008.77.505ON79995780.98
SAKL0G16610g4.296ON1966131761.9
TBLA0H020705.191ON152146707.5
TPHA0D013708.693ON238114688.7
ZYRO0G15884g5.621ON53082699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.14
         (652 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...  1276   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...  1233   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...  1219   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...  1083   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   845   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   833   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   831   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   830   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   829   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   829   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   815   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   810   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   807   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   796   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   793   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   789   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   789   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   788   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   775   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   725   0.0  
Smik_13.408 Chr13 (648920..649690) [771 bp, 256 aa] {ON} YMR200W...    34   0.73 
Kpol_1008.7 s1008 complement(9101..11500) [2400 bp, 799 aa] {ON}...    35   0.98 
SAKL0G16610g Chr7 (1434140..1440040) [5901 bp, 1966 aa] {ON} sim...    34   1.9  
TBLA0H02070 Chr8 (492770..497335) [4566 bp, 1521 aa] {ON} Anc_5....    32   7.5  
TPHA0D01370 Chr4 complement(283224..283940) [717 bp, 238 aa] {ON...    31   8.7  
ZYRO0G15884g Chr7 complement(1300583..1302175) [1593 bp, 530 aa]...    31   9.9  

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score = 1276 bits (3302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/652 (94%), Positives = 618/652 (94%)

Query: 1   MFSVXXXXXXXXXXXXXXXXXXXGSLYWVATQGERPCVHNDASYMVQFPTAAPPQVSRRD 60
           MFSV                   GSLYWVATQGERPCVHNDASYMVQFPTAAPPQVSRRD
Sbjct: 1   MFSVTRRRAAAAAAAAAAMATATGSLYWVATQGERPCVHNDASYMVQFPTAAPPQVSRRD 60

Query: 61  LLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGV 120
           LLERLGKTHQFDVLII               RGLNVALVEKGDFASGTSSKSTKMIHGGV
Sbjct: 61  LLERLGKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGV 120

Query: 121 RYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYMGCKF 180
           RYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYMGCKF
Sbjct: 121 RYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYMGCKF 180

Query: 181 YDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVEN 240
           YDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVEN
Sbjct: 181 YDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVEN 240

Query: 241 GATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQMDRN 300
           GATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQMDRN
Sbjct: 241 GATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQMDRN 300

Query: 301 PSGQPDSPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGR 360
           PSGQPDSPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGR
Sbjct: 301 PSGQPDSPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGR 360

Query: 361 VMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAG 420
           VMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAG
Sbjct: 361 VMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAG 420

Query: 421 VRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEETIDKVV 480
           VRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEETIDKVV
Sbjct: 421 VRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEETIDKVV 480

Query: 481 EVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEY 540
           EVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEY
Sbjct: 481 EVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEY 540

Query: 541 FKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFL 600
           FKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFL
Sbjct: 541 FKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFL 600

Query: 601 LRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652
           LRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV
Sbjct: 601 LRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score = 1233 bits (3191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/627 (94%), Positives = 600/627 (95%)

Query: 26  LYWVATQGERPCVHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIXXXXXXXXX 85
           LYW+ +QG+RP VHND SYMVQFPTAAPPQVSRRDLL+RL KTHQFDVLII         
Sbjct: 23  LYWMTSQGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGC 82

Query: 86  XXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNER 145
                 RGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNER
Sbjct: 83  ALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNER 142

Query: 146 KHLINTAPHLCTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKA 205
           KHLINTAPHLCTVLPILIPIYST QVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKA
Sbjct: 143 KHLINTAPHLCTVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKA 202

Query: 206 PMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVIGA 265
           PMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDP SGKVIGA
Sbjct: 203 PMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGA 262

Query: 266 EARDVETNELIRIKAKCVVNATGPYSDAILQMDRNPSGQPDSPLNDNSKAKSAFNQIAVM 325
           EARDVETNEL+RI AKCVVNATGPYSDAILQMDRNPSG PDSPLNDNSK KS FNQIAVM
Sbjct: 263 EARDVETNELVRINAKCVVNATGPYSDAILQMDRNPSGLPDSPLNDNSKIKSTFNQIAVM 322

Query: 326 DPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPE 385
           DPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPE
Sbjct: 323 DPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPE 382

Query: 386 NPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVV 445
           NPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVV
Sbjct: 383 NPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVV 442

Query: 446 RSHFLFTSDNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWT 505
           RSHFLFTSDN LITIAGGKWTTYRQMAEET+DKVVEVGGFHNL PCHTRDIKLAGAEEWT
Sbjct: 443 RSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWT 502

Query: 506 QNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSE 565
           QNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICE+FKESMENKLPLSLADKENNVIYSSE
Sbjct: 503 QNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSE 562

Query: 566 ENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVM 625
           ENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALN+VHATVKVM
Sbjct: 563 ENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVM 622

Query: 626 GDEFNWSEKKRQWELEKTVNFIKTFGV 652
           GDEFNWSEKKRQWELEKTVNFIKTFGV
Sbjct: 623 GDEFNWSEKKRQWELEKTVNFIKTFGV 649

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score = 1219 bits (3154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/629 (93%), Positives = 597/629 (94%)

Query: 24  GSLYWVATQGERPCVHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIXXXXXXX 83
           GS+YW  TQG+R  V NDASYMV FPTAAPPQVSRRDLL+RL KTHQFDVLII       
Sbjct: 21  GSVYWATTQGDRRLVRNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGT 80

Query: 84  XXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALN 143
                   RGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALN
Sbjct: 81  GCALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALN 140

Query: 144 ERKHLINTAPHLCTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVE 203
           ERKHLINTAPHLCTVLPILIPIY+T QVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVE
Sbjct: 141 ERKHLINTAPHLCTVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVE 200

Query: 204 KAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVI 263
           KAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQ+LIKDPASGKV+
Sbjct: 201 KAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVV 260

Query: 264 GAEARDVETNELIRIKAKCVVNATGPYSDAILQMDRNPSGQPDSPLNDNSKAKSAFNQIA 323
           GAEARDVETNEL++I AKCVVNATGPYSDAILQMDRNPSGQP+SPLNDNS  KS FNQIA
Sbjct: 261 GAEARDVETNELVKINAKCVVNATGPYSDAILQMDRNPSGQPNSPLNDNSLIKSTFNQIA 320

Query: 324 VMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQV 383
           V DPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQV
Sbjct: 321 VTDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQV 380

Query: 384 PENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQG 443
           PENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQG
Sbjct: 381 PENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQG 440

Query: 444 VVRSHFLFTSDNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEE 503
           VVRSHFLFTSDN LITIAGGKWTTYRQMAEET+DKVVEVG FHNL PCHTRDIKLAGAEE
Sbjct: 441 VVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEE 500

Query: 504 WTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYS 563
           WTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICE+FKESMENKLPLSLADKENNVIYS
Sbjct: 501 WTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYS 560

Query: 564 SEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVK 623
           SEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNS HATVK
Sbjct: 561 SEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVK 620

Query: 624 VMGDEFNWSEKKRQWELEKTVNFIKTFGV 652
           VMGDEFNWSEKKRQWELEKT+NFIKTFGV
Sbjct: 621 VMGDEFNWSEKKRQWELEKTINFIKTFGV 649

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score = 1083 bits (2801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/538 (95%), Positives = 527/538 (97%)

Query: 115 MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYI 174
           MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIY+T QVPYI
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 175 YMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 234
           Y GCKFYDFFAG QNLK SYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 235 ITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAI 294
           ITAVENGATVLNYVEVQKLIKDPASGKV+GAEARDVETNEL+RI AKCVVNATGPYSDAI
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 295 LQMDRNPSGQPDSPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDV 354
           LQMDRN SGQP+SPLNDNSK KSAFNQ+AVMDP+MVIPSIGVHIVLPSFYCPKD+GLLDV
Sbjct: 181 LQMDRNASGQPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLDV 240

Query: 355 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 414
           RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV
Sbjct: 241 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 300

Query: 415 LSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEE 474
           LSAWAGVRPLVRDPR+IPA GKKGSATQGVVRSHFLFTSDN LITIAGGKWTTYRQMAEE
Sbjct: 301 LSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 360

Query: 475 TIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRS 534
           TIDKVVEVGGFHNL PCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV+NYGTRS
Sbjct: 361 TIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGTRS 420

Query: 535 SIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCR 594
           SIICE+FK+SMENKLPLSLADKENN IYS+EENNLVNFDTFRYPFTIGELKYSMQYEYCR
Sbjct: 421 SIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEYCR 480

Query: 595 TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652
           TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWS+KKRQWELEKTVNFIKTFGV
Sbjct: 481 TPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/607 (65%), Positives = 484/607 (79%), Gaps = 16/607 (2%)

Query: 57  SRRDLLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMI 116
           +R DL+ +L KT+QFDVL+I               RGLNVALVEK DFASGTSSKSTKM 
Sbjct: 59  TRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKSTKMA 118

Query: 117 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYM 176
           HGGVRYLEKAFWE SKAQLDLVIEALNER HL+NTAPHLC +LPI+IP+Y+  Q+PY Y 
Sbjct: 119 HGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFYA 178

Query: 177 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 236
           GCK YD FAGSQNLK SYLLSK +  + APML T  LKA LVYHDG+FNDSR+N+TLA+T
Sbjct: 179 GCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAVT 238

Query: 237 AVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQ 296
           A+ENG+TVLNY+EV++L+K+  SGK+ GA   D+ET +   IKAK V+NATGPYSDAILQ
Sbjct: 239 AIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAILQ 298

Query: 297 MDRNPSGQPDSPLNDNSKAKSAF-NQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVR 355
           MD+NP+G PD PLN N K  +    +++V +PKMV+PS GVHI+LPSFYCPKD+GLLD +
Sbjct: 299 MDQNPTGLPD-PLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLDAK 357

Query: 356 TSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVL 415
           TSDGRVMFFLPWQGKVLAGTTD+P+KQ+PENP  TEADIQDILKELQHYI FPVKREDVL
Sbjct: 358 TSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKREDVL 417

Query: 416 SAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEET 475
           SAWAG+RPLV+DPRT+  +G    +TQG+VRSHF+FTSD+ L+TIAGGKWTTYR MAEET
Sbjct: 418 SAWAGIRPLVKDPRTLDKNGD--GSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAEET 475

Query: 476 IDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSS 535
           +D+ ++VG F N+ PC TRDIKLAG E W  N  ALLAQ YHLSSK+S +L  NYGTR+ 
Sbjct: 476 VDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADNYGTRAP 535

Query: 536 IICEYFKESMENKLPLSLA----------DKENNVIYSSEENNLVNFDTFRYPFTIGELK 585
           IICE + +  +NKLP++LA          +  N++IY++E  ++  F+ FRYPFT+GE+K
Sbjct: 536 IICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDV--FECFRYPFTVGEVK 593

Query: 586 YSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVN 645
           YS+ YEY  T LDFL+RR+RFAFLDAKEA+++V  TVK+MGDE NW E +R  E+E T+ 
Sbjct: 594 YSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENTIK 653

Query: 646 FIKTFGV 652
           +IKTFGV
Sbjct: 654 YIKTFGV 660

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/633 (63%), Positives = 483/633 (76%), Gaps = 10/633 (1%)

Query: 24  GSLYWVATQGERPCVHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIXXXXXXX 83
            ++ W   Q ++  ++ND +       +     +R+DLL +L KT+QFDVLII       
Sbjct: 23  ATILWHQQQQQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIGGGATGT 82

Query: 84  XXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALN 143
                   RGLNVALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLV+EALN
Sbjct: 83  GSALDAATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALN 142

Query: 144 ERKHLINTAPHLCTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVE 203
           ER H++ TAPHLC +LPI+IP+Y+  Q PY Y+GCK YD FAGSQNLK SY+L+ S   E
Sbjct: 143 ERAHMLYTAPHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAE 202

Query: 204 KAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVI 263
            APML    LKA LVYHDGSFNDSR+NATLA+TAVE GATVLNY+EV++LIK+  +GKV 
Sbjct: 203 VAPMLDASKLKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVE 262

Query: 264 GAEARDVETNELIRIKAKCVVNATGPYSDAILQMDRNPSGQPDSPLNDNSKAKSAF-NQI 322
           GA A+D ET E  RIKAK VVNATGP+SD ILQMD +  G PD  L  +S   +   +++
Sbjct: 263 GAVAQDRETGETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKV 322

Query: 323 AVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQ 382
           AV +P+MV+PS GVHIVLPSFYCPK++GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQ
Sbjct: 323 AVANPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQ 382

Query: 383 VPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGK---KGS 439
           +PENP  TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLV+DPR    +       S
Sbjct: 383 IPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAAS 442

Query: 440 ATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLA 499
           +TQ +VRSHFLFTSDNDL+TIAGGKWTTYR+M+EETI++VV+VG F N  PC TR +KLA
Sbjct: 443 STQELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKF-NAKPCITRKLKLA 501

Query: 500 GAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENN 559
           GAE +  N  A+LAQ YHLSSKM+ YL  NYGTR+ +ICE FK+  +NKLP++   KEN 
Sbjct: 502 GAENYDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENV 561

Query: 560 VIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVH 619
            +Y +     V+FD+FRYPFTIGELKYS+  EY RT LDFL+RRTR+AFLDAK+AL +V 
Sbjct: 562 TVYGN-----VDFDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVD 616

Query: 620 ATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652
            TVKVMGDE +W   +RQ E EK   FIKTFGV
Sbjct: 617 GTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/627 (64%), Positives = 477/627 (76%), Gaps = 23/627 (3%)

Query: 42  ASYMVQ--------------FPTAAPPQVSRRDLLERLGKTHQFDVLIIXXXXXXXXXXX 87
           A+YMVQ                  AP   +R +LLE++ KT QFDVLII           
Sbjct: 22  AAYMVQNDKIARSEVRVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIGGGATGTGCAV 81

Query: 88  XXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKH 147
               RGLNVALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER H
Sbjct: 82  DAATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGH 141

Query: 148 LINTAPHLCTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPM 207
           ++NTAPHLC VLPI+IP+Y+  QVPY Y+GCK YD FAGSQNLK SY++S     E APM
Sbjct: 142 MLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPM 201

Query: 208 LTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVIGAEA 267
           L    LKA LVYHDGSFNDSR+NA LA+TA+E GATVLNY+EV +L+K+  SG++ GA  
Sbjct: 202 LDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMV 261

Query: 268 RDVETNELIRIKAKCVVNATGPYSDAILQMDRNPSGQPDSPLND--NSKAKSAFNQIAVM 325
           RD ET E  RIKAK VVN+TGP+SD +LQMD    G+P + L    N    S  ++IAV 
Sbjct: 262 RDRETGEEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVS 321

Query: 326 DPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPE 385
           +P+MV+PS GVHIVLP+FYCPK++GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPE
Sbjct: 322 NPRMVVPSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPE 381

Query: 386 NPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVV 445
           NP  TEADIQDILKELQHYI+FPVKR DVLSAWAG+RPL+RDPRTI  +G   S+TQG+V
Sbjct: 382 NPTATEADIQDILKELQHYIKFPVKRGDVLSAWAGIRPLIRDPRTI-KEGDDVSSTQGLV 440

Query: 446 RSHFLFTSDNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWT 505
           R+HFL+TSDN L+TIAGGKWTTYR+MAEETID+VV+ G F    PC T+ IKLAGAE W 
Sbjct: 441 RNHFLYTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFQ-AKPCITKKIKLAGAEGWD 499

Query: 506 QNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSE 565
            N+VA+LAQ YHLSSKM+ +L  NYGTRS IICE FK   +N+LP++   +EN  +Y + 
Sbjct: 500 PNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKN- 558

Query: 566 ENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVM 625
               VNFD+FRYPFTIGELKYSMQYEY RT LDFL+RRTRF FLDA++AL +V  TV VM
Sbjct: 559 ----VNFDSFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVM 614

Query: 626 GDEFNWSEKKRQWELEKTVNFIKTFGV 652
           GDE  WS+ +RQ E ++   FIKTFG+
Sbjct: 615 GDELGWSDDRRQAERQQASEFIKTFGL 641

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/631 (63%), Positives = 478/631 (75%), Gaps = 10/631 (1%)

Query: 24  GSLYWVATQGERPCVHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIXXXXXXX 83
           G     A Q +R   HN+    +     AP   SR +LL+++ KT QFDVL+I       
Sbjct: 19  GGYAAFALQRDR-SAHNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGT 77

Query: 84  XXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALN 143
                   RGLNVALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALN
Sbjct: 78  GCAVDGATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALN 137

Query: 144 ERKHLINTAPHLCTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVE 203
           ER H++NTAPHLC VLPI+IP+Y+  QVPY Y+GCK YD FAGSQNLK SY+++     E
Sbjct: 138 ERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASE 197

Query: 204 KAPMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVI 263
            APML    LKA LVYHDGSFNDSR+NA LA+TA+E GATVLNY+EV +L+K+  +G+V 
Sbjct: 198 VAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVE 257

Query: 264 GAEARDVETNELIRIKAKCVVNATGPYSDAILQMDRNPSGQPDSPLND--NSKAKSAFNQ 321
           GA ARD ET +  RI AK VVN+TGP+SD ILQMD    G P + L    N    S  ++
Sbjct: 258 GAMARDRETGKEFRINAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSR 317

Query: 322 IAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLK 381
           +AV +P+MV+PS GVHIVLP+FYCPK +GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+K
Sbjct: 318 VAVSNPRMVVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMK 377

Query: 382 QVPENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSAT 441
           QVPENP  TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLVRDPRT+  +G   S+T
Sbjct: 378 QVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLK-EGDDVSST 436

Query: 442 QGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGA 501
           QG+VR+HFLFTSDN L+TIAGGKWTTYR+MAEETID+VV+ G F    PC T+ IKLAGA
Sbjct: 437 QGLVRNHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHFQ-AKPCITKKIKLAGA 495

Query: 502 EEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVI 561
           E W  N+VA+LAQ YHLSSKM+ +L  NYGTRS IICE F+   +N+LP++   +EN  +
Sbjct: 496 EGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTV 555

Query: 562 YSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHAT 621
           Y +     VNFD+FRYPFTI ELKYS++YEY RT LDFL+RRTRF FLDAK+AL +V  T
Sbjct: 556 YKN-----VNFDSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGT 610

Query: 622 VKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652
           V +MGDE  W E KR  E+++  +FIKTFGV
Sbjct: 611 VSIMGDELGWDENKRLSEIQQASDFIKTFGV 641

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/624 (66%), Positives = 480/624 (76%), Gaps = 21/624 (3%)

Query: 38  VHNDASYM--VQFPTAAPPQVSRRDLLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRGLN 95
           + ND S +  V+ P    P  +R +LL++L +T+QFDVLII               RGLN
Sbjct: 39  ISNDVSLISPVEKPDVKLP--TRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGLN 96

Query: 96  VALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHL 155
           VALVEK DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER HL+NTAPHL
Sbjct: 97  VALVEKNDFASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHL 156

Query: 156 CTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKA 215
           C +LPI+IP+Y+  QVPY Y GCK YD FAGSQNLK SYL+SK+AT+E APML   NLKA
Sbjct: 157 CKLLPIIIPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKA 216

Query: 216 SLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNEL 275
            LVYHDGSFND+R+NATLA+TA+EN ATVLNY+EV++L+KD   GKV GA   D ET + 
Sbjct: 217 GLVYHDGSFNDTRMNATLAVTAIENSATVLNYMEVKQLVKD-KDGKVAGAVVEDRETGKT 275

Query: 276 IRIKAKCVVNATGPYSDAILQMDRNPSGQPD------SPLND-NSKAKSAFNQIAVMDPK 328
             ++AK VVNATGPYSD +LQMD NP G PD       P+ D N+  KS  +Q+AV  P 
Sbjct: 276 YSVRAKVVVNATGPYSDRLLQMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTKPN 335

Query: 329 MVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPM 388
           MV+PS GVHI+LPSFYCPK+MGLLD +TSDGRVMFFLPWQGKVLAGTTDIPLKQVPENP 
Sbjct: 336 MVVPSAGVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPT 395

Query: 389 PTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSH 448
            TEADIQDILKELQ YI+FPVKREDVLSAWAG+RPLV DPR      K   +TQG+VRSH
Sbjct: 396 ATEADIQDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRK---KSKADGSTQGLVRSH 452

Query: 449 FLFTSDNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNY 508
           F+FTSD+ L+TIAGGKWTTYR MAEETID+VV+ G F +  PC TR +KLAGAE W  N 
Sbjct: 453 FIFTSDHGLVTIAGGKWTTYRAMAEETIDEVVKNGKF-DAKPCITRKLKLAGAENWDPNL 511

Query: 509 VALLAQNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSEENN 568
            ALLAQ YHLS KMS+YL +NYGTR+ +ICE F E  EN+LPL LADKE   +       
Sbjct: 512 PALLAQKYHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLGH---- 567

Query: 569 LVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDE 628
            V+FD+FRYP TI ELKY+++YEY RT LDFL+RRTRFAFLDAK+ALN+V  TV++MGD 
Sbjct: 568 -VDFDSFRYPITIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGDS 626

Query: 629 FNWSEKKRQWELEKTVNFIKTFGV 652
             W E++RQ E+  +  FIKTFGV
Sbjct: 627 LGWDEQRRQDEIRYSTEFIKTFGV 650

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/600 (67%), Positives = 473/600 (78%), Gaps = 10/600 (1%)

Query: 57  SRRDLLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMI 116
           +R  LL++L +  QFDVLII               RGL VALVE+ DFASGTSSKSTKM 
Sbjct: 61  TRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQNDFASGTSSKSTKMA 120

Query: 117 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYM 176
           HGGVRYLEKAF++ SK+QLDLVIEALNER HL+NTAPHLC +LPILIP+Y+  QVPY Y 
Sbjct: 121 HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA 180

Query: 177 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 236
           GCK YD FAG+QNLK SYLLS+S  +E APML   NLKA+LVYHDGSFNDSRLNATLAIT
Sbjct: 181 GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT 240

Query: 237 AVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQ 296
           A+E GATVLNYVEVQKL+KD  +G + G   RD+ET + + + +K VVNATGP+SD ILQ
Sbjct: 241 AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ 300

Query: 297 MDRNPSGQPDSPLNDNSKA---KSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLD 353
           MD+NP+G PD  +N N K    +   ++IAV +P MV+PS GVHI+LPS+YCPK MGLLD
Sbjct: 301 MDKNPTGLPDD-MNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLD 359

Query: 354 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 413
           VRTSDGRVMFFLPWQGKV+AGTTDIP+ QVPE P+  EADIQDILKELQHYI+FPVKRED
Sbjct: 360 VRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRED 419

Query: 414 VLSAWAGVRPLVRDPRTIPADGKKG-SATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMA 472
           VLSAWAG+RPLVRDPR +  D KK   +TQG+VRSHF+FTSDN L+TIAGGKWTTYR+MA
Sbjct: 420 VLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMA 479

Query: 473 EETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGT 532
           EETID+VV+ G F +  PC TR++KLAGAE W  N  ALL+Q Y+L S M+NYL  NYGT
Sbjct: 480 EETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGT 539

Query: 533 RSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEY 592
           RS IICE F     NKLP+ LA +E   I  +      +F+TFRYP TIGELKYSM+YEY
Sbjct: 540 RSPIICELFLNDEINKLPVLLAGEEKEQILGN-----TDFNTFRYPITIGELKYSMRYEY 594

Query: 593 CRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652
            RT LDFL+RRTRFAFLDAKEAL +V  TVK+MGDEFNWS ++RQ E EKT+ FIK+FGV
Sbjct: 595 ARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/597 (66%), Positives = 470/597 (78%), Gaps = 10/597 (1%)

Query: 57  SRRDLLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMI 116
           SR +LL RL KT +FDVLII               RGLNVALVE  DFASGTSSKSTKM 
Sbjct: 55  SRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDFASGTSSKSTKMA 114

Query: 117 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYM 176
           HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC +LPI+IP+Y+  QVPY Y+
Sbjct: 115 HGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFYV 174

Query: 177 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 236
           G K YD FAGSQNLK SYLLS S   E APML    LKA LVYHDGSFNDSR+N++LAIT
Sbjct: 175 GTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAIT 234

Query: 237 AVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQ 296
           A+E GATVLNYV++++L+K+  +GKV GA A D ET +  +IKAK VVNATGPYSD +LQ
Sbjct: 235 AIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLLQ 294

Query: 297 MDRNPSGQP-DSPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVR 355
           MD++P+G P DS L   ++  +   +IAV +PKMV+PS GVHIVLPSFYCPK++GLLD +
Sbjct: 295 MDQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDAQ 354

Query: 356 TSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVL 415
           TSDGRVMFFLPWQGKVLAGTTDIP+KQ+PENP  TEADIQDILKELQHYI FPVKREDVL
Sbjct: 355 TSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDVL 414

Query: 416 SAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEET 475
           SAWAG+RPLV+DPR   AD   GS TQ +VRSHFLFTS ++L+TI+GGKWTTYR+MAEET
Sbjct: 415 SAWAGIRPLVKDPRK--ADSGSGS-TQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEET 471

Query: 476 IDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSS 535
           ID+VV+VG F N  PC T+ +KL G E W  N  ALL+Q YHLSS MS +L  NYGTR+ 
Sbjct: 472 IDEVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRAP 530

Query: 536 IICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRT 595
           +ICE F E   NKLP++LA +EN  ++       V++D+FRYP+TIGELKYS++YEY R 
Sbjct: 531 LICELFNEDPRNKLPVALAGQENVSVFGH-----VDYDSFRYPYTIGELKYSLKYEYARN 585

Query: 596 PLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652
            LDFL+RRTR+AFLDAK+ALN+V  TVKVMGDE  W  KKRQ E+++   +IKTFGV
Sbjct: 586 CLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/621 (62%), Positives = 472/621 (76%), Gaps = 14/621 (2%)

Query: 34  ERPCVHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRG 93
           E+  + ND +      T      SR DLL +L KT QFDVL+I               RG
Sbjct: 35  EQRRIANDVALQSAVDTPNVKLPSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRG 94

Query: 94  LNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAP 153
           LNVALVE  DFASGTSSKSTKM HGGVRYLEKA ++ SKAQLDLVIEALNER H++NTAP
Sbjct: 95  LNVALVEMHDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAP 154

Query: 154 HLCTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNL 213
           HLC +LPI+IP+Y+  Q+PY Y+GCK YD FAGSQNLK SYLL+K    + APML    L
Sbjct: 155 HLCKILPIMIPVYTYWQIPYFYVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTL 214

Query: 214 KASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETN 273
           KA LVYHDGSFNDSR+N  LA+TA+ENGATVLNY+EV++LIKD  +GKV GA   + ET 
Sbjct: 215 KAGLVYHDGSFNDSRMNTALAVTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETG 274

Query: 274 ELIRIKAKCVVNATGPYSDAILQMDRNPSGQPD--SPLNDNSKAKSAFNQIAVMDPKMVI 331
           E   +KAK  VNATGPYSD +LQMD N  G+PD   PL + + +     ++AV +PKMV+
Sbjct: 275 EQFTVKAKVTVNATGPYSDKLLQMDENKDGKPDPTKPLPNATIS----TKVAVENPKMVV 330

Query: 332 PSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTE 391
           PS GVHI+LPSFYCP++MGLLDV+TSDGRVMFFLPWQGKVLAGTTDIP+KQVP+ P   E
Sbjct: 331 PSAGVHIILPSFYCPREMGLLDVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAE 390

Query: 392 ADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLF 451
           +DIQDIL+ELQHYI+FPVKREDVLSAWAG+RPLV DPR   + G  G +TQG+VRSH  F
Sbjct: 391 SDIQDILQELQHYIKFPVKREDVLSAWAGIRPLVIDPRK--SQGNTGGSTQGLVRSHLCF 448

Query: 452 TSDNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVAL 511
           T+DN ++TIAGGKWTTYR+MAEETI++VV+VG F N+ PC TR +KL+GAE W  N  AL
Sbjct: 449 TTDNGMVTIAGGKWTTYREMAEETINEVVKVGKF-NVKPCITRKLKLSGAENWNPNLAAL 507

Query: 512 LAQNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVN 571
           LAQ YHLS  MSN+L +NYGTR+ +ICE F+E   N+LP++   +EN  +Y +     VN
Sbjct: 508 LAQKYHLSGAMSNHLSENYGTRAPLICEMFQEDERNQLPVTFGGRENVTVYGN-----VN 562

Query: 572 FDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNW 631
           FD+FRYPFTIGEL YS+ YEY RT LDFL+RRTRFAFLDA++AL++V  TV VMGD+ NW
Sbjct: 563 FDSFRYPFTIGELNYSVDYEYTRTALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNW 622

Query: 632 SEKKRQWELEKTVNFIKTFGV 652
              +R+ E+EK+  FI+TFGV
Sbjct: 623 DSTRRKHEIEKSKEFIRTFGV 643

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/601 (65%), Positives = 468/601 (77%), Gaps = 10/601 (1%)

Query: 57  SRRDLLERLG-KTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKM 115
           SR  L  +L  K HQFD+LII               RGLNVALVE+ DFASGTSSKSTKM
Sbjct: 58  SRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERDDFASGTSSKSTKM 117

Query: 116 IHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIY 175
            HGGVRYLEKAF +FSK+QLDLVIEALNER HL+NTAPHLC +LPILIP+Y+  Q+PY Y
Sbjct: 118 AHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYFY 177

Query: 176 MGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAI 235
            GCKFYDFFAG QNLK SYL+S+   +E APML   NLKA+LVYHDGSFNDSRLN+++AI
Sbjct: 178 AGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIAI 237

Query: 236 TAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAIL 295
           TA+ENGATVLNYVEV+KL+KDP S K+IG   +D ET E+  +K+K +VNATGPYSD IL
Sbjct: 238 TAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTIL 297

Query: 296 QMDRNPSGQPDSPLNDNS--KAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLD 353
           QMD+N SG PD    D          ++IAV +PKMV+PS GVHI+LPS+YCPK MGLLD
Sbjct: 298 QMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLLD 357

Query: 354 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 413
            RT+DGRVMFFLPWQGKV+AGTTDIP+ QVP+ P+  E DIQDILKELQHYI+FPV+RED
Sbjct: 358 ARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRRED 417

Query: 414 VLSAWAGVRPLVRDPRTIPADG-KKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMA 472
           VLSAWAG+RPLVRDPR I  D  +K   TQG+VRSHFLFTSDN LITIAGGKWTTYR+MA
Sbjct: 418 VLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREMA 477

Query: 473 EETIDKVVEVGGFHNLT-PCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYG 531
           EETID+VV+ G F N   PC T+D+KL GAE W  N VALL+Q ++LSS M+ YL +NYG
Sbjct: 478 EETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENYG 537

Query: 532 TRSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYE 591
           TRS+IIC+ F+    NKLP+ LA  E+  I  +     V+F+TFRYP TI ELKY+M+YE
Sbjct: 538 TRSTIICQLFEREEMNKLPVQLAGIEDKPILGN-----VDFNTFRYPITIAELKYAMKYE 592

Query: 592 YCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFG 651
           Y RTPLDFL+RRTRFA+LDA +AL +V  TVKVMGDEF W  K+R+ E++    FI++FG
Sbjct: 593 YARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFG 652

Query: 652 V 652
           V
Sbjct: 653 V 653

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/596 (64%), Positives = 460/596 (77%), Gaps = 12/596 (2%)

Query: 57  SRRDLLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMI 116
           +R +L+  L  T QFDVLII               RGLNVALVEK DFASGTSSKSTKM 
Sbjct: 63  TRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLNVALVEKDDFASGTSSKSTKMA 122

Query: 117 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYM 176
           HGGVRYLEKA ++ SKAQLDLVIEALNER HL+ TAPHLC +LPI+IP+Y   QVPY Y 
Sbjct: 123 HGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYKYWQVPYFYA 182

Query: 177 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 236
           G K YD FAGSQNLK SYL+SK+   E APML    LKA LVYHDG+FNDSR+N+TLAIT
Sbjct: 183 GVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAGLVYHDGTFNDSRMNSTLAIT 242

Query: 237 AVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQ 296
           A+ENGATVLNY+EV++L+KDP+S ++ GA   D+ET E I+I AK +VNATGPYSD ILQ
Sbjct: 243 AIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKIQINAKVIVNATGPYSDKILQ 302

Query: 297 MDRNPSGQPDSPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRT 356
           MD N +G+PD      S   S   ++AV +P MV+PS GVHI+LPSFYCP++MGLLD  T
Sbjct: 303 MDNNKNGKPDE--FTQSAETSIATKVAVQNPHMVVPSAGVHIILPSFYCPREMGLLDANT 360

Query: 357 SDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLS 416
           SDGRVMFFLPWQGKVLAGTTDIP+K VPENP  TEADIQDILKELQHYI+FPVKREDVLS
Sbjct: 361 SDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHYIKFPVKREDVLS 420

Query: 417 AWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEETI 476
           AWAG+RPLV+DPR  P +G    ATQ +VRSHF+FTSD+ L+TIAGGKWTTYR+MAEETI
Sbjct: 421 AWAGIRPLVQDPRKTPKEG----ATQELVRSHFIFTSDHGLVTIAGGKWTTYREMAEETI 476

Query: 477 DKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSI 536
           D VV+ G F N+ PC TR +KLAG E +  N  ALLAQ YHL SK+S +L  NYGTRS +
Sbjct: 477 DTVVKNGKF-NVKPCSTRKLKLAGGENYDPNLAALLAQKYHLPSKLSEHLANNYGTRSPL 535

Query: 537 ICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTP 596
           IC+ F     N+LP+ LA KE N +Y +     V+FD+FRYP++I E+KY + +EY RT 
Sbjct: 536 ICDMFVADDHNRLPIYLAGKEENKVYGT-----VDFDSFRYPYSIAEVKYCVHHEYARTT 590

Query: 597 LDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652
           LDFL+RR+RFAFLDAK+AL SV  TVK+MGDE NW E++R+ E + ++ +IKTFGV
Sbjct: 591 LDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWDEERRKQETDYSIEYIKTFGV 646

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/616 (62%), Positives = 465/616 (75%), Gaps = 15/616 (2%)

Query: 38  VHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVA 97
           V N+    ++    AP   SR  LLE+L KT QFDVL+I               RGLNVA
Sbjct: 43  VANELPAELKLEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVA 102

Query: 98  LVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCT 157
           L+E  D+ASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER H+++TAPHLC 
Sbjct: 103 LLEMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCK 162

Query: 158 VLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASL 217
           +LPI+IP+Y   QVPY Y+G K YDFFAG QNLK SYLLS +   + APML    LKA L
Sbjct: 163 ILPIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGL 222

Query: 218 VYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIR 277
           VYHDGSFNDSR+N+TLA+TA+ENGAT+LNY+EV++L+K+P +GKV GA A D ET +   
Sbjct: 223 VYHDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYS 282

Query: 278 IKAKCVVNATGPYSDAILQMDRNPSGQPDS-PLNDNSKAKSAFNQIAVMDPKMVIPSIGV 336
           +KAK VV+ATGP+SD ILQM+ +P G PD   L+  ++  +   ++AV DPKMV+PS GV
Sbjct: 283 VKAKVVVSATGPFSDRILQMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGV 342

Query: 337 HIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQD 396
           HI+LPSFYCPKDMGLLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQD
Sbjct: 343 HIILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQD 402

Query: 397 ILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDND 456
           ILKELQHYI+FPVKREDV SAWAG+RPLV+DPR      K  S TQ +VRSHFLFTSD+ 
Sbjct: 403 ILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR------KDNSDTQDLVRSHFLFTSDSG 456

Query: 457 LITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNY 516
           L+TI+GGKWTTYR+MA+ETID+VV+VG F N  PC TR IKL G+E W  N  A+L+Q Y
Sbjct: 457 LVTISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQY 516

Query: 517 HLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFR 576
           +L   +S YL +NYGT+++ ICE F+    N+LP+SLA        + +    V++D FR
Sbjct: 517 NLPPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLA--------AEKAAANVDYDAFR 568

Query: 577 YPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKR 636
           YPFT+GELKY+++ EY R PLDFL+RRTR+AFLDAK+A+ +V  TVK+MGDE  W   KR
Sbjct: 569 YPFTVGELKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKR 628

Query: 637 QWELEKTVNFIKTFGV 652
           + E +  + FIKTFGV
Sbjct: 629 EMETKYAIEFIKTFGV 644

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/619 (61%), Positives = 466/619 (75%), Gaps = 16/619 (2%)

Query: 35  RPCVHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRGL 94
           RP + N+    ++    AP   SR +LLE+L KT+QFDVL+I               RGL
Sbjct: 28  RPSLVNEVPTELKLERRAPAPPSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGL 87

Query: 95  NVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPH 154
           NVAL+E  DFASGTSSKSTKM HGGVRYLEKA WE SKAQLDLVIEALNER HL+ TAPH
Sbjct: 88  NVALLEMNDFASGTSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPH 147

Query: 155 LCTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLK 214
           LC VLPI+IP+Y   QVPY Y+G K YDFFAGSQNLK SYLLS SA  E APML    LK
Sbjct: 148 LCKVLPIMIPVYKWWQVPYFYVGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLK 207

Query: 215 ASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNE 274
           A LVYHDGSFNDSR+NAT+A+TA+ENGATVLNY+EV++LIK+P  GKV GA A D ET +
Sbjct: 208 AGLVYHDGSFNDSRMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGK 267

Query: 275 LIRIKAKCVVNATGPYSDAILQMDRNPSGQPDSPLNDN-SKAKSAFNQIAVMDPKMVIPS 333
              ++AK VVNATGP+SD +LQMD +P G PD  + D  +K  +   ++AV +PKMV+PS
Sbjct: 268 EYAVRAKVVVNATGPFSDRLLQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPS 327

Query: 334 IGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEAD 393
            GVHI+LPS+YCPK+MGLLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVP NP  TEAD
Sbjct: 328 SGVHIILPSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEAD 387

Query: 394 IQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTS 453
           IQDILKELQHYI+FPVKREDV SAWAG+RPLV+DPR      K  S TQG+VRSH +FTS
Sbjct: 388 IQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR------KNLSDTQGLVRSHLVFTS 441

Query: 454 DNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLA 513
            N ++TI+GGKWTTYR+MAEET+++VV+VG F N  PC TR +KL+GAE W  N  ALL+
Sbjct: 442 KNGMVTISGGKWTTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLS 501

Query: 514 QNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFD 573
             Y++   ++ +L QNYGT+++ +CE F++   N LP+SLA         +++   ++++
Sbjct: 502 HQYNIPPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVSLA---------ADKPTSIDYN 552

Query: 574 TFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSE 633
            FRYP+TIGELK++M +EY RTPLDFL+RRTR+AFLDAK+AL +V  TVKVMGD   W  
Sbjct: 553 AFRYPYTIGELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDS 612

Query: 634 KKRQWELEKTVNFIKTFGV 652
            KR  E +  + +IKTFGV
Sbjct: 613 AKRVAETKYAIEYIKTFGV 631

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/628 (64%), Positives = 472/628 (75%), Gaps = 23/628 (3%)

Query: 37  CVHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRGLNV 96
            V+ND S      T      SR DLL +L KT+QFDVLII               RGLNV
Sbjct: 41  AVYNDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDAATRGLNV 100

Query: 97  ALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLC 156
           ALVEK D+ASGTSSKSTKM HGGVRYLEKA ++ SKAQLDLVIEALNER HL+ TAPHLC
Sbjct: 101 ALVEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLC 160

Query: 157 TVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKAS 216
            +LPI+IP+Y   QVPY Y+G K YD FAGSQNLK SYLLSKS+  E APML +  LKA 
Sbjct: 161 KILPIMIPVYQYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLKAG 220

Query: 217 LVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELI 276
           LVYHDGSFNDSR+NATLAI+A+E GATVLNY+EV++L+KD  + K+ GA   D ET E  
Sbjct: 221 LVYHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETY 280

Query: 277 RIKAKCVVNATGPYSDAILQMDRNPSGQPD------------SPLNDNSKAKSAFNQIAV 324
           +IKAK +VNATGPYSD ILQMD N +G PD            +PLN  +  +S   ++AV
Sbjct: 281 QIKAKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVIT-PESISKEVAV 339

Query: 325 MDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVP 384
            +P MV+PS GVHI+LPS+YCP +MGLLD  T+DGRVMFFLPWQGKVLAGTTDIP+K VP
Sbjct: 340 QNPNMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVP 399

Query: 385 ENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGV 444
           ENP  TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLV+DPR      +KG ATQ V
Sbjct: 400 ENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRV-----QKGGATQEV 454

Query: 445 VRSHFLFTSDNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEW 504
           VRSHF+FTSDN L+TIAGGKWTTYR+MAEETID+VV+ G F N  PC TR +KLAGAE W
Sbjct: 455 VRSHFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENW 513

Query: 505 TQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSS 564
             N  ALL+Q Y++S+ M+ +L  NYGTRS IICE  KES ENKLP++LA +EN  I   
Sbjct: 514 DANLAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESI--- 570

Query: 565 EENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKV 624
             N  V +D+FRYP+TI ELKYSM YEY RT LDFL+RRTR+AFLDAKEAL++V+ TVK+
Sbjct: 571 -SNAHVGYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKI 629

Query: 625 MGDEFNWSEKKRQWELEKTVNFIKTFGV 652
           MGD  NW   +R+ E     ++IKTFGV
Sbjct: 630 MGDHLNWDNDRREREKVYATDYIKTFGV 657

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/607 (62%), Positives = 468/607 (77%), Gaps = 15/607 (2%)

Query: 53  PPQVSRRDLLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKS 112
           PP  SR +LL  L KT +FDVLII               RGLNVAL+E  DFAS TSSKS
Sbjct: 67  PP--SRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKS 124

Query: 113 TKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVP 172
           TKM HGGVRYLEKA ++ SKAQLDLVIEALNERKH++ TAPHLC +LPI+IP+Y+  +VP
Sbjct: 125 TKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVP 184

Query: 173 YIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNAT 232
           Y Y GCK YDFFAGSQNLK +YLLSK++  + APML    LKA+LVYHDGSFND+R+N +
Sbjct: 185 YFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVS 244

Query: 233 LAITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSD 292
           LA+TA+ENGATVLNY+EV+KLIKDP +GK+ GA  RD ET++   + AK VVN+TGP+SD
Sbjct: 245 LAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSD 304

Query: 293 AILQMDRNPSGQPD--SPLN-DNSKAKSA----FNQIAVMDPKMVIPSIGVHIVLPSFYC 345
            ILQMDRN SG PD     N D SK  S      ++IAV +PKMV+PS GVHI+LPS+YC
Sbjct: 305 NILQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYC 364

Query: 346 PKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYI 405
           PKDMG+LDV+T+DGRVMFFLPWQ KVLAGTTDIP+K+VPENP+ TEADI+DIL ELQHY 
Sbjct: 365 PKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYC 424

Query: 406 EFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKW 465
           +FPVKREDVLSAWAG+RPLVRDPR +  + K   +TQG+VRSHF+FTS+N+L+TIAGGKW
Sbjct: 425 KFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKW 484

Query: 466 TTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNY 525
           TTYR+MAEETID+ ++VG   N  P  T+D+ L+G E WT N  ALL+Q YH+ S +S Y
Sbjct: 485 TTYRRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKY 543

Query: 526 LVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELK 585
           L +NYGTR+ IICE  K+  +N+LP++LA KE+N I  +     V+F   RYP+T+ E+K
Sbjct: 544 LSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGN-----VDFQALRYPYTVAEVK 598

Query: 586 YSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVN 645
           Y +  EY RT LDFLLRRTRF FLDAKEA+N+V  TV +MGDE NW  +KR  E++K+  
Sbjct: 599 YCIDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKE 658

Query: 646 FIKTFGV 652
           +IKT GV
Sbjct: 659 YIKTLGV 665

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/596 (63%), Positives = 449/596 (75%), Gaps = 10/596 (1%)

Query: 57  SRRDLLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMI 116
           SR DLL  L KT +FDVLII               RGLNVA VE  DFASGTSSKSTKM 
Sbjct: 58  SREDLLSNLQKTDKFDVLIIGGGASGAGSALDAATRGLNVACVEANDFASGTSSKSTKMA 117

Query: 117 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYM 176
           HGGVRYLEKA +E S+AQLDLVIEALNER H++ TAPHLC +LPI+IP+YS  QVPY + 
Sbjct: 118 HGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFFA 177

Query: 177 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 236
           GCK YD+FAG QNL+ SYLLSK+   E APML    LKA LVYHDGSFNDSR+N+TLAI+
Sbjct: 178 GCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAIS 237

Query: 237 AVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQ 296
           A+E+GATVLNYV+V +L+KD ++ KV GA   D ET +  ++KAK  VNATGPYSD ILQ
Sbjct: 238 AIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQ 297

Query: 297 MDRNPSGQPDSPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRT 356
           MD+N +G PD P        S   ++AV  P MV+PS GVHI+LPS+YCPK +GLLDV+T
Sbjct: 298 MDKNKNGLPD-PQPPQPANVSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDVKT 356

Query: 357 SDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLS 416
           +DGRVMFFLPWQGKVLAGTTDIP+K VP+NP  TEADIQDIL+ELQHYI+FPV+REDVLS
Sbjct: 357 ADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDVLS 416

Query: 417 AWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEETI 476
           AWAG+RPLV DPR        G +T+G+VR+H +FTS+  LIT+AGGKWTTYR+MAE+TI
Sbjct: 417 AWAGIRPLVMDPRK---RKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMAEQTI 473

Query: 477 DKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSI 536
           D+VV+ GGF ++ PC TR IKLAG E WT N  ALLAQ+Y LS  MS +L  NYGTR+ I
Sbjct: 474 DEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTRAPI 532

Query: 537 ICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTP 596
           ICE FKE   N+LP++   +EN  +        VNFD+FRYPFTIGE  YS+++EY R  
Sbjct: 533 ICELFKEDERNQLPVAFGGRENVTVLHH-----VNFDSFRYPFTIGEFLYSIRHEYSRKA 587

Query: 597 LDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652
            DFL+RRTR+AFLDA  AL +V  TVKVMGDE NW   +RQ E+E+   FIKTFGV
Sbjct: 588 TDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/599 (60%), Positives = 430/599 (71%), Gaps = 18/599 (3%)

Query: 58  RRDLLERLGKTHQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEKGDFASGTSSKSTKMIH 117
           R  +L+RL  T +FDVL++               RGL VALVEK DFA+GTSSKSTK+ H
Sbjct: 61  RAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKLAH 119

Query: 118 GGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYMG 177
           GGVRYLEKA +E SK QLDLV+EALNER HL+  APHL  +LPI+IP+Y   +VPY Y G
Sbjct: 120 GGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFYAG 179

Query: 178 CKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITA 237
           CK YDFFAG+QNLK SYLLS+      APML    LK  LVYHDG FNDSRL ATLAI+A
Sbjct: 180 CKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAISA 239

Query: 238 VENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQM 297
           VE GATV NYV V++LIKD  +G + GA+  D ET     + AK VVNATGPYSD ILQM
Sbjct: 240 VERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKILQM 299

Query: 298 DRNPSGQPDSPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTS 357
           D NP G P+    +  KA      IAV +PKMV+PS GVHI LPSFYCP +MGLLD  TS
Sbjct: 300 DANPQGLPE---KEPEKATPENALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDASTS 356

Query: 358 DGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSA 417
           DGRVMFFLPWQGKV+AGTTDIPLKQVP +P PTEADIQDIL+ELQHYI+FPV+REDVLSA
Sbjct: 357 DGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDVLSA 416

Query: 418 WAGVRPLVRDPRTIPADGKKGSA-TQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEETI 476
           WAG+RPLVRDPR   A+G  GS  T+G+VRSHF+FTS   L+TIAGGKWTTYR+MAEET+
Sbjct: 417 WAGIRPLVRDPRV--AEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEETV 474

Query: 477 DKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYH-LSSKMSNYLVQNYGTRSS 535
           D+V++VG F  L PC TR  KL GA+ W  N+ A L Q Y  L   ++ +L  NYG R+ 
Sbjct: 475 DEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRAP 534

Query: 536 IICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFD--TFRYPFTIGELKYSMQYEYC 593
           IICE F+    +KLP+ L        Y   ++ + N D   F YPFTI ELKY +++EY 
Sbjct: 535 IICEMFEADKSSKLPVGL--------YGDGDDKVKNMDANAFDYPFTIAELKYCIRFEYV 586

Query: 594 RTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652
           RT LDFLLRR+RFAFLDA+EALN+V  TV ++GDE  W  +KR  E  KT  +IKTFGV
Sbjct: 587 RTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645

>Smik_13.408 Chr13 (648920..649690) [771 bp, 256 aa] {ON} YMR200W
           (REAL)
          Length = 256

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 18/98 (18%)

Query: 214 KASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEV--QKLIKDPASGKVIGAEARDVE 271
           KASL+Y  G++N S           ENG   LN +EV  ++L  DP + + +   +R  +
Sbjct: 92  KASLIYQHGTYNIS-----------ENGTLTLNPIEVDGRQLFSDPCTDQGVSTYSRYNQ 140

Query: 272 TNELIRIKAKCVVNATGPYSDAILQMDRNPSGQPDSPL 309
           T E+ +     +    G Y+  + Q D    G P  PL
Sbjct: 141 T-EIFKEYNVGIDPYHGIYTLQLYQFD----GTPMQPL 173

>Kpol_1008.7 s1008 complement(9101..11500) [2400 bp, 799 aa] {ON}
           complement(9101..11500) [2400 nt, 800 aa]
          Length = 799

 Score = 34.7 bits (78), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 48/95 (50%), Gaps = 10/95 (10%)

Query: 131 SKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNL 190
           +  +L+  +E ++   +LIN      ++LP+     S + VP+IY+G KF  F     +L
Sbjct: 404 TDEELEKYLEYVSHPMNLINLPRAEGSLLPVFGKRISGMTVPWIYVGSKFSTF---CWHL 460

Query: 191 KKSYLLSKSATVEKAPML-------TTDNLKASLV 218
           +  Y LS +   E AP +       + D+L++ LV
Sbjct: 461 EDQYTLSANYQHEGAPKVWYSIPEYSCDSLRSYLV 495

>SAKL0G16610g Chr7 (1434140..1440040) [5901 bp, 1966 aa] {ON} similar
            to uniprot|Q06409 Saccharomyces cerevisiae YLR422W
            Hypothetical ORF
          Length = 1966

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 57/131 (43%), Gaps = 32/131 (24%)

Query: 243  TVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKC--VVNATGPYSDAILQMDRN 300
            T++N  EV+K+ +   S       +  ++  EL  ++  C  ++   G YS+   ++ RN
Sbjct: 1685 TLMNRTEVKKISEKVLSPVENAIRSLQLKIQELTGLENMCYKLIKENGEYSEIFGELSRN 1744

Query: 301  PSGQPDSPLN----------------------DNSKAKSAFNQIAVMDPKMVIPSIGVHI 338
             SG  D+P+N                      D +  +SAF+++AV+  +     + +H 
Sbjct: 1745 ISGTIDAPINGGVSRYREFFEATEAKAEFKESDTNLLQSAFDELAVVLSR----CLALHD 1800

Query: 339  VLPSFYCPKDM 349
             L    CP D+
Sbjct: 1801 EL----CPVDL 1807

>TBLA0H02070 Chr8 (492770..497335) [4566 bp, 1521 aa] {ON} Anc_5.191
           YLR024C
          Length = 1521

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 559 NVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRT 604
           N+IY    NN  NF +F  P TI  LK  ++++  +  L  +LR T
Sbjct: 830 NLIYICLLNNFKNFQSFFTPITISHLKSLLKFDSIQLLLQNILRMT 875

>TPHA0D01370 Chr4 complement(283224..283940) [717 bp, 238 aa] {ON}
           Anc_8.693 YPL166W
          Length = 238

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 12/114 (10%)

Query: 177 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 236
           G K  D  A   NL+ S  +S    V+    +  D +  S   H    N +  N++L   
Sbjct: 100 GSKIIDLEAQRTNLQISQYISNKNIVDHQEEIPADEVSES--KHGMKTNSA--NSSL--- 152

Query: 237 AVENGATVLNYVEVQKLIKDPASGKVIGA--EARDVETNELIRIKAKCVVNATG 288
              NGA  ++Y+   KL KD   G+VI     ++ +E N  I+ K K  +  +G
Sbjct: 153 ---NGAMYMHYMNEDKLDKDDMYGEVISKLQTSKILENNFPIKFKNKLKLEDSG 203

>ZYRO0G15884g Chr7 complement(1300583..1302175) [1593 bp, 530 aa]
           {ON} similar to uniprot|P52911 Saccharomyces cerevisiae
           YDR261C EXG2 Exo-1 3-beta-glucanase involved in cell
           wall beta-glucan assembly may be anchored to the plasma
           membrane via a glycosylphosphatidylinositol (GPI) anchor
          Length = 530

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 32/82 (39%), Gaps = 11/82 (13%)

Query: 483 GGFHNLTPCHTRD------IKLAGAEEWTQNYVA-----LLAQNYHLSSKMSNYLVQNYG 531
           GG++N T  HT D      I     E+W + Y       + AQ    S+  S Y+  NY 
Sbjct: 386 GGYYNTTKFHTDDKPIGKCISQQSVEDWPKEYKKQVRQFIEAQLSSFSAHTSGYIFWNYK 445

Query: 532 TRSSIICEYFKESMENKLPLSL 553
           T  +I  +Y         P  L
Sbjct: 446 TEGAIEWDYLALKKHGLFPQPL 467

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,896,893
Number of extensions: 2836314
Number of successful extensions: 8136
Number of sequences better than 10.0: 38
Number of HSP's gapped: 8303
Number of HSP's successfully gapped: 38
Length of query: 652
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 536
Effective length of database: 40,180,143
Effective search space: 21536556648
Effective search space used: 21536556648
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)