Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_9.135.712ON1060106049780.0
YIL156W (UBP7)5.712ON1071106444230.0
Skud_9.125.712ON1064106442970.0
Suva_9.305.712ON1062106441650.0
CAGL0H06721g5.712ON108192419910.0
NDAI0F002005.712ON110549214740.0
NCAS0G001705.712ON103048214291e-180
TDEL0B020805.712ON102548514211e-179
KNAG0L022005.712ON116149614141e-176
KLLA0A00396g5.712ON101248213261e-165
Kwal_55.196455.712ON97053213051e-163
KLTH0E00814g5.712ON97448412981e-161
Kpol_2001.785.712ON40345312351e-160
TPHA0D046605.712ON104548012581e-155
TBLA0E017605.712ON121249312551e-153
AFR296C5.712ON116948212351e-150
Ecym_40095.712ON151748612541e-150
YKR098C (UBP11)5.712ON71748810871e-134
Skud_11.3385.712ON71248210831e-133
Smik_11.3625.712ON72148010831e-133
Suva_11.3355.712ON72448210681e-131
KAFR0H001505.712ON6564929901e-120
ZYRO0B16544g5.712ON10444879831e-115
Kpol_304.65.712ON5624758731e-104
SAKL0E15136g5.712ON10372519041e-104
CAGL0G02563gsingletonON6314858151e-95
KAFR0D021605.712ON8462537468e-84
KNAG0D019308.188ON9862512767e-24
AFR007W8.188ON8482502758e-24
TPHA0C027708.188ON9702472722e-23
YER144C (UBP5)8.188ON8052472685e-23
TBLA0F036108.188ON11442502661e-22
KAFR0C025908.188ON9782522651e-22
Kwal_14.20088.188ON4242662562e-22
KLTH0H07678g8.188ON8612682622e-22
Ecym_61848.188ON8512532623e-22
KLLA0E10275g8.188ON7962602613e-22
Kpol_1032.288.188ON8822502604e-22
TDEL0B042208.188ON8252462552e-21
Smik_4.3078.188ON9292412525e-21
Skud_4.3238.188ON9262412507e-21
NDAI0A036808.188ON11162532472e-20
YDR069C (DOA4)8.188ON9262412462e-20
CAGL0G05247g8.188ON9472432462e-20
Suva_2.2288.188ON9272412453e-20
Suva_5.2728.188ON7882662443e-20
SAKL0H18986g8.188ON8932582435e-20
Skud_5.2818.188ON8232502391e-19
CAGL0I06765g8.188ON8872512373e-19
NDAI0C059008.188ON8262492363e-19
Smik_5.3098.188ON8052522336e-19
ZYRO0G06798g8.188ON8772462329e-19
NCAS0B042808.188ON9222552311e-18
NCAS0A039108.188ON7952581998e-15
NCAS0I031401.137ON12012071981e-14
ZYRO0C17908g1.137ON12042261863e-13
AFR627C1.137ON12872101845e-13
TPHA0A025401.137ON12862131846e-13
KNAG0G015908.188ON6712461827e-13
TDEL0C056401.137ON11782331802e-12
KNAG0C021801.137ON12312121756e-12
KLTH0F03674g1.137ON11982161749e-12
KAFR0F015601.137ON11712081693e-11
Kwal_33.136281.137ON11602051651e-10
NDAI0B004801.137ON12532161632e-10
Smik_10.371.137ON12472091622e-10
YJL197W (UBP12)1.137ON12542081613e-10
KLLA0C03476g1.137ON12522121613e-10
CAGL0L01639g1.137ON11472061586e-10
Kpol_2001.541.137ON12231981586e-10
Suva_6.2761.137ON12562071579e-10
Ecym_81401.137ON12642041571e-09
Skud_10.221.137ON12552061571e-09
TBLA0J006001.137ON14622361523e-09
NCAS0E026107.390ON7171351424e-08
KNAG0C035807.390ON7761331391e-07
TPHA0L022905.18ON11931221391e-07
YBL067C (UBP13)7.390ON7471351372e-07
Suva_2.507.390ON7501351353e-07
Suva_4.2953.270ON7821911353e-07
NCAS0D023905.18ON12111211353e-07
Skud_2.387.390ON7481351344e-07
ZYRO0F01276g3.270ON7761921344e-07
KNAG0B023707.390ON7531011334e-07
Smik_2.497.390ON7451341334e-07
ZYRO0B03300g7.390ON8131291335e-07
NDAI0A016707.390ON8461341326e-07
SAKL0C04246g1.137ON12971431328e-07
Kpol_513.255.18ON11902341328e-07
NCAS0I016203.270ON7952371301e-06
Ecym_46857.390ON7781331291e-06
NDAI0E041807.390ON8271351282e-06
TDEL0D035503.270ON7802361282e-06
CAGL0I05522g7.390ON7241271282e-06
KLLA0C06974g8.742ON4462471263e-06
ZYRO0D07062g5.18ON11931181255e-06
TPHA0P006807.390ON7271291246e-06
YMR304W (UBP15)5.18ON12302351256e-06
SAKL0H04994g8.742ON4541341236e-06
CAGL0A04477g7.390ON7701301238e-06
NCAS0C021108.540ON4942041229e-06
ZYRO0A05962g8.742ON4651411211e-05
Smik_13.5215.18ON12312351221e-05
TBLA0C070205.18ON12472351221e-05
Ecym_56715.18ON11762361221e-05
CAGL0M13783g5.18ON11962341211e-05
KAFR0A069102.307ON6782611201e-05
NDAI0I025305.18ON11971201212e-05
Suva_13.4955.18ON12302351212e-05
CAGL0M11198g8.742ON4611471192e-05
TBLA0C012001.369ON5031121192e-05
NCAS0A143707.390ON7291291192e-05
Skud_13.4785.18ON12312351202e-05
YER098W (UBP9)7.390ON7541351192e-05
Kwal_26.91518.742ON4541421182e-05
KAFR0A042108.742ON4401261173e-05
CAGL0H10186g3.270ON7782361183e-05
Kwal_34.162681.369ON4491201173e-05
KNAG0G029308.742ON4592581164e-05
Skud_2.1773.270ON7821911174e-05
YMR223W (UBP8)8.742ON4711421156e-05
TDEL0B036708.742ON4631351156e-05
ZYRO0G01188g1.369ON5001261156e-05
Kpol_534.231.369ON4961131156e-05
KNAG0C019401.369ON4991091156e-05
NCAS0B005808.742ON4661341147e-05
TBLA0D010708.742ON4832631138e-05
AGL357W5.18ON11661151158e-05
KAFR0I026005.18ON12132381159e-05
TBLA0E025703.270ON7851211141e-04
Smik_5.2447.390ON7491331141e-04
TDEL0G004105.18ON11861181141e-04
TDEL0C015707.390ON7651291131e-04
Smik_13.4318.742ON4711401121e-04
KLLA0D08459g2.69ON7501371131e-04
TPHA0G005608.742ON4632601121e-04
NDAI0E008108.742ON4931371121e-04
NCAS0D006001.369ON4931271121e-04
KNAG0E012905.18ON11961211131e-04
Skud_5.2237.390ON7481331121e-04
TPHA0E008707.390ON7151001121e-04
NDAI0C059508.202ON10801441122e-04
CAGL0K10494g1.369ON4951261112e-04
Kpol_1018.937.390ON7551271112e-04
KLTH0D12760g8.742ON4531331092e-04
Suva_13.4078.742ON4711401092e-04
SAKL0H00418g5.18ON11901051103e-04
Kpol_1045.417.390ON7121251093e-04
NDAI0F034102.69ON8702041094e-04
KLTH0B09944g5.18ON11891181094e-04
Skud_13.3928.742ON4731421074e-04
Kwal_26.95985.18ON11912331085e-04
KLLA0A10791g1.369ON4841091075e-04
Ecym_27171.369ON4831121076e-04
KAFR0C004103.270ON7691861076e-04
TPHA0A025101.369ON5051151058e-04
AEL242W8.540ON613871068e-04
Suva_5.2177.390ON7541361068e-04
Kpol_1064.488.742ON4661061059e-04
KNAG0J008003.270ON7651281050.001
TBLA0D006207.390ON11711331050.001
KNAG0A019708.540ON4711591040.001
NDAI0A074103.270ON8101371040.001
SAKL0H18656g8.202ON7721531040.001
KAFR0L017307.390ON7011271040.001
Klac_YGOB_Anc_5.18b5.18ON11662361040.001
Ecym_62488.742ON4661121000.003
KAFR0E009308.540ON4982451000.003
Kwal_33.144302.69ON5112551000.003
KAFR0K018107.390ON7141291000.003
SAKL0D10120g1.369ON492112990.004
KLTH0H13354g1.369ON495112990.004
AGR023C3.270ON7801281000.005
Kwal_56.230843.270ON762127990.005
TDEL0D024001.369ON494112980.006
ZYRO0G01606g5.443ON130553990.006
Kpol_1024.448.540ON496194980.006
Suva_6.831.369ON500112970.008
Kpol_251.73.270ON480116970.008
Ecym_11668.540ON69681970.009
AEL029W1.369ON446109960.009
SAKL0E13002g2.69ON739251960.010
Smik_5.3188.202ON909170970.010
KAFR0C045201.369ON499109960.012
KLLA0E20351g7.390ON697163960.012
YPL072W (UBP16)8.540ON49984950.014
NDAI0H035501.369ON502115940.019
Skud_16.2098.540ON50384940.020
AGR370W7.390ON740141940.022
KNAG0A054502.307ON764271940.022
Smik_2.1893.270ON782209930.024
CAGL0K10252g5.443ON126744940.025
CAGL0J11352g2.69ON771197930.027
KLLA0E02377g5.443ON1220139930.030
ZYRO0D03982g8.540ON82181920.031
CAGL0I06600g8.202ON816166920.032
SAKL0H10076g8.540ON76781920.034
YFR010W (UBP6)1.369ON499109910.039
YER151C (UBP3)8.202ON912168910.044
SAKL0F12430g7.390ON754132910.045
TPHA0E017105.443ON128344910.050
TPHA0J026205.443ON122526900.063
TDEL0B030608.540ON73481900.065
SAKL0D03322g3.270ON765121890.072
Kpol_1016.15.443ON125133900.074
CAGL0H05335g8.540ON483167880.092
KLLA0F18700g3.270ON770112880.093
ZYRO0B11044g8.202ON826160880.10
Skud_6.941.369ON499109880.10
TBLA0H036008.540ON482205880.10
Smik_7.3141.369ON499108870.11
TDEL0A016208.202ON795165880.11
Smik_16.1638.540ON50172870.13
TBLA0B019308.202ON1019166870.14
TBLA0A064705.443ON132030870.15
Kwal_55.213935.443ON123330870.17
KLLA0E14125g8.97ON477160860.17
SAKL0G02728g5.443ON123738870.17
Suva_8.1765.443ON127038860.19
KLLA0E01013g8.202ON774168860.19
KNAG0B041905.443ON126291860.20
NCAS0A038408.202ON917163850.23
KLTH0C07326g3.270ON762107850.27
KLLA0E08801g2.307ON77138840.28
TDEL0D025805.443ON127252850.28
KLTH0F15862g5.443ON124126840.31
KAFR0D050705.443ON122788840.32
KLLA0E23387g8.540ON78287830.37
AGR139C8.202ON789147830.38
Ecym_45145.443ON124626830.39
Skud_15.2865.443ON127826830.42
Kwal_27.120308.540ON74986830.43
NDAI0C015505.443ON129539830.45
KLTH0G10934g2.307ON75852820.47
YOR124C (UBP2)5.443ON127226830.48
NCAS0B061302.307ON770279820.50
Smik_15.3015.443ON127226820.51
ACL164C5.443ON138931820.52
TPHA0D043508.202ON854138820.56
Kpol_1062.235.443ON126641820.57
KLTH0H07370g8.202ON781155820.58
Ecym_55448.202ON834148800.89
KLTH0E12540g8.540ON75281801.0
Smik_4.1152.307ON79040791.2
YBR058C (UBP14)3.270ON781100791.3
NCAS0H021005.443ON126926781.6
Kpol_1003.532.307ON78826781.6
KAFR0B015505.46ON96697771.9
AFR551W8.742ON469107772.1
Kwal_27.108427.390ON711117772.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_9.13
         (1060 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...  1922   0.0  
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...  1708   0.0  
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...  1659   0.0  
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...  1608   0.0  
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   771   0.0  
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     572   0.0  
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     555   e-180
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   551   e-179
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   549   e-176
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   515   e-165
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   507   e-163
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   504   e-161
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   480   e-160
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   489   e-155
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   488   e-153
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   480   e-150
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   487   e-150
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   423   e-134
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   421   e-133
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   421   e-133
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   416   e-131
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   385   e-120
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   383   e-115
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   340   e-104
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   352   e-104
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   318   1e-95
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   291   8e-84
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   110   7e-24
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   110   8e-24
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...   109   2e-23
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   107   5e-23
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....   107   1e-22
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   106   1e-22
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...   103   2e-22
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...   105   2e-22
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   105   3e-22
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...   105   3e-22
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...   104   4e-22
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   102   2e-21
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...   101   5e-21
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   100   7e-21
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}             100   2e-20
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...    99   2e-20
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    99   2e-20
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...    99   3e-20
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    99   3e-20
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    98   5e-20
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    97   1e-19
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    96   3e-19
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    96   3e-19
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    94   6e-19
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    94   9e-19
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     94   1e-18
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     81   8e-15
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    81   1e-14
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    76   3e-13
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    75   5e-13
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    75   6e-13
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    75   7e-13
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    74   2e-12
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    72   6e-12
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    72   9e-12
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    70   3e-11
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    68   1e-10
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    67   2e-10
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    67   2e-10
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    67   3e-10
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    67   3e-10
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    65   6e-10
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    65   6e-10
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    65   9e-10
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    65   1e-09
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    65   1e-09
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    63   3e-09
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    59   4e-08
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    58   1e-07
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    58   1e-07
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    57   2e-07
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    57   3e-07
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    57   3e-07
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    57   3e-07
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    56   4e-07
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    56   4e-07
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    56   4e-07
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    56   4e-07
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    56   5e-07
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    55   6e-07
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    55   8e-07
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    55   8e-07
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    55   1e-06
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    54   1e-06
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    54   2e-06
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    54   2e-06
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    54   2e-06
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    53   3e-06
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    53   5e-06
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    52   6e-06
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    53   6e-06
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    52   6e-06
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    52   8e-06
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    52   9e-06
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    51   1e-05
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    52   1e-05
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    52   1e-05
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    52   1e-05
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    51   1e-05
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    51   1e-05
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    51   2e-05
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    51   2e-05
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    50   2e-05
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    50   2e-05
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    50   2e-05
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    51   2e-05
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    50   2e-05
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    50   2e-05
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    50   3e-05
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    50   3e-05
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    50   3e-05
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    49   4e-05
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    50   4e-05
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    49   6e-05
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    49   6e-05
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    49   6e-05
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    49   6e-05
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    49   6e-05
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       49   7e-05
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    48   8e-05
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    49   8e-05
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    49   9e-05
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    49   1e-04
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    49   1e-04
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    49   1e-04
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    48   1e-04
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    48   1e-04
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    48   1e-04
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    48   1e-04
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    48   1e-04
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    48   1e-04
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    48   1e-04
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    48   1e-04
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    48   1e-04
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    48   2e-04
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    47   2e-04
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    47   2e-04
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    47   2e-04
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    47   2e-04
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    47   3e-04
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    47   3e-04
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    47   4e-04
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    47   4e-04
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    46   4e-04
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    46   5e-04
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    46   5e-04
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    46   6e-04
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    46   6e-04
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    45   8e-04
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    45   8e-04
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    45   8e-04
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    45   9e-04
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    45   0.001
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    45   0.001
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    45   0.001
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    45   0.001
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    45   0.001
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    45   0.001
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    45   0.001
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    43   0.003
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    43   0.003
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    43   0.003
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    43   0.003
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    43   0.004
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    43   0.004
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    43   0.005
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    43   0.005
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    42   0.006
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    43   0.006
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    42   0.006
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    42   0.008
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    42   0.008
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    42   0.009
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    42   0.009
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    42   0.010
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    42   0.010
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    42   0.012
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    42   0.012
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    41   0.014
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    41   0.019
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    41   0.020
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    41   0.022
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    41   0.022
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    40   0.024
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    41   0.025
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    40   0.027
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    40   0.030
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    40   0.031
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    40   0.032
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    40   0.034
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    40   0.039
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    40   0.044
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    40   0.045
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    40   0.050
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    39   0.063
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    39   0.065
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    39   0.072
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    39   0.074
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    39   0.092
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    39   0.093
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    39   0.10 
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    39   0.10 
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    39   0.10 
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    38   0.11 
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    39   0.11 
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    38   0.13 
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    38   0.14 
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    38   0.15 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    38   0.17 
KLLA0E14125g Chr5 (1250334..1251767) [1434 bp, 477 aa] {ON} simi...    38   0.17 
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    38   0.17 
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    38   0.19 
KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some s...    38   0.19 
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    38   0.20 
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    37   0.23 
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    37   0.27 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    37   0.28 
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    37   0.28 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    37   0.31 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    37   0.32 
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    37   0.37 
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    37   0.38 
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    37   0.39 
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    37   0.42 
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    37   0.43 
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    37   0.45 
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    36   0.47 
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    37   0.48 
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    36   0.50 
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    36   0.51 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    36   0.52 
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    36   0.56 
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    36   0.57 
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    36   0.58 
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    35   0.89 
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    35   1.0  
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    35   1.2  
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    35   1.3  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    35   1.6  
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    35   1.6  
KAFR0B01550 Chr2 complement(292584..295484) [2901 bp, 966 aa] {O...    34   1.9  
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    34   2.1  
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    34   2.3  
NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.5...    33   3.4  
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    33   3.5  
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    33   3.7  
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     33   3.8  
TPHA0M01090 Chr13 complement(217833..220175) [2343 bp, 780 aa] {...    33   3.9  
KLTH0D07062g Chr4 complement(615021..618899) [3879 bp, 1292 aa] ...    33   4.5  
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    33   4.6  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    33   5.1  
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    33   5.1  
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    32   6.2  
KLLA0F24420g Chr6 (2275736..2277472) [1737 bp, 578 aa] {ON} some...    32   7.5  
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    32   7.7  
TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {...    32   8.4  
CAGL0A02486g Chr1 (266055..268655) [2601 bp, 866 aa] {ON} some s...    32   8.7  
Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa] ...    32   9.1  

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (REAL)
          Length = 1060

 Score = 1922 bits (4978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 959/1060 (90%), Positives = 959/1060 (90%)

Query: 1    MHPHTTLFTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHH 60
            MHPHTTLFTPEYSDELLRRVQDLYHEDIKHYYPQ           HTEYLFELYLDSMHH
Sbjct: 1    MHPHTTLFTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHH 60

Query: 61   GRPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120
            GRPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE
Sbjct: 61   GRPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120

Query: 121  IGVVLDESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDM 180
            IGVVLDESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDM
Sbjct: 121  IGVVLDESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDM 180

Query: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTSTFNEPERKSTSPARPSVLLEDVPCTYHDND 240
            DQSSPVWTAPNLEPNDQLKLALLPEVIPTSTFNEPERKSTSPARPSVLLEDVPCTYHDND
Sbjct: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTSTFNEPERKSTSPARPSVLLEDVPCTYHDND 240

Query: 241  ASTASLNPPFRDITADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQ 300
            ASTASLNPPFRDITADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQ
Sbjct: 241  ASTASLNPPFRDITADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQ 300

Query: 301  KQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTP 360
            KQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTP
Sbjct: 301  KQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTP 360

Query: 361  VYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTT 420
            VYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTT
Sbjct: 361  VYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTT 420

Query: 421  VPTALLGGYEKWKKTLHSYAQEYHISVEDYLYRPYSQKARAXXXXXXXXXXXXXXXXXKE 480
            VPTALLGGYEKWKKTLHSYAQEYHISVEDYLYRPYSQKARA                 KE
Sbjct: 421  VPTALLGGYEKWKKTLHSYAQEYHISVEDYLYRPYSQKARAQQQQQQQQPNSQDSSSSKE 480

Query: 481  TPTKVPEPPSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMVYPHEGSVPRKPP 540
            TPTKVPEPPSW                                   MVYPHEGSVPRKPP
Sbjct: 481  TPTKVPEPPSWKPPDLPIRLRKRPPPPPPASMPTTPEIPPPLPPKIMVYPHEGSVPRKPP 540

Query: 541  IPAKQHVKKKQSNSNEIIQRKRXXXXXXXXXXXXXXXKDYSIPTIERNPNVYVSLSITGL 600
            IPAKQHVKKKQSNSNEIIQRKR               KDYSIPTIERNPNVYVSLSITGL
Sbjct: 541  IPAKQHVKKKQSNSNEIIQRKRQQQHYGQQLLQPLPPKDYSIPTIERNPNVYVSLSITGL 600

Query: 601  RNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFNKM 660
            RNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFNKM
Sbjct: 601  RNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFNKM 660

Query: 661  YLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPN 720
            YLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPN
Sbjct: 661  YLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPN 720

Query: 721  LLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFY 780
            LLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFY
Sbjct: 721  LLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFY 780

Query: 781  VLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPXXXXXXXX 840
            VLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGP        
Sbjct: 781  VLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPTASFTASA 840

Query: 841  XXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFGDSNGEGNNINNTMIFERERSRSP 900
                LENE           RFFTLHTGSKRRHLDIFGDSNGEGNNINNTMIFERERSRSP
Sbjct: 841  SASALENESSILKSKKKKSRFFTLHTGSKRRHLDIFGDSNGEGNNINNTMIFERERSRSP 900

Query: 901  FKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYD 960
            FKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYD
Sbjct: 901  FKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYD 960

Query: 961  LTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGR 1020
            LTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGR
Sbjct: 961  LTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGR 1020

Query: 1021 SKWYYFDDEVVKADKKHGSDKNLKISSSDVYVLFYERVYD 1060
            SKWYYFDDEVVKADKKHGSDKNLKISSSDVYVLFYERVYD
Sbjct: 1021 SKWYYFDDEVVKADKKHGSDKNLKISSSDVYVLFYERVYD 1060

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
            UBP7Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1071

 Score = 1708 bits (4423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 864/1064 (81%), Positives = 907/1064 (85%), Gaps = 6/1064 (0%)

Query: 1    MHPHTTLFTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHH 60
            MHPH T FTPEYS+ELLRRVQDLYHEDIKHYYPQ           HTEYLFELYLDS+HH
Sbjct: 10   MHPHITPFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHH 69

Query: 61   GRPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120
             RPNDALTAF+IGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE
Sbjct: 70   DRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 129

Query: 121  IGVVLDESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDM 180
            IGVVLDESVKH  GIEHRI KKRAFSVPA+DLSGQVASLSLDTA PQ H +K   TEDD 
Sbjct: 130  IGVVLDESVKHGAGIEHRITKKRAFSVPADDLSGQVASLSLDTAAPQDHGLKGTFTEDDA 189

Query: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTSTFNEPERKSTSPARPSVLLEDVPCTYHDND 240
            +QSSPVWTAPNLEPNDQLKLALLPEVIPT  F EPERK++ P RPSVLLEDVP  YH++D
Sbjct: 190  EQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFREPERKTSVPVRPSVLLEDVPSIYHEDD 249

Query: 241  ASTASLNPPFRDITADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQ 300
             S ASLNPPFR+ITADRSVTHRKDSYHSVYMVDS NLKEDND+  NVENDGFIQSLDILQ
Sbjct: 250  TSFASLNPPFREITADRSVTHRKDSYHSVYMVDSGNLKEDNDDLFNVENDGFIQSLDILQ 309

Query: 301  KQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTP 360
            KQSIITAPELFSILSNRVEREKVLLIDLRIPQRSA+NHIVAPNLV VDPNLLWDK+TNTP
Sbjct: 310  KQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAINHIVAPNLVNVDPNLLWDKQTNTP 369

Query: 361  VYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTT 420
            +Y+DDILEHLLKENENF NR+KFDYIVYY+DVKTFMTINFDY FIFFYLMLTSQKTPLTT
Sbjct: 370  IYKDDILEHLLKENENFINRNKFDYIVYYTDVKTFMTINFDYAFIFFYLMLTSQKTPLTT 429

Query: 421  VPTALLGGYEKWKKTLHSYAQEYHISVEDYLYRPYSQKARAXXXXXXXXXX--XXXXXXX 478
            VPT LLGGYEKWKKTLHSYAQEYHIS+EDYLYRPYSQKAR                    
Sbjct: 430  VPTTLLGGYEKWKKTLHSYAQEYHISIEDYLYRPYSQKARLQQEQQQQQQQPDSQDSFSA 489

Query: 479  KETPTKVPEPPSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMVYPHEGSVPRK 538
            KE+ TKVPEPPSW                                   MV+    S+ RK
Sbjct: 490  KESSTKVPEPPSWKPPDLPIRLRKRPPPPPPVSMPTTPEIPPPLPPKIMVHSQVSSISRK 549

Query: 539  PPIPAKQHVKKKQSNSNEIIQRKRXXXXXXXXXXXXXXXKDYSIPTIERNPNVYVSLSIT 598
            PPIPAKQHVKK+Q NSNEIIQRKR               + Y+IPTIER+PNVYVSLSIT
Sbjct: 550  PPIPAKQHVKKEQLNSNEIIQRKRQHQHQHYDQQILQPQRAYNIPTIERSPNVYVSLSIT 609

Query: 599  GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
            GLRNLGNTCYINSMIQCLFAAKTFRTLFISS YK+YL+P+ SN  H+SPKLSNSLSMLFN
Sbjct: 610  GLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIRSNGSHYSPKLSNSLSMLFN 669

Query: 659  KMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDY 718
            KMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELS+QQHVANDY
Sbjct: 670  KMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSDQQHVANDY 729

Query: 719  PNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 778
            PNLLLYNAD LKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST
Sbjct: 730  PNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 789

Query: 779  FYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPXXXXXX 838
            FYVLSLAIP RSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGP      
Sbjct: 790  FYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGP--TASV 847

Query: 839  XXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFGDSNGEGNNI--NNTMIFERER 896
                  LENE           RFFTLHTG+KRRHLD FGD   EG+N   NNT IFERER
Sbjct: 848  STSVSALENEPSIVKSKKKKSRFFTLHTGTKRRHLDFFGDGITEGHNSNNNNTTIFERER 907

Query: 897  SRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSR 956
            SRSPF+MLGGSGKRSSSSTPF+ GGNDSNN+ D+KNKK+TTVKTINFVTLPKILVIHLSR
Sbjct: 908  SRSPFRMLGGSGKRSSSSTPFSTGGNDSNNSSDYKNKKLTTVKTINFVTLPKILVIHLSR 967

Query: 957  FYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSV 1016
            FYYDLTKKNNTV+TYPLILNIILKNNDTMKY+LFGVVNHTGTLISGHYTSLVNKDLEH+V
Sbjct: 968  FYYDLTKKNNTVVTYPLILNIILKNNDTMKYKLFGVVNHTGTLISGHYTSLVNKDLEHNV 1027

Query: 1017 DIGRSKWYYFDDEVVKADKKHGSDKNLKISSSDVYVLFYERVYD 1060
            +IGRSKWYYFDDEVVKAD+KHGSDKNLKISSSDVYVLFYERVYD
Sbjct: 1028 NIGRSKWYYFDDEVVKADRKHGSDKNLKISSSDVYVLFYERVYD 1071

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (REAL)
          Length = 1064

 Score = 1659 bits (4297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 831/1064 (78%), Positives = 883/1064 (82%), Gaps = 5/1064 (0%)

Query: 1    MHPHTTLFTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHH 60
            MHPHTTLFTPEYS+ELLRRVQDLYHEDIKHYYPQ           HTEYL+ELYLDSM H
Sbjct: 1    MHPHTTLFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRH 60

Query: 61   GRPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120
             RPNDALTAF+IGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE
Sbjct: 61   NRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120

Query: 121  IGVVLDESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDM 180
            IGVVLDESVKH VGIEHRI KKRAFSVPANDLSGQVASLSL+ AGP  H  K   TE+D 
Sbjct: 121  IGVVLDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEEDA 180

Query: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTSTFNEPERKSTSPARPSVLLEDVPCTYHDND 240
            +QSSPVWTAPNLEPNDQLKLALLPEVIPT  + E  RK++SP RPSVLLEDVP   +D  
Sbjct: 181  EQSSPVWTAPNLEPNDQLKLALLPEVIPTPIYPESGRKTSSPVRPSVLLEDVPYNCYDGG 240

Query: 241  ASTASLNPPFRDITADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQ 300
            AS+ASLNP F +IT DRS+THRKDSYHS+YMVDSD LKEDND+ LNVE D FIQSLDILQ
Sbjct: 241  ASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQ 300

Query: 301  KQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTP 360
            KQSIITAPELFSILSN +EREK+LLIDLRIP+RS +NHIVAPNLVK+DPNLLWD+KTNTP
Sbjct: 301  KQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTP 360

Query: 361  VYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTT 420
            VYQDDILEHLL+ENE F NRDKF+Y+VYY+DVKTFM +NFDYVFIFFYLMLTSQKT LT+
Sbjct: 361  VYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTS 420

Query: 421  VPTALLGGYEKWKKTLHSYAQEYHISVEDYLYRPYSQKARAXXXXXXXXXXXXXXXXXKE 480
            VPTALLGGYEKWKKTLH+YAQEY +S+EDYLYRPYSQKA                   KE
Sbjct: 421  VPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYRPYSQKAHQQQQQEQQQSNAQDSSSSKE 480

Query: 481  TPTKVPEPPSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMVYPHEGSVPRKPP 540
            +  KVPEPPSW                                   MVY H+ S  RKPP
Sbjct: 481  SSAKVPEPPSWKPPDLPIRLRKRPPPPPPVSMPTTPGIPPPLPPKIMVYSHDNSFSRKPP 540

Query: 541  IPAKQHVKKKQSNSNEIIQRKRXXXXXX---XXXXXXXXXKDYSIPTIERNPNVYVSLSI 597
            IPAKQHVKK+Q NSNEIIQRKR                  + Y+IPTIE++ NVYVSLSI
Sbjct: 541  IPAKQHVKKQQLNSNEIIQRKRQQQKHRHYGQQLLQPQPQRAYNIPTIEQSSNVYVSLSI 600

Query: 598  TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            TGLRNLGNTCYINSMIQCLFAAK FRTLFIS+NYKNYL+P   +R  HS KLSNSL+MLF
Sbjct: 601  TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLF 660

Query: 658  NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            NKMYLNGGCSVVPTGFLKV+NQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND
Sbjct: 661  NKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 720

Query: 718  YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 777
            YPNLLLYNAD LKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS
Sbjct: 721  YPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 780

Query: 778  TFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPXXXXX 837
            TFYVLSLAIP RSMKLSKLGRSTEKRVKLEDCINMFT DEVLSGENAWDCPRCGP     
Sbjct: 781  TFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCGPTASSS 840

Query: 838  XXXXXXXLENEXX-XXXXXXXXXRFFTLHTGSKRRHLDIFGDSNGEGNNINNTMIFERER 896
                                   RFFTLHTGSKRRHLD FGD+  E N+ +NT+ FERER
Sbjct: 841  SASASASAFESESPIAKSKKKKSRFFTLHTGSKRRHLDFFGDNINESNS-SNTVTFERER 899

Query: 897  SRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSR 956
            SRSPFKMLG SGKRS+SSTPFAN  ND NN  DFKNKK+TTVKTINFVTLPKILVIHLSR
Sbjct: 900  SRSPFKMLGSSGKRSNSSTPFANNNNDGNNINDFKNKKLTTVKTINFVTLPKILVIHLSR 959

Query: 957  FYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSV 1016
            FYYDLTKKN+TVITYPLILNIILKNN+TMKYRLFGVVNHTGTL+SGHYTSLVNKDLEHSV
Sbjct: 960  FYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSV 1019

Query: 1017 DIGRSKWYYFDDEVVKADKKHGSDKNLKISSSDVYVLFYERVYD 1060
            DIGRSKWYYFDDEVVKAD KHGSDKNLKISSSDVYVLFYERV+D
Sbjct: 1020 DIGRSKWYYFDDEVVKADNKHGSDKNLKISSSDVYVLFYERVHD 1063

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
            YIL156W (REAL)
          Length = 1062

 Score = 1608 bits (4165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 809/1064 (76%), Positives = 872/1064 (81%), Gaps = 6/1064 (0%)

Query: 1    MHPHTTLFTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHH 60
            MHPHTT FTPEYS+ELLRRV+DLYHEDIKHYYPQ           HTEYLFELYLDSM H
Sbjct: 1    MHPHTTSFTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRH 60

Query: 61   GRPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120
             RPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIY+DLKKMYENEMNMTNVVLMVKKE
Sbjct: 61   ERPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKE 120

Query: 121  IGVVLDESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDM 180
            IGVVLD+SVKHVVGIEHRI KKRAFSVP  DLS Q+ASLSLD AGP+ H  K   TE+D 
Sbjct: 121  IGVVLDDSVKHVVGIEHRITKKRAFSVPGIDLSDQLASLSLDAAGPRGHLHKTSSTEEDA 180

Query: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTSTFNEPERKSTSPARPSVLLEDVPCTYHDND 240
            DQSSPVWTAPNLEPNDQLKLALLPEVIPT  F E  RK+++P R SVLLEDVP T++DND
Sbjct: 181  DQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVPYTHNDND 240

Query: 241  ASTASLNPPFRDITADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQ 300
             ++AS + PF +ITADRSVTHRKDSYHSVYMVDSD  K DND+ L+VE DGFIQSL+ILQ
Sbjct: 241  GTSASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQ 300

Query: 301  KQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTP 360
            KQSIITAPELF+ILSN+ E EK+LLIDLRIPQRSA+N+IVAPNLVK+DPNLLWDKKTN P
Sbjct: 301  KQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKP 360

Query: 361  VYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTT 420
            VYQDDILE LL+ NE+F NRDKF Y+V YSDVKTFMT+NFDY FIFFYL+LTSQKT L T
Sbjct: 361  VYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLAT 420

Query: 421  VPTALLGGYEKWKKTLHSYAQEYHISVEDYLYRPY--SQKARAXXXXXXXXXXXXXXXXX 478
            VPTALLGGYEKWKKTLH+YAQ+YHIS++DYLYRPY   Q+ +                  
Sbjct: 421  VPTALLGGYEKWKKTLHTYAQQYHISIDDYLYRPYSQKQQQQQQQQQQQQQPSSQDSSSS 480

Query: 479  KETPTKVPEPPSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMVYPHEGSVPRK 538
            KE+  K+PEPPSW                                   MV+PH+    R+
Sbjct: 481  KESSAKIPEPPSWKPPDLPIRLRKRPPPPLPVTMPTTPENPPPLPPKIMVHPHDNFQLRQ 540

Query: 539  PPIPAKQHVKKKQSNSNEIIQRKR--XXXXXXXXXXXXXXXKDYSIPTIERNPNVYVSLS 596
            PPIPA+QHVKK+Q NSNEIIQ+KR                 + Y IPTIE++ N YVSLS
Sbjct: 541  PPIPARQHVKKQQLNSNEIIQKKRQHQHQHYDQQLLQPQPQRVYHIPTIEQSSNAYVSLS 600

Query: 597  ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656
            ITGLRNLGNTCYINSMIQCLFAAK FRTLFISS YK+YL+    NR  HSP+LSNSL+ML
Sbjct: 601  ITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGNRL-HSPRLSNSLNML 659

Query: 657  FNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAN 716
            F+KMYLNGGCSVVPTGFLKV+NQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ HVAN
Sbjct: 660  FDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVAN 719

Query: 717  DYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY 776
            DYPNLLLY+AD LKVSN EYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY
Sbjct: 720  DYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNY 779

Query: 777  STFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPXXXX 836
            STFYVLSLAIP RSMKLSKLGR  EKRVKLEDCINMFTSDEVLSGENAWDCPRCGP    
Sbjct: 780  STFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPTAST 839

Query: 837  XXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFGDSNGEGNNINNTMIFERER 896
                    LEN+           RFFTLHT SKRRHLD FGDS+ E  + NN + FERER
Sbjct: 840  SLSASASALENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSSNESTS-NNPVHFERER 898

Query: 897  SRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSR 956
            SRSPFKMLGG GKRS S+TPFAN  ND NN  DFKNKK+TTVKTINFVTLPKILVIHLSR
Sbjct: 899  SRSPFKMLGGGGKRSHSNTPFANSSNDGNNFNDFKNKKLTTVKTINFVTLPKILVIHLSR 958

Query: 957  FYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSV 1016
            FYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEH+V
Sbjct: 959  FYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHNV 1018

Query: 1017 DIGRSKWYYFDDEVVKADKKHGSDKNLKISSSDVYVLFYERVYD 1060
            DIGRSKWYYFDDEVVKADKKHGSDK+LKISSSD YVLFYERV+D
Sbjct: 1019 DIGRSKWYYFDDEVVKADKKHGSDKSLKISSSDAYVLFYERVHD 1062

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/924 (46%), Positives = 549/924 (59%), Gaps = 101/924 (10%)

Query: 155  QVASLSL---DTAGPQQHN--IKVPLTEDDMDQ------SSPVWTAPNLEPNDQLKLALL 203
            ++ +LSL   D A   QHN    +P T  D D+       SP+WTAP+L+PNDQLKLAL 
Sbjct: 238  EIPTLSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALG 297

Query: 204  PEVIPTSTFNEPERKSTSPARPSVLLEDVPCTYHDNDASTASLNPPFRDITADRSVTHRK 263
             E++                    L +D+           +     F D+ A+R +THRK
Sbjct: 298  TELLSPPVMG---------LDGDTLGDDIYYETVSKGDDVSYRGKDFEDLHANRLITHRK 348

Query: 264  DSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKV 323
            DSYHS+YM+D DN    N  + +  N  FIQ L+ LQKQSIITAPELFSILSN  ER K+
Sbjct: 349  DSYHSIYMIDDDNNNSKN--YFDGSN-AFIQGLERLQKQSIITAPELFSILSNPEERHKL 405

Query: 324  LLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKF 383
            LLIDLR+ +RS  NHIVAPN+V +DP  LWD + N+P+Y+D ILE  L  N  F  R K+
Sbjct: 406  LLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLN-NPLFNGRLKY 464

Query: 384  DYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEY 443
            DYIVYYSD+KT+M   +DY FI FYL+ TS K  L++VPTALLGGYEKWKK +++Y  +Y
Sbjct: 465  DYIVYYSDMKTYMNFEYDYSFILFYLLTTSGKH-LSSVPTALLGGYEKWKKVMNTYVSQY 523

Query: 444  HISVEDYLYRPYSQKARAXXXXXXXXXXXXXXXXXKETPTKVPEPPSWXXXXXXXXXXXX 503
             I ++DYLYRPY+                      ++   ++P+ P+W            
Sbjct: 524  QIELDDYLYRPYA----------------PSNNKGEQNNAQIPDVPTWKPPPVPVMVRKR 567

Query: 504  XXXXXXXXXXXXXXXXXXXXXXXMVYPHEGSVPR------KPPIPAKQHVKKKQSNSNEI 557
                                    +   E S P       +PP  AK  +    S  N+ 
Sbjct: 568  PPPPVPVSIPIPPETPPPLPQKIKLESIEESAPSDNSQYIRPP--AKLPIHALHSPRNQT 625

Query: 558  IQRKRXXXXXXXXXXXXXXXKDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLF 617
            + RK                  +SIPTIE+N N YV+ S+TGLRNLGNTCYIN M+Q LF
Sbjct: 626  LTRK------------------FSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLF 667

Query: 618  AAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVI 677
            A    + LFIS  Y+ Y      N+      +SN+ + LFNKMY+NGGC+VVP+GFLK+ 
Sbjct: 668  ATNELKNLFISGKYREYQMKPNDNK---ESAISNTFANLFNKMYMNGGCTVVPSGFLKIC 724

Query: 678  NQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYK 737
            N LRPDL+IPDDQQDTQEFL+ +L+RLHDELSNQ +V NDYPNLLLY+ D + V   +YK
Sbjct: 725  NFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVINDYPNLLLYDDDKMMVDKEKYK 784

Query: 738  HWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLG 797
             WFDK V+ NG+SP+D +FQGQMEN+LQC+RCGY + NYSTFYVLSLA+P    K S   
Sbjct: 785  KWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALP----KPSAPA 840

Query: 798  RSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXX 857
                 RVKLEDCINMFTSDEVL+GENAWDCP+CG              +           
Sbjct: 841  FYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHK 900

Query: 858  XXRFFTLHTGSKRRHLDIFGDSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPF 917
              +FF L TG                            RS+SPF+ LG   K        
Sbjct: 901  KSKFFGLPTGKA------------------------ISRSKSPFRKLGLLEKHEGKQEKL 936

Query: 918  ANGGNDS-NNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILN 976
                 D        K+KK+ T+KTINF++LPK+L+IHLSRFYYDLTKKN+ V++YPL+LN
Sbjct: 937  DKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLN 996

Query: 977  IILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKK 1036
            I+LKN + ++Y+L+ +VNHTG LISGHYTSLVNKD  H++     KWYYFDDEVVKA+K 
Sbjct: 997  IVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKT 1056

Query: 1037 HGS-DKNL-KISSSDVYVLFYERV 1058
            HG+ DK + K+SS +VYVLFYERV
Sbjct: 1057 HGNVDKGITKVSSKNVYVLFYERV 1080

 Score =  106 bits (264), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 82/120 (68%), Gaps = 1/120 (0%)

Query: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDAL 67
           FTPE+S +LL ++Q +Y ++I+  +PQ             + + E Y+  +     + A+
Sbjct: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCVDVDT-SKAV 62

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
             F+ GC+Y++L++P+S+QFQTR+KSYS+YT+L+ +YE+++NMTNV+ MVK+E+  + ++
Sbjct: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/492 (60%), Positives = 351/492 (71%), Gaps = 53/492 (10%)

Query: 578  KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEP 637
            + +SIPTIE++PN+YVSLSITGLRNLGNTCYINSM+QCLFA + FR LFISS +++++  
Sbjct: 658  RKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN- 716

Query: 638  LASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFL 697
              S  P+ +PK+SNS ++LF KMYLNGGCSVVPT FLK  N LRPDL+IPDDQQDTQEFL
Sbjct: 717  -DSKFPN-TPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFL 774

Query: 698  MILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQ 757
            MI+LDRLHDELSNQQ V N+YPNLLLY+ + LKV N EYKHWFDKNVIGNG+SPID IF 
Sbjct: 775  MIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFS 834

Query: 758  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDE 817
            GQMENSLQC+RCG +++NYSTFYVLSLAIP    K S    S  KRVKLE+CINMFTSDE
Sbjct: 835  GQMENSLQCQRCGNSSYNYSTFYVLSLAIP----KPSSTTFSRSKRVKLEECINMFTSDE 890

Query: 818  VLSGENAWDCPRCGPXXXXXXXXXXXXL-------ENEXXXXXXXXXXXRFFTLHTGSKR 870
            VLSGENAWDCP+CG             L       +N            +FFTLHT S  
Sbjct: 891  VLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRS-- 948

Query: 871  RHLDIFGDSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDF 930
                                     RS SPF+      K S ++ P       S     +
Sbjct: 949  ------------------------HRSISPFR-----KKTSPAAVP------SSTKNEPW 973

Query: 931  KNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLF 990
            K+KK+ T+KT+NF+ LP ILVIHLSRFYYDLTKKNNTVITYPLILNI+LKNN+  KYRL+
Sbjct: 974  KSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLY 1033

Query: 991  GVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKN-LKISSS 1048
            G+VNH+G LISGHYTSLVNK+  H +   + +WYYFDDE VK ++ HG  DK  L++SS 
Sbjct: 1034 GIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSR 1093

Query: 1049 DVYVLFYERVYD 1060
            DVYVLFYER+Y+
Sbjct: 1094 DVYVLFYERIYE 1105

 Score =  219 bits (557), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/207 (53%), Positives = 151/207 (72%), Gaps = 13/207 (6%)

Query: 256 DRSVTHRKDSYHSVYMVD---SDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFS 312
           DR+  HRKDSYHS+YMVD   +D + +  D      ++ +I SL+ LQKQ IITA ELFS
Sbjct: 331 DRASNHRKDSYHSIYMVDDGSADGITQYYD------SNPYIHSLERLQKQCIITAQELFS 384

Query: 313 ILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLL- 371
           ILSN +E+ K+LLIDLR P+R + NHIVAPNL+ +DP LLW+ KTNTP+Y    LE+LL 
Sbjct: 385 ILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLY 444

Query: 372 --KENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTP-LTTVPTALLGG 428
             K  +   NR +F+YIV+Y+D KT+M  NFDY F FFYL++TS+    + + PT LLGG
Sbjct: 445 EPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGG 504

Query: 429 YEKWKKTLHSYAQEYHISVEDYLYRPY 455
           Y+KWKK L+SY+++Y+ ++ DYLY+P+
Sbjct: 505 YDKWKKVLYSYSEQYNFNMGDYLYKPH 531

 Score =  197 bits (501), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 143/225 (63%), Gaps = 31/225 (13%)

Query: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPN-DA 66
           FTPEYS+ELL++VQ +YH+DIKHYYPQ           HTEYL EL+     +   N D 
Sbjct: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKDV 68

Query: 67  LTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLD 126
           LTAF++GCYY+FLIIPQS+QFQ++NKSY IYT+LKK+YENE +MTNV+LMVK EI  VLD
Sbjct: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128

Query: 127 -ESVKHVVGIEHRINKK-RAFSVPANDLSGQVASLSLDTAGPQQH---NIKVPLTED--- 178
            +   +   + HRI K+ RA+S+  N+LS QV SLS+  +  Q+H     +  LT     
Sbjct: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188

Query: 179 ----------------------DMDQSSPVWTAPNLEPNDQLKLA 201
                                 D D++SP+WTAP+LEP DQLKLA
Sbjct: 189 HHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLA 233

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  555 bits (1429), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 288/482 (59%), Positives = 345/482 (71%), Gaps = 44/482 (9%)

Query: 581  SIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLAS 640
            SIPTIER+PN+YVSLSITGLRNLGNTCYINSM+QCLFA + FR LF++S Y ++L    S
Sbjct: 591  SIPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYSSFLN--GS 648

Query: 641  NRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMIL 700
              P+ SP +SNS ++LF KMYLNGGCSVVPT FLK  N LRPDLKIPDDQQDTQEFLMI+
Sbjct: 649  KFPN-SPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMII 707

Query: 701  LDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQM 760
            LDRLHDELSNQQ V N+YP+L+LY+ + L+V + EYKHWF+K+VIGNG+SPID+IFQGQ+
Sbjct: 708  LDRLHDELSNQQEVVNEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSPIDEIFQGQI 767

Query: 761  ENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLS 820
            EN LQC+RCG+++FNYSTFYVLSLAIP    K S  G S  KRVKLEDCINMFT+DE+LS
Sbjct: 768  ENGLQCQRCGHSSFNYSTFYVLSLAIP----KPSPTGFSRSKRVKLEDCINMFTNDEMLS 823

Query: 821  GENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFGDSN 880
            GENAWDCP CG                +           RFF L T   R H        
Sbjct: 824  GENAWDCPNCGSNAQDRVRVNTDQSVKKKRQGEEHRHKSRFFGLPT---RPH-------- 872

Query: 881  GEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKT 940
                           RS SPF+  G S   S+S            +   +K KK+ T+KT
Sbjct: 873  ---------------RSLSPFRKSGSSSTNSTSKI---------KHEQQWKTKKLITIKT 908

Query: 941  INFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLI 1000
            +NF+ LP +LVIHLSRF+YDLTKKN TVITYPLILNI+LKNN+  KY+L+G+VNHTG LI
Sbjct: 909  LNFIMLPPVLVIHLSRFFYDLTKKNKTVITYPLILNIVLKNNEVAKYKLYGIVNHTGNLI 968

Query: 1001 SGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKN--LKISSSDVYVLFYERV 1058
            SGHYTSLVNK+  H+++  + +WYYFDDEVVKA+  HG   N   K+SS DVYVLFYER+
Sbjct: 969  SGHYTSLVNKEPGHNLNHNQQRWYYFDDEVVKAEGNHGDIDNGISKVSSKDVYVLFYERL 1028

Query: 1059 YD 1060
            Y+
Sbjct: 1029 YE 1030

 Score =  434 bits (1117), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 252/526 (47%), Positives = 329/526 (62%), Gaps = 62/526 (11%)

Query: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDAL 67
           FTPEYS+ELLRR+Q +Y EDIKHYYPQ           HTEYLFEL+L   H G   DAL
Sbjct: 10  FTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKDAL 69

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
           T+F++GCYY+FLI+PQS+QFQ+RNKSY IY+DLKK+YEN+ +MTNV+LMVK EI  +L++
Sbjct: 70  TSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETILEK 129

Query: 128 SVKHVVG-IEHRINKKRAFSVP-ANDLSGQVASLSLDTAGPQQHNIKVP----------- 174
           + +  +    +RI ++RA+SVP +NDL+ Q+ SLS+        N+K P           
Sbjct: 130 TAEREINETNNRIVRQRAYSVPDSNDLTEQLHSLSV-----SDRNLKSPPRKILMNNSFE 184

Query: 175 -----LTEDDMDQSSPVWTAPNLEPNDQLKLALL------PEVIP--------TSTFNEP 215
                +  ++ D SSP+WTAP LEP DQLKLA+L      P VIP        T    +P
Sbjct: 185 HSDSDVINEENDMSSPLWTAPPLEPTDQLKLAVLGNETLPPPVIPYEADIQERTDLLKQP 244

Query: 216 ERKSTSPARPSVL-LEDVPCTYH-----DND---ASTASLNPPFRDITADRSVTHRKDSY 266
                SP   S+   +D    +      DND       S N  FR+  ADRS THRKDSY
Sbjct: 245 SIPELSPTTTSLKNSKDFNSPFQSVISLDNDIPLVREPSNNRSFRETNADRSQTHRKDSY 304

Query: 267 HSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLI 326
           HSVYM+D ++  + N  +   ++  +IQ L  LQKQSIITA EL SILS   ER K+LLI
Sbjct: 305 HSVYMIDEESTDKLNQFY---DSTDYIQDLQRLQKQSIITAQELLSILSCPPERIKLLLI 361

Query: 327 DLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYI 386
           DLR  +R+A+NHIVAPN+V +DP+LLWD  T+TP+Y  + LE LL +NE F  R +F+Y+
Sbjct: 362 DLRWSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMETLEKLL-DNELFNRRHEFEYV 420

Query: 387 VYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHIS 446
           VYY+D+KT+M  +FDY F  FYL+ T     L + PT LLGGY+KWK  LH YA+EY I+
Sbjct: 421 VYYTDMKTYMHSDFDYNFTLFYLLTTETTNILRSTPTYLLGGYDKWKVFLHHYAKEYDIN 480

Query: 447 VEDYLYRPYSQKARAXXXXXXXXXXXXXXXXXKETPTK-VPEPPSW 491
           + DYLYRPY +  ++                 +ET  K V EPPSW
Sbjct: 481 IPDYLYRPYDKALKS-----------ETPEEFEETKNKHVLEPPSW 515

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  551 bits (1421), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 280/485 (57%), Positives = 347/485 (71%), Gaps = 52/485 (10%)

Query: 578  KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEP 637
            + YSIPTIE++ N YVSLSITGLRNLGNTCYINSM+QCLFA   FR LF+S  ++ +   
Sbjct: 588  RHYSIPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVSGKFEEFFNQ 647

Query: 638  LASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFL 697
              SNRP    +LS S ++LF KMY+NGGCSVVPT FLKV++ LRPDL+IPDDQQDTQEFL
Sbjct: 648  NYSNRP----QLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFL 703

Query: 698  MILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQ 757
            M+ LDRLHDELSNQ  VAN+YP+LLLY+   + V+  EYK WF+++VIGNG++PID IFQ
Sbjct: 704  MVTLDRLHDELSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPIDHIFQ 763

Query: 758  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDE 817
            GQ+EN L+C+RCG ++F+YSTFYVLSLAIP  S   S   R+  KRVKLEDCINMFT+DE
Sbjct: 764  GQIENILECQRCGNSSFSYSTFYVLSLAIPKPST--STFSRA--KRVKLEDCINMFTNDE 819

Query: 818  VLSGENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXR--FFTLHTGSKRRHLDI 875
            +LSGENAWDCP+CG              + +           +  FF +H+ SK      
Sbjct: 820  ILSGENAWDCPKCGSAVTDMGPNHLKKSKKKKKSELGEERRSKSGFFRIHSKSK------ 873

Query: 876  FGDSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKM 935
                                RS+SPF+MLG      S+  P A          D+K+K++
Sbjct: 874  --------------------RSKSPFRMLG------STKFPLA--------MEDWKSKEL 899

Query: 936  TTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNH 995
            +T KT+NF+ LP +L+IHLSRFYYDLTKKN+T++TYPL+LNIILKNN+T +YRL+ VVNH
Sbjct: 900  STKKTLNFIFLPPVLIIHLSRFYYDLTKKNDTIVTYPLVLNIILKNNETARYRLYAVVNH 959

Query: 996  TGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKN-LKISSSDVYVL 1053
            TG LISGHYTSLVNK+  H +D GR KWYYFDDEVVK + KHG+ D+  LK+SSSDVYVL
Sbjct: 960  TGNLISGHYTSLVNKEPMHKLDKGRQKWYYFDDEVVKEETKHGNIDQGILKVSSSDVYVL 1019

Query: 1054 FYERV 1058
            FYER+
Sbjct: 1020 FYERL 1024

 Score =  408 bits (1048), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 226/517 (43%), Positives = 314/517 (60%), Gaps = 57/517 (11%)

Query: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDAL 67
           FTPEYS+ELLR VQ+LY +DIKHY+ Q           HTEYLFE YL  +H     DAL
Sbjct: 8   FTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQDAL 67

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
           TAF+IGCYY++LI+PQS++FQTRNKSYSI+ DL KMY+N+ NMTNV+LMVK E+  +LD 
Sbjct: 68  TAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDSILDR 127

Query: 128 SVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGP-----QQHNIKVPLTEDDM-- 180
           + +     EH+  + RA+SVP  +   ++ +L++    P      Q   K     +DM  
Sbjct: 128 NAREFKEFEHQKARTRAYSVPDRNFESRLTNLNIHNENPLPLGDHQAASKSEQGREDMNN 187

Query: 181 ----DQSSPVWTAPNLEPNDQLKLALLPEVIPTS----TFNEP----------ERKSTSP 222
               + SSPVWTAP LEPNDQL++AL  +  P S      ++P           RK+ S 
Sbjct: 188 LQNDEDSSPVWTAPPLEPNDQLRIAL--DATPLSPSIMALDQPMATKELAISTSRKALS- 244

Query: 223 ARPSVL------LEDVPCTYHDNDASTASL--NPPFRDITADRSVTHRKDSYHSVYMVDS 274
            R S +      +E++  +  D ++    L  N    +   DR  THRKDSYHSVYM + 
Sbjct: 245 RRASAMGPTPYPIEELDISGQDGNSHYDELGFNKTLWNANVDRQTTHRKDSYHSVYMFEG 304

Query: 275 DNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRS 334
            +    +D   ++  D F Q L+ LQKQSIITAPELF+ILS+  E EK+LLID R+ +RS
Sbjct: 305 GS----DDHMPSISKD-FTQGLERLQKQSIITAPELFTILSSSEESEKLLLIDFRLSKRS 359

Query: 335 AVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDVKT 394
            VNHI+AP  V++DP  LWD KTNTP+     L+ ++K+   F  R  +DYIVYY+D+KT
Sbjct: 360 KVNHIIAPTTVEIDPRQLWDPKTNTPISNAATLDEIIKK-PAFLERGSYDYIVYYTDMKT 418

Query: 395 FMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISVEDYLYRP 454
           +MTI++DY+F  FYL+  S    L ++PT LLGGYEKWKK + +Y+ ++ +++++Y+YRP
Sbjct: 419 YMTIDYDYMFTLFYLLTASPTVNLRSLPTHLLGGYEKWKKIMKNYSVDHGVNMDNYIYRP 478

Query: 455 YSQKARAXXXXXXXXXXXXXXXXXKETPTKVPEPPSW 491
           Y +  +A                   +  + PE PSW
Sbjct: 479 YGESKKALPDT---------------SSKRTPELPSW 500

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1161

 Score =  549 bits (1414), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 280/496 (56%), Positives = 346/496 (69%), Gaps = 24/496 (4%)

Query: 580  YSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLA 639
            YSIPTIE+NPN+YVSLSITGLRNLGNTCYINSMIQCLFA K+FR LFIS  YK +L+ +A
Sbjct: 673  YSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVA 732

Query: 640  SNRPHHS--PKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFL 697
                 +   P +S +  +LF KMYLNGGCSVVP  FLK  + LRPD KIPDDQQDT EFL
Sbjct: 733  PKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFL 792

Query: 698  MILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQ 757
            M++LDRLHDELSNQ  V N+YP+L+LY+   L V N EYK WFDK+VIGNG+SPIDDIFQ
Sbjct: 793  MLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQ 852

Query: 758  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDE 817
            GQMENSL C+RCG+++FNYSTFYVLSLAIP  +   S   RS  KRV LE+C+NM+TSDE
Sbjct: 853  GQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATS--STFSRS--KRVSLEECLNMYTSDE 908

Query: 818  VLSGENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFG 877
            VLSGENAWDCP C                N+              +         L    
Sbjct: 909  VLSGENAWDCPNCCKITKDYKGMVEKTKRNKAARDTLSPGSSSSSSKKGKLFSFSLHHRH 968

Query: 878  DSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGD-------- 929
                E   +N + I    RS SPF++LGGS  +S   +  ++   D +   D        
Sbjct: 969  HHRSELGELNVSKI---NRSLSPFRVLGGSSSKSVRKSEDSHSRADVDAQRDIDELREMK 1025

Query: 930  -----FKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDT 984
                 +K+KK+ T+KT+NF+ +P+ L+IHLSRFYYDLTKKN+T++TYPLILNI+LK+N+ 
Sbjct: 1026 EEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEV 1085

Query: 985  MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKN-- 1042
            +KY+L+GVVNHTG LISGHYTS+V+K L+HS++     WYYFDDEVVK + +HG  K+  
Sbjct: 1086 VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGV 1145

Query: 1043 LKISSSDVYVLFYERV 1058
            +KISSSDVYVLFYER+
Sbjct: 1146 MKISSSDVYVLFYERI 1161

 Score =  221 bits (563), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/204 (53%), Positives = 145/204 (71%), Gaps = 3/204 (1%)

Query: 250 FRDITADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPE 309
           F+D T DRS+THRK+SYHSVYM++     + N      E++ +IQSL+ LQKQSIITAPE
Sbjct: 345 FKDFTPDRSLTHRKNSYHSVYMLEESESSQGN--LYYDESNAYIQSLERLQKQSIITAPE 402

Query: 310 LFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEH 369
           LFSILSN  + +++LLIDLR+  R   + I+APN V +DP +LW+  +  P+Y+   LE 
Sbjct: 403 LFSILSNEQQSKQLLLIDLRLDYRYNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELES 462

Query: 370 LLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGY 429
            L  N  F  RD+FDY+VY+SD+KTFM +NFDY F FFYL+ T++  PL  VPT LLGGY
Sbjct: 463 KLN-NPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGY 521

Query: 430 EKWKKTLHSYAQEYHISVEDYLYR 453
           EKWKK +  Y ++Y+I V DYL R
Sbjct: 522 EKWKKVILEYGKQYNICVTDYLVR 545

 Score =  158 bits (400), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 130/230 (56%), Gaps = 37/230 (16%)

Query: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDAL 67
           FTPE SDEL +RV  +Y +DI    PQ           HTE+L+ELYL  +   +  DAL
Sbjct: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
            +F+ GC+YV+L++PQS+QF TRN+++++Y+D++ +YE+++NMTNV+LMVK+E+ VVL E
Sbjct: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVL-E 132

Query: 128 SVKHVVGIEHRINKKRAFSVP-----ANDLSGQVASLSLDTAG-------------PQQH 169
           S      +  RI + RA+SVP       +L         +T G             P+  
Sbjct: 133 SQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPG 192

Query: 170 NIKV------------PLTEDDM------DQSSPVWTAPNLEPNDQLKLA 201
           N+ V             L  DD       DQSSP+W AP LEPNDQLKLA
Sbjct: 193 NVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLA 242

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  515 bits (1326), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 262/482 (54%), Positives = 322/482 (66%), Gaps = 43/482 (8%)

Query: 580  YSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLA 639
            +SIPTIER+PN +VSLSITGLRN+GNTCYINSM+QCLF    FR LF+   Y  YL P  
Sbjct: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629

Query: 640  SNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMI 699
            SN       +S   S+LF KMYLNGGCSVVP GFLK  + LRPD  IP DQQDTQEFL+ 
Sbjct: 630  SNTI-----ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLF 684

Query: 700  LLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ 759
            LLD LHDELS    VANDYPNLLL++ + L V N EY  WFD+ +  NG+SPIDDIFQGQ
Sbjct: 685  LLDTLHDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQ 744

Query: 760  MENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVL 819
            MENSL+C+RCG+T++NYSTFYVLSLAIP  +M   K    ++K ++LEDCIN++T DE+L
Sbjct: 745  MENSLKCQRCGFTSYNYSTFYVLSLAIP--AMPPPKTFSRSKKIIRLEDCINLYTQDELL 802

Query: 820  SGENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFGDS 879
            +GENAWDCP+CG                               T+    K+  L + GD 
Sbjct: 803  TGENAWDCPKCGTHSNSSDGSMNSDE-----------------TVDKKKKKNFLSVNGD- 844

Query: 880  NGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVK 939
                            +SRS F  L  S     S +PF +           K+KKMTT+K
Sbjct: 845  ---------------HKSRSKFFKLSSSRSGKRSLSPFKSNSVKPEKLH-IKSKKMTTIK 888

Query: 940  TINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTL 999
            T+NF+T+P ILVIHLSRF+YDLTKKN T+I YPLIL+++LKNN+  +YRL+G++NH G L
Sbjct: 889  TLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNL 948

Query: 1000 ISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISSSDVYVLFYER 1057
            +SGHYTSLVNK L H +  G+ KWYYFDDEVVK +  HG  D+ +  ISS DVYVLFYER
Sbjct: 949  VSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYER 1008

Query: 1058 VY 1059
            ++
Sbjct: 1009 IH 1010

 Score =  260 bits (664), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 176/486 (36%), Positives = 262/486 (53%), Gaps = 62/486 (12%)

Query: 5   TTLFTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPN 64
           + L+TPEYSDELL  VQ++Y +D+KHYY +             E LFE Y +S+   +  
Sbjct: 2   SRLYTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKYE 61

Query: 65  DALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVV 124
           D L  +VIG +YVFLIIP S+QF  RNKSYSIY+DLKK+Y++E+NM+NV+LMV  ++  V
Sbjct: 62  DCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSV 121

Query: 125 LDESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDMDQSS 184
           L+++++ +       ++KRAFSV    +  Q+ +L L+ A  +       + +D    +S
Sbjct: 122 LNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQKS------VDDDYKSFAS 175

Query: 185 PVWTAPNLEPNDQLKLALL-PEVIPTSTFNE--------PERKST------------SPA 223
             W AP L+PND+L LA+   +   +S+ N          E+  T            S  
Sbjct: 176 TEWKAPQLDPNDRLHLAIASSKTTESSSLNSISLDENLYKEQDDTDALDSVSDKLLGSIH 235

Query: 224 RPSVL-----LEDVP-----------CTYHDNDASTASLNPPFRDITADRSVTHRKDSYH 267
           +P +L     +  VP             Y  ND+S    N      + DRS THRKDSYH
Sbjct: 236 KPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENMD----SFDRSRTHRKDSYH 291

Query: 268 SVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLID 327
           SVY+        D  E LN  + G  +     Q+++ I    LFS+L +   RE +LLID
Sbjct: 292 SVYL-------GDELEDLNNISTGLARH----QQENTIDCFALFSLLKDAESRENLLLID 340

Query: 328 LRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIV 387
           LR+P+R   NH+VAPNL+ +DP LL+D +  T +   + L+ ++  N       ++D IV
Sbjct: 341 LRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVA-NPILDKISQYDNIV 399

Query: 388 YYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISV 447
           YY+D K+FM + F+Y  I F L+    K   T +P +LLGGYE+WK  L+   ++     
Sbjct: 400 YYTDYKSFMHLTFNYELILFELLF---KKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDK 456

Query: 448 EDYLYR 453
             +L+R
Sbjct: 457 SLFLFR 462

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
            (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  507 bits (1305), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 275/532 (51%), Positives = 342/532 (64%), Gaps = 54/532 (10%)

Query: 533  GSVPRKP-PIPAKQHVKKKQSNS---NEIIQRKRXXXXXXXXXXXXXXXKDYSIPTIERN 588
            GS  R P P+PAK+ V +   +S    +I                     + +IPTIE++
Sbjct: 487  GSYTRAPFPLPAKEMVIQSSLDSISRTQIPSHLESHYTHEKVLQNKMHHAEGTIPTIEQS 546

Query: 589  PNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPK 648
             N YV+LSITGLRN+GNTCYINSM+QCLFA + FR LF+S  Y++Y     SN PH   +
Sbjct: 547  SNEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYFSKRYSN-PH---Q 602

Query: 649  LSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 708
            LS   ++LF KMY+NGGCSVVPTGFLK  N LRPDLKIP +QQDTQEFL+ LL +LHDEL
Sbjct: 603  LSKYFNILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQLHDEL 662

Query: 709  SNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKR 768
            S   HVANDYPNLLL++ + L V   EY  WF+ N+  NGISPID IFQGQMEN L C+R
Sbjct: 663  SESNHVANDYPNLLLHDDESLAVDQKEYDKWFESNISENGISPIDAIFQGQMENGLLCQR 722

Query: 769  CGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCP 828
            CG++++NYS FYVLSLAIP     +S  G+  +K+++LEDCIN+FTSDE L+ ENAWDCP
Sbjct: 723  CGHSSYNYSMFYVLSLAIPA---SMSSFGQ--KKKMRLEDCINLFTSDEKLTNENAWDCP 777

Query: 829  RCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFGDSNGEGNNINN 888
            +CG                                     KR+ L    +SNG       
Sbjct: 778  KCGSAVSGNGPDGDK------------------------KKRKFLSTSDNSNG------- 806

Query: 889  TMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPK 948
                   RSRS F  L  S  RS S +PF    + S  +  +K+KK++T+KT+NFV+LP 
Sbjct: 807  -------RSRSRFFKL-RSKSRSRSVSPFHKPSSQSPASEKWKSKKLSTIKTLNFVSLPS 858

Query: 949  ILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLV 1008
            +L IHLSRF YDLT KNN VITYPL L+I+LKNN+ + YRL+ + NH G LISGHYTSLV
Sbjct: 859  VLTIHLSRFLYDLTNKNNKVITYPLTLSIVLKNNEVVNYRLYAIANHFGNLISGHYTSLV 918

Query: 1009 NKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISSSDVYVLFYERV 1058
            NKDL H +  GR KWYYFDDEV K D  HG+ D  +  +SSSDVYVLFYE++
Sbjct: 919  NKDLSHDLGNGRQKWYYFDDEVAKRDLNHGNIDAGITSVSSSDVYVLFYEKI 970

 Score =  291 bits (745), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 187/467 (40%), Positives = 260/467 (55%), Gaps = 45/467 (9%)

Query: 7   LFTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDA 66
           L++PEYS+ELL+ V+++Y +DI HYYP+           H EYLFE Y  S+   + ++ 
Sbjct: 4   LYSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQNSEL 63

Query: 67  LTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLD 126
           LTAFV+GC+Y++LIIP S+QF +R+KSY+IY DL+K Y++E NMTNV+LMV    GV+  
Sbjct: 64  LTAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMV---TGVI-- 118

Query: 127 ESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDMDQSSPV 186
           ESV        +I +KRA+SVP   LS ++ +L+L    P+  +      E D +  S +
Sbjct: 119 ESVSRDELESAKIMRKRAYSVPHKKLSDKMQALTL---SPETASSTNAGPETDNENDSTM 175

Query: 187 WTAPNLEPNDQLKLALLPE--VIPTSTFNEPERKSTSPARPSVLLEDVPCTYHDN----- 239
           WTAP LEPND LK+ L      + + + NE   K  +    S   +D+    H       
Sbjct: 176 WTAPELEPNDHLKVNLGGHNSSVSSRSSNEQAFKVGNEGNSSS-SDDIEMAVHSTTQDQR 234

Query: 240 ----------DASTASLNPPFRDI---TADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLN 286
                     +A   SL     DI     DR  THRK SYHSV+M          DE+  
Sbjct: 235 PRRSSVPIKVEAPQNSLQSTVDDIYCQKVDRYNTHRKGSYHSVHMT--------GDEY-- 284

Query: 287 VENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVK 346
              D F  +   LQKQSIIT  +L  IL +  E E++LL+DLR  +R   NHIVAPNLV 
Sbjct: 285 ---DSFTFNTARLQKQSIITCDKLLRILDSE-EAERLLLVDLRFIKRFETNHIVAPNLVN 340

Query: 347 VDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIF 406
           +DP  LWD      +  D  LE +L +N    +  +F +IVYY+D+KTFM ++FDY  +F
Sbjct: 341 LDPMNLWDFAKGRAIEGDAPLE-VLNKNHALKDLSQFKHIVYYTDMKTFMRLDFDYQLVF 399

Query: 407 FYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISVEDYLYR 453
           F ++ TS    ++  P  LLGGYE+WKK L    Q      E +L+R
Sbjct: 400 FQMLYTSNWR-ISCTPKVLLGGYEQWKKFLAKVPQSRVPIKEAFLFR 445

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 974

 Score =  504 bits (1298), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 263/484 (54%), Positives = 328/484 (67%), Gaps = 52/484 (10%)

Query: 578  KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEP 637
            K  +IPTIE++PN YV+LSITGLRN+G TCY+NSM+QCLFA K FR LF+S+ Y++Y   
Sbjct: 536  KHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF-- 593

Query: 638  LASNRPHHSP-KLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEF 696
               +R + +P +LS   ++LF KMY+NGGCSVVPTGFLK  N LRPD +IP DQQDTQEF
Sbjct: 594  ---SRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEF 650

Query: 697  LMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIF 756
            L+ LL +LHDELS    VANDYP LLL++   L V   EY  WF+K++  NGISPID+IF
Sbjct: 651  LLFLLSQLHDELSESNRVANDYPGLLLHDDKKLDVDQKEYDTWFEKHISENGISPIDNIF 710

Query: 757  QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSD 816
            QGQMEN L C+RCG+++FNYS FYVLSLAIP+ +   S+      K+V+LEDCIN+FTSD
Sbjct: 711  QGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQ-----RKKVRLEDCINLFTSD 765

Query: 817  EVLSGENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIF 876
            E L+ ENAWDCP+CG              E E                    K++   + 
Sbjct: 766  EQLTNENAWDCPKCGTSASGTGP------EEE-------------------KKKKRFLLN 800

Query: 877  GDSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMT 936
             D+   GN           RSR  FK+   S  RS S +PF    +   N    K+KK+T
Sbjct: 801  PDTRASGN-----------RSRF-FKL--RSKSRSRSVSPFRKQSSQQQNLEKLKSKKLT 846

Query: 937  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHT 996
            T+KT+NF++LP +L IHLSRF+YDLTKKNN VITYPLIL+I+LKN   MKYRL+ + NH 
Sbjct: 847  TIKTLNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHF 906

Query: 997  GTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISSSDVYVLF 1054
            G LISGHYTSLVNKDL+H ++ G+ KWYYFDDE VK D  HG  D  +  ISSSDVYVLF
Sbjct: 907  GNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLF 966

Query: 1055 YERV 1058
            YE++
Sbjct: 967  YEKI 970

 Score =  318 bits (815), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 191/466 (40%), Positives = 268/466 (57%), Gaps = 63/466 (13%)

Query: 7   LFTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDA 66
           L++PEYS+ELL+ V+D+Y +DI HY+P+           H EYLFE Y  ++   +  D 
Sbjct: 4   LYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDL 63

Query: 67  LTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLD 126
           LTAFV GC+Y++LIIP S+QFQ+R+KSY+IY DLKK Y++E NMTNV+LMV + I  +  
Sbjct: 64  LTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSK 123

Query: 127 ESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDMDQSSPV 186
           + V+       RI +KRA+SVP       + +LS   +   + +     TE + +  + +
Sbjct: 124 DEVETA-----RIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAP---TETEFENGTTM 175

Query: 187 WTAPNLEPNDQLKLAL---------------LPEVIPTS---TFNEPE-----------R 217
           WTAP LEPND LK++L                P++   S    F EPE           R
Sbjct: 176 WTAPELEPNDHLKVSLGSHHSSTSSASSNEQFPKIHNESHSFPFEEPELHALSLGGSRTR 235

Query: 218 KSTSPARPSVLLEDVPCTYHDNDASTASLNPPFRDITADRSVTHRKDSYHSVYMVDSDNL 277
           +S+ PAR S  L            + AS +  F D   +R  THRKDSYHSV+M      
Sbjct: 236 RSSVPARASRKL----------GTTQASNSSDFNDQKINRYATHRKDSYHSVHM------ 279

Query: 278 KEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVN 337
              ND++     D F  +L  LQKQS++T  +L  IL ++ +R+ +LLIDLR  +R   N
Sbjct: 280 --SNDDY-----DAFTFNLARLQKQSVVTCDQLMRILCSQ-DRDNLLLIDLRFSKRFQTN 331

Query: 338 HIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMT 397
           HI+APNL+ VDP LLW++   +P+  D  LE  L +N+    R +F+YIVYY+D+KTFM 
Sbjct: 332 HILAPNLLNVDPTLLWNQNKGSPIESDVQLERTL-DNKLLNARSQFEYIVYYTDMKTFMK 390

Query: 398 INFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEY 443
           ++FDY  +FF L+ TS K  L   P  LLGGYE+WKK L   +Q Y
Sbjct: 391 LDFDYQLVFFQLIYTSNKN-LKCTPKVLLGGYEQWKKFLSKSSQAY 435

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] {ON}
            complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  480 bits (1235), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 249/453 (54%), Positives = 305/453 (67%), Gaps = 54/453 (11%)

Query: 612  MIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPT 671
            M+QCLF  K  R LFISS Y+ YL    S R   S  LS S S+LF KMYLNGGCSVVPT
Sbjct: 1    MVQCLFGTKLLRDLFISSKYEKYL----SKRIDRSSNLSRSFSILFKKMYLNGGCSVVPT 56

Query: 672  GFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKV 731
             FLK  NQLRPDL+IPDDQQDTQEFLM++LDRLHDELSNQ+ V  DYP+L+LY+   L+V
Sbjct: 57   SFLKTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRV 116

Query: 732  SNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSM 791
            +N EY  WFDK +  NG+SPID IFQGQ+EN+L C+RCG+ ++NYSTFYVLSLAIP    
Sbjct: 117  NNKEYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIP---- 172

Query: 792  KLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPXXXXXXXXXXXXLENEXXX 851
            K S    S  KRVKLEDCINMFT+DEVLSGENAWDC  CG                    
Sbjct: 173  KPSSGTFSRSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSS------------------ 214

Query: 852  XXXXXXXXRFFTLHTGSKRRHLDIFGDSNGEGNNINNTMIFERERSRSP--FKMLGGSGK 909
                       ++H   +R+        NGE          E++RSR    F +   +G+
Sbjct: 215  -----------SVHNVEQRKDKTT---GNGE----------EKKRSRKSRLFLLPNINGR 250

Query: 910  RSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVI 969
             S S +PF    +        K+KK+ T+K++NF++LP  LVIHLSRFYYDL+KKN T++
Sbjct: 251  SSRSISPFRKSASPRPPHEKLKHKKLVTIKSMNFISLPPTLVIHLSRFYYDLSKKNETIV 310

Query: 970  TYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE 1029
            TYPLILNI+L NN+T KYRL+G+VNHTG LISGHYT+LVNK+  H +   + KWYYFDDE
Sbjct: 311  TYPLILNIVLNNNETAKYRLYGIVNHTGNLISGHYTTLVNKEKNHELKKDKQKWYYFDDE 370

Query: 1030 VVKADKKHGS--DKNLKISSSDVYVLFYERVYD 1060
            VVK +  HG+  +  +K+SSS VYVLFYERVY+
Sbjct: 371  VVKEENNHGNIDEGVIKVSSSQVYVLFYERVYN 403

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  489 bits (1258), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 255/480 (53%), Positives = 323/480 (67%), Gaps = 47/480 (9%)

Query: 582  IPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASN 641
            +PTIE+NPN YVSLSITGLRNLGNTCYI+SM+QCLFA  T R LFI++ Y++Y+    ++
Sbjct: 609  VPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYINHKVTD 668

Query: 642  RPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILL 701
            + +    LS S S+LF KMYLNGGCSVVP  FLK  NQLRPDLKIPDDQQDTQEFLM++L
Sbjct: 669  KIN----LSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVL 724

Query: 702  DRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQME 761
            DRLHDELS +  V NDY NLLLY+A+ + V  ++YK WF+ + +  G+SPIDDIFQGQ+E
Sbjct: 725  DRLHDELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIFQGQIE 784

Query: 762  NSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSG 821
            NS+ C+RCGY++FNYS+FYVLSLAIP    K+S +  S   RVKLEDCINMFT DEVLSG
Sbjct: 785  NSINCQRCGYSSFNYSSFYVLSLAIP----KISVMSFSRTNRVKLEDCINMFTRDEVLSG 840

Query: 822  ENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFGDSNG 881
            ENAWDC RCG                               T H    + H     D + 
Sbjct: 841  ENAWDCSRCGSQSDNFVK-----------------------TSHNDHHKEHTSETTDDSK 877

Query: 882  EGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTI 941
            +             R    F +       S S +PF    +  ++    K+KKM T+K++
Sbjct: 878  QN------------RKSRLFLLPKKYNPTSRSLSPFGRHSSHKSSEKW-KSKKMETIKSL 924

Query: 942  NFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLI- 1000
            NF+ +PKILVIHLSRF+YD++KKN TV+ YPLILNI+LKN +  KYRL+ +VNH G  + 
Sbjct: 925  NFIKMPKILVIHLSRFFYDMSKKNETVVAYPLILNIVLKNEEVCKYRLYAIVNHMGNQVA 984

Query: 1001 SGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISSSDVYVLFYERV 1058
            SGHYT+LVNK+  H +     +WYYFDDEVVK +  HG+ D+ + K+SSS VYVLFYE++
Sbjct: 985  SGHYTTLVNKNRNHDLGKNEQQWYYFDDEVVKHELNHGNIDEGVNKVSSSHVYVLFYEKI 1044

 Score =  375 bits (963), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/494 (42%), Positives = 301/494 (60%), Gaps = 58/494 (11%)

Query: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDAL 67
           FTPEYS+ELL+RV D Y+ +IK ++PQ           HT YL E YLD +H  + ++ L
Sbjct: 7   FTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYDECL 66

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
           +A+++GC+Y++LIIP S QFQ RNKS+ IY +LK +Y+N+ NMTNV+ +VK E+  +LDE
Sbjct: 67  SAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSILDE 126

Query: 128 SVKHVVGIEHRINKKRAFSVPA----------------NDLSGQVASL------------ 159
           S+  + GIE  I + RA+S PA                N  +G+  S             
Sbjct: 127 SILELEGIEKVIKRDRAYSSPAPKVNNISKFSKLSINDNHHNGETISTDNKLQSHFPQTP 186

Query: 160 ----SLDTAGPQQHNIKVPLTEDDMDQSSPVWTAPNLEPNDQLKLALLP------EVIPT 209
               S ++ G   +      + ++ + ++P+W  P+LEPNDQLKLAL        E I  
Sbjct: 187 NYSNSNNSTGSFNNVKSNSNSSEEAEDTAPIWHIPSLEPNDQLKLALEQPVEFSDEEIDA 246

Query: 210 STFNEPERKSTSPARP----------SVLLEDVPCTYHDNDASTASLNPPFRDITADRSV 259
           S+ +EP  +  SP  P          S  L  VP  +++ND    + +    D+  DRSV
Sbjct: 247 SSISEPLGRRYSPLSPYQKKRNSSISSAFL--VPFPHNENDKVHDN-SMLIEDLPVDRSV 303

Query: 260 THRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVE 319
           THRKDSYHSVYM + D  + D+     + N  +IQS+D LQKQ++IT  EL+SILS+  E
Sbjct: 304 THRKDSYHSVYMNNQDE-ESDSGAHYGLSN-SYIQSMDRLQKQNVITCSELYSILSSPTE 361

Query: 320 REKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENEN--F 377
           R+K+LL+DLRIP+ S  NHI+AP+++K+DPNLLW+++T TP+Y     E L+K   N   
Sbjct: 362 RQKLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNEETQTPIYS---FEELVKRINNPLI 418

Query: 378 ANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLH 437
           +  +KFDYIVYYSD++TFM  ++D+ F FFYL+L+++   L  VPT LLGG+EKWKK L 
Sbjct: 419 SEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYLLLSTKSLNLKQVPTNLLGGFEKWKKVLK 478

Query: 438 SYAQEYHISVEDYL 451
           +Y +EY I +  ++
Sbjct: 479 TYNKEYGIDITPFI 492

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1212

 Score =  488 bits (1255), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 254/493 (51%), Positives = 327/493 (66%), Gaps = 26/493 (5%)

Query: 578  KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLE- 636
            + +SIP +E++ N YVSLSITGLRNLGNTCYINSM+QCLFA   FR +F+S  Y+ Y++ 
Sbjct: 733  RHFSIPILEKSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEKYMDH 792

Query: 637  PLASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEF 696
             + +N+     +LS S +MLF KMY+NGGCSVVPTGFLK  N LRPDL+IPDDQQDTQEF
Sbjct: 793  DIPTNQ-----RLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEF 847

Query: 697  LMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIF 756
            LM++LDRLHDELSNQ  V  DYP+L+ Y+ D ++V   +Y  W++++V  NG+SPID +F
Sbjct: 848  LMLILDRLHDELSNQHEVKLDYPDLVDYDVDDMEVQPGQYIKWYNESVKSNGLSPIDHVF 907

Query: 757  QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSD 816
            QGQ E+ L C+RCG ++F YSTFY+LSLAIP  S   +  G+   KRV LEDCI MFT+D
Sbjct: 908  QGQTEDGLVCQRCGCSSFTYSTFYILSLAIPKAST--NAFGKI--KRVNLEDCIKMFTND 963

Query: 817  EVLSGENAWDCPRCGPXXXXXXXXXXXXLENE--------XXXXXXXXXXXRFFTLHTGS 868
            E+LS ENAWDCPRCG              +                     RFF L+   
Sbjct: 964  EILSDENAWDCPRCGSAAPKQEPIHRHREKKHIHDISPPPRSPSSPEPRSKRFFLLNAPR 1023

Query: 869  K-RRHLDIFGDSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNT 927
            +  R         G  ++ +     +   SRS  + L    +  + +TP    G   + +
Sbjct: 1024 EVVRSYSPLRILPGGRHSFDKPRELKEHYSRSADENLSDDKENQNHTTPNGRAGRVRHYS 1083

Query: 928  GDFKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKY 987
            G     KM T+K++NFV  P+ILVIHLSRFYYDLTKKNNTVITYPL LNI LKN +  +Y
Sbjct: 1084 G-----KMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNISLKNGEVARY 1138

Query: 988  RLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKN--LKI 1045
            +L+G+VNHTGTL+SGHYTSLVNKD +H +   + KW+YFDDE+VK +K HG  +     I
Sbjct: 1139 KLYGLVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHGDIEGGVTSI 1198

Query: 1046 SSSDVYVLFYERV 1058
            SSS VYVLFY+R+
Sbjct: 1199 SSSHVYVLFYQRI 1211

 Score =  235 bits (600), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 113/199 (56%), Positives = 148/199 (74%), Gaps = 3/199 (1%)

Query: 255 ADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSIL 314
            DRSVTHRKDSYHSVYM +  N  EDN+     E   +I+SL+ +QKQ +IT PELFS+L
Sbjct: 446 VDRSVTHRKDSYHSVYMFNDSN--EDNNNHGYDETSEYIESLEHIQKQDVITCPELFSLL 503

Query: 315 SNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKEN 374
           SN VEREKVLLIDLR P+R   NHIVAPN+++++P LLWD  TNTPVY  + LE ++  N
Sbjct: 504 SNNVEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTAEKLEQIIN-N 562

Query: 375 ENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKK 434
             F+ RD F Y+VYYSD+KT+M + FDY+F  FYL++T    P+ ++PT+LLGGYEKW K
Sbjct: 563 PLFSKRDTFKYVVYYSDMKTYMNMTFDYLFTLFYLLVTCTSKPVKSLPTSLLGGYEKWYK 622

Query: 435 TLHSYAQEYHISVEDYLYR 453
            ++SY  +Y I++ DY+YR
Sbjct: 623 VINSYVNQYSITMNDYVYR 641

 Score =  131 bits (329), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/148 (44%), Positives = 96/148 (64%), Gaps = 7/148 (4%)

Query: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDAL 67
           +TPEYSDELL+ VQ++Y+ + K +YPQ           H+ +LFE Y  S+     +DAL
Sbjct: 10  YTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDAL 69

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLD- 126
           +AF++G +Y++ IIPQS QF T+N+ Y +Y +LK +YE+E+NMTNV+ MVK EI  +LD 
Sbjct: 70  SAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILDS 129

Query: 127 ------ESVKHVVGIEHRINKKRAFSVP 148
                 ES  ++      I ++RAFSVP
Sbjct: 130 NYKSQNESSNNLFVDSKFIRRERAFSVP 157

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 20/24 (83%)

Query: 178 DDMDQSSPVWTAPNLEPNDQLKLA 201
           +D D+SSP+WTAP L+  +QLKLA
Sbjct: 260 EDTDESSPLWTAPQLDSKNQLKLA 283

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  480 bits (1235), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 261/482 (54%), Positives = 337/482 (69%), Gaps = 44/482 (9%)

Query: 580  YSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLA 639
            +S+PTIE+NPN Y++LSITGLRN+ NTCYINSM+QCLF+   FR LF+S+ Y  YL+  +
Sbjct: 728  FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLK--S 785

Query: 640  SNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMI 699
            SN  +    +S S  MLF KMY+NGGCSVVP+GFLK+ + L+PDL+IP  QQDTQEFL+ 
Sbjct: 786  SNMDN----MSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLLF 841

Query: 700  LLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ 759
            LLDRL DELS    V NDYP LLL+ + VLKV++ EY  WFD+N   NG+SPID IFQGQ
Sbjct: 842  LLDRLRDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQ 901

Query: 760  MENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVL 819
            +E+ L C+RC +++++YSTFYVLSLA+P    K    G++  K+++LEDCIN FT DEVL
Sbjct: 902  IEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSK--AFGKA--KKLRLEDCINFFTCDEVL 957

Query: 820  SGENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFGDS 879
            +G+N WDCP+CG             + +E                   SKR++    G  
Sbjct: 958  TGQNPWDCPKCG-----VNSSGDRQMNSEK------------------SKRKNKFFMGSE 994

Query: 880  NGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFK-NKKMTTV 938
            N    N N      R+     FK+  GS  RS SS+PF +G   S  T + + NKK+ T+
Sbjct: 995  NANSANSN------RDHLPRLFKI--GSKSRSRSSSPFISGPKSSGKTHEKRYNKKLATI 1046

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGT 998
            K++NF+TLP+IL+IHLSRF YDLTKKNNTV+TYPLILNI+LKNN+  KYRL+  +NH GT
Sbjct: 1047 KSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGT 1106

Query: 999  LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISSSDVYVLFYE 1056
            LISGHYTSLVNKDL+H +  G+ KWYYFDDE+VK D  HG+ D+ +  +SSSDVY+LFYE
Sbjct: 1107 LISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYE 1166

Query: 1057 RV 1058
            R+
Sbjct: 1167 RI 1168

 Score =  130 bits (328), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 112/196 (57%), Gaps = 4/196 (2%)

Query: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDAL 67
           + PEYS EL   VQ+ Y + ++  YP+               LFE Y D +  G+  + L
Sbjct: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEI-GVVLD 126
            A+VIG +Y++LIIPQS++F TRN SYS+YTDL+K YE E NMTNVV MV +++  V+L 
Sbjct: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLR 124

Query: 127 ESVKHVVGIEHRINKKRAFSVPANDL---SGQVASLSLDTAGPQQHNIKVPLTEDDMDQS 183
           ++ +     + ++ +KRA+SVP   +   S  +  L++D      H+       +   Q+
Sbjct: 125 QTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEVAVQA 184

Query: 184 SPVWTAPNLEPNDQLK 199
             +W+AP LE ND L+
Sbjct: 185 DTLWSAPKLEENDLLR 200

 Score = 98.6 bits (244), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 89/158 (56%), Gaps = 5/158 (3%)

Query: 296 LDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDK 355
           L  L + S I   +L  IL + ++ ++VL IDLR P+R  +NHIVA +L+ +DP LLWD 
Sbjct: 441 LTRLYETSSIKCSDLMIILESDIQ-DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDT 499

Query: 356 KTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQK 415
           + + P+   +  E  L +N  F  R +F Y+V Y+D  T M ++F +   FF L+   + 
Sbjct: 500 ERSAPITSVNEFERRL-DNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKP 558

Query: 416 TPLTTVPTALLGGYEKWKKTLHSYAQEYHISVEDYLYR 453
             LT     L GGY++W+  L +  +  H  + D+++R
Sbjct: 559 RLLT---KCLQGGYDQWRLYLKTNTKSIHAKISDFMWR 593

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  487 bits (1254), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 252/486 (51%), Positives = 324/486 (66%), Gaps = 60/486 (12%)

Query: 580  YSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLA 639
            +SIPTIE + N YV+LSITGLRN+ NTCYINSM+QCLF+   FR LF+S+ Y +YL+   
Sbjct: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLK--- 1143

Query: 640  SNRPHHSPKL---SNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEF 696
                  SP++   S S  MLF KMY+NGGCSVVP+GFLK+ N L+PDL+IP  QQDTQEF
Sbjct: 1144 ------SPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEF 1197

Query: 697  LMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIF 756
            L+ LLD+LHDELS+ + V+NDY +LLL++   L V + +Y  WFD+N+  NG+SPIDD+F
Sbjct: 1198 LLFLLDKLHDELSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLF 1257

Query: 757  QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSD 816
            QGQMEN L C+RCGY+++ YSTFYVLSLA+P    K    G++  K+++LEDCIN FT D
Sbjct: 1258 QGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAK--AFGKT--KKLRLEDCINFFTCD 1313

Query: 817  EVLSGENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIF 876
            EVLS +NAWDCPRC                              + +     KR+    F
Sbjct: 1314 EVLSDQNAWDCPRCC-------------------------SPSDYMSYDHKGKRKISTSF 1348

Query: 877  GDSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMT 936
               NG GN+           SRS     G   +  S +  F++  +D        N K  
Sbjct: 1349 ESLNG-GNS-----------SRSKLFKFGYKMRSRSEAPKFSSKLSD-----KVSNGKPA 1391

Query: 937  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHT 996
            TVK++NF+T+P+ILVIHLSRF YDLTKKNN V++YPLILNI+LKN++  K+RL+ +VNH 
Sbjct: 1392 TVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKFRLYSIVNHF 1451

Query: 997  GTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKN--LKISSSDVYVLF 1054
            GTLISGHYTSLVNK+L H +  G+ KWYYFDDE+VK D  HG   N    +SSS+VYVLF
Sbjct: 1452 GTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLF 1511

Query: 1055 YERVYD 1060
            YER++D
Sbjct: 1512 YERIFD 1517

 Score =  210 bits (534), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 159/482 (32%), Positives = 247/482 (51%), Gaps = 53/482 (10%)

Query: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDAL 67
           + PEYS EL + V+++Y E+++  Y +           H  YL E Y + +  G+    +
Sbjct: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGI 64

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
           TA+V+G +Y++LIIPQS++F TRN SYSIY DLK+ YE++ NM NV+L+V  ++G V+  
Sbjct: 65  TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQL 124

Query: 128 SVKHVVGIEHR---INKKRAFSVPAND---LSGQVASLSLDTAGPQQHNIKVPLTE---- 177
            +      ++      +KRA+S+ + D   L+  +  LS++ +  +   +    TE    
Sbjct: 125 YLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQGAF 184

Query: 178 ----DDMDQSSPVWTAPNLEPNDQLKLAL----LPEVIPTSTFNEPER--KSTSPARPSV 227
                D +    VW+APNLEP+DQLKLA+     P +  TS     +   ++ S A  SV
Sbjct: 185 GQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNSAAEFSV 244

Query: 228 LLEDVPCTYHDN--------DASTASLNPPFRDI-----TADRSVTHRKDSYHSVYMVDS 274
           L E+                D+S    N     I       DR  TH +D  + +     
Sbjct: 245 LDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDVLDRFYTHGQDLRYPIC---- 300

Query: 275 DNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRS 334
                 ND  +  EN   +     L + S I   +L S L++  ER  +LLIDLR+P+R 
Sbjct: 301 ------NDGVVPCENSSIMW----LYESSSIKCLDLLSKLTSS-ERSSMLLIDLRLPKRY 349

Query: 335 AVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDVKT 394
             +HI+A N++ +DP LLWD +   PV     LE L+ +N  F +R +F  IV Y+D  T
Sbjct: 350 EYSHILAENVINIDPELLWDDEKGAPVSSVKELE-LVIDNHLFRSRRQFATIVCYTDNYT 408

Query: 395 FMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISVEDYLY-R 453
           +M I+FD+VF+ F L+   +  P   + T L GGYE+WK  L    +   I + D+L+ R
Sbjct: 409 YMQIDFDFVFLLFRLLYLGR--PQLVLKT-LSGGYEQWKSFLKELKRTESIILSDFLWKR 465

Query: 454 PY 455
           P+
Sbjct: 466 PH 467

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
            UBP11Ubiquitin-specific protease that cleaves ubiquitin
            from ubiquitinated proteins
          Length = 717

 Score =  423 bits (1087), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 223/488 (45%), Positives = 312/488 (63%), Gaps = 65/488 (13%)

Query: 578  KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEP 637
            K Y++P IE + ++   LSITGL+N  NTCYINS+IQCLF    FR LF++  Y+ +L  
Sbjct: 278  KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLN- 336

Query: 638  LASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFL 697
              +N+     +LS S+ +LF KMYLNGG +++P  FLK+  +LRPDL IPDDQQDTQEFL
Sbjct: 337  --TNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFL 394

Query: 698  MILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQ 757
            +I+L R+H+ELSN+ +V   YP+L+ Y+A+ L+V+ ++Y+ W+++NVI +G+SPID I++
Sbjct: 395  LIVLARIHEELSNE-NVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYR 453

Query: 758  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLG-RSTEKRVKLEDCINMFTSD 816
            GQ+EN L+C+RCG ++++YSTFYVLSLAIP    KLS     S  +++KLEDCIN+FT D
Sbjct: 454  GQLENILKCQRCGNSSYSYSTFYVLSLAIP----KLSLYSFTSKSRKIKLEDCINLFTGD 509

Query: 817  EVLSGENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIF 876
            E LSG+NAWDCP C                                     S+++   IF
Sbjct: 510  EELSGDNAWDCPNCRITDSKSKKE------------------------EITSQKKKSTIF 545

Query: 877  GDSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMT 936
            G                R RS+SP                  +  + + N     +KK+T
Sbjct: 546  G-------------FHSRSRSKSP----------HHHHHHHHSSDDSTKNAKKRNSKKLT 582

Query: 937  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHT 996
            T+K+++F+ LP ILVIHLSRFYYDLTKKN+TVITYPLILNIILKN   ++Y+L+G VNH+
Sbjct: 583  TIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHS 642

Query: 997  GTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKN------LKISSSDV 1050
            G LI+GHYTS+VNK+  H + + R  W  FDD+ +   ++H  D+N       ++SS +V
Sbjct: 643  GNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYI---QQHRKDRNNFEAGKTEMSSDEV 699

Query: 1051 YVLFYERV 1058
            YVLFYER+
Sbjct: 700  YVLFYERM 707

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 107/194 (55%), Gaps = 9/194 (4%)

Query: 14  DELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDALTAFVIG 73
           D++L  V+ +Y  DIK +Y Q           H  +LF +YL  +   +  +ALTAF+IG
Sbjct: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65

Query: 74  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHVV 133
           CYY++LIIPQSLQFQTRN  YS Y  LK  Y++E  M  V+ +V+ E  V++D  +    
Sbjct: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125

Query: 134 GIEHRINKKRAFSVPANDLSGQVASLSL-DTAGPQQHNIKVPLT--------EDDMDQSS 184
           GI   I +KRA+S+P   L   +ASLS+ +      H I   LT        ED + +S+
Sbjct: 126 GICRTIKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDIVRESN 185

Query: 185 PVWTAPNLEPNDQL 198
            + ++  LE   ++
Sbjct: 186 QIASSNKLEAGSEV 199

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
            YKR098C (REAL)
          Length = 712

 Score =  421 bits (1083), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 222/482 (46%), Positives = 305/482 (63%), Gaps = 62/482 (12%)

Query: 583  PTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNR 642
            PTIE +  +   LSITGL+N  NTCYINS+IQCLF +  FR LF++  Y+ +L      +
Sbjct: 277  PTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFL------K 330

Query: 643  PHHSPK---LSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMI 699
                PK   LS S+  LF KMY NGG ++VP GFLK+  +LRPDL IPDDQQDTQEFL+I
Sbjct: 331  TEEYPKEVQLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLI 390

Query: 700  LLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ 759
            +L R+H+ELSN+ +V   Y +L+ Y+ + L+V+  +Y+ W+++ ++ +G+SPID IF+GQ
Sbjct: 391  ILARIHEELSNE-NVTKYYCDLVSYDTNALQVNPIKYQKWYEETILADGLSPIDHIFRGQ 449

Query: 760  MENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVL 819
            MEN L+C+RCG ++F+YSTFYVLSLAIP  S+       S  K++KLEDCIN+FTSDE L
Sbjct: 450  MENILKCQRCGNSSFSYSTFYVLSLAIPKNSV---HSFTSKSKKIKLEDCINLFTSDEEL 506

Query: 820  SGENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFGDS 879
            +G+NAWDCP C                             +  T    S+++   +F   
Sbjct: 507  TGDNAWDCPEC------------------------RIDDSKLKTGENSSQKKRSPLFS-- 540

Query: 880  NGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVK 939
                          R RS+SP          S ++T          N+  +K+K++TT+K
Sbjct: 541  -----------FHSRSRSKSPHHHHHYHHHGSDNTT---------KNSNKWKSKRLTTIK 580

Query: 940  TINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTL 999
            +++F+ LP ILVIHLSRFYYDLTKKNN VITYPLILNIILKNN  ++Y+L+G VNH+G L
Sbjct: 581  SLDFIFLPPILVIHLSRFYYDLTKKNNAVITYPLILNIILKNNKVVRYKLYGTVNHSGNL 640

Query: 1000 ISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV---KADKKHGSDKNLKISSSDVYVLFYE 1056
            I+GHYTS+VNK+  H + + +  W  FDD+ +     D+        K+SSS+VYVLFYE
Sbjct: 641  ITGHYTSVVNKERSHEIGLNKQVWVTFDDDFIIQHHKDRDGFEAGKTKMSSSEVYVLFYE 700

Query: 1057 RV 1058
            R+
Sbjct: 701  RM 702

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 91/148 (61%)

Query: 14  DELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDALTAFVIG 73
           D++L  V+D+Y  DIK +Y Q           HT +LF++YL  +   R  +ALTAF+IG
Sbjct: 6   DQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALTAFIIG 65

Query: 74  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHVV 133
            YY++LIIPQSLQFQTR+  YS Y  LK  Y++E  M+ V+ +V+ E   ++D+ +    
Sbjct: 66  GYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQYLSDSN 125

Query: 134 GIEHRINKKRAFSVPANDLSGQVASLSL 161
            I   I +KRA+S+P   L   +ASLS+
Sbjct: 126 RITVTITRKRAYSLPLRPLPVHMASLSI 153

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
            YKR098C (REAL)
          Length = 721

 Score =  421 bits (1083), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 222/480 (46%), Positives = 306/480 (63%), Gaps = 58/480 (12%)

Query: 582  IPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASN 641
            +PTIE + ++   LSITGL+N  NTCYINS+IQCLF    FR LF++  Y+ +L+   ++
Sbjct: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQ---TD 343

Query: 642  RPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILL 701
            +     +LS S+ +LF KMYLNGG ++ P GFLK+  +LRPDL IPDDQQDTQEFL+I+L
Sbjct: 344  KYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIIL 403

Query: 702  DRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQME 761
             RLH+ELSN   V   YP+L+ Y+A+  +V+ ++Y+ W++ +V+ +G+SPID IF+GQME
Sbjct: 404  ARLHEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQME 462

Query: 762  NSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSG 821
            N L+C+RCG ++ +YSTFYVLSLAIP  S+       S  K++KLEDCIN+FTSDE LSG
Sbjct: 463  NILKCQRCGNSSHSYSTFYVLSLAIPKISL---YSFTSKSKKIKLEDCINLFTSDEELSG 519

Query: 822  ENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFGDSNG 881
            +N+WDCP CG             L+ +            FF+ H+               
Sbjct: 520  DNSWDCPNCG----------TTDLKTKINESTSQKKKSTFFSFHS--------------- 554

Query: 882  EGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTI 941
                        R RS+SP                  +  N   ++  + ++K+TTVK+ 
Sbjct: 555  ------------RSRSKSP---------HHHHHHHHHSHDNTEKHSKKWNSRKLTTVKSS 593

Query: 942  NFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLIS 1001
            +F+ LP ILVIHLSRFYYDLT+KNNTVITYPLILN+ILKNN  ++Y+L+G VNH G L++
Sbjct: 594  DFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGTVNHIGNLVN 653

Query: 1002 GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSD---KNLKISSSDVYVLFYERV 1058
            GHYTS VNK+  H + + R  W  FDD+ +K  + H  D      ++SSS+VYVLFYER+
Sbjct: 654  GHYTSDVNKEKNHEIGLNRQVWITFDDDYIK--QHHHDDFEAGKTEVSSSEVYVLFYERM 711

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 90/148 (60%)

Query: 14  DELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDALTAFVIG 73
           D+++  V+++Y  DIK +Y Q           H  +LFE+YL      +  +ALTAF+IG
Sbjct: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65

Query: 74  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHVV 133
            YY++L+IPQSLQFQTRN  YS Y  LK  Y++E  M+ V+ +VK+E  +++D  +    
Sbjct: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125

Query: 134 GIEHRINKKRAFSVPANDLSGQVASLSL 161
            I   I +KRA+S+P   L   +ASLS+
Sbjct: 126 RISRTITRKRAYSLPLRPLPVHMASLSI 153

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
            YKR098C (REAL)
          Length = 724

 Score =  416 bits (1068), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/482 (47%), Positives = 300/482 (62%), Gaps = 50/482 (10%)

Query: 578  KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEP 637
            K + +P IE + N+   LSITGLRN  NTCYINSM+QCLF+   FR LF++  YK +LE 
Sbjct: 276  KTFKLPVIENSDNLLSELSITGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLE- 334

Query: 638  LASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFL 697
              + +     +LS+S+ +LF KMYLNGG +++P GFLKV  +LRPDL IPDDQQDTQEFL
Sbjct: 335  --NEKYPKGLQLSHSIYVLFKKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFL 392

Query: 698  MILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQ 757
            MI+L R+H+ELSN  +V   Y +L+L +A  L+V+ ++Y+ W ++ V+ +G+SPID IFQ
Sbjct: 393  MIILARIHEELSN-NNVTKYYSDLILNDATALQVNPSKYQKWCEETVLSDGLSPIDHIFQ 451

Query: 758  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDE 817
            GQMEN L+C+RCG ++++YSTFYVLSLAIP  S+       S  K++KLEDCIN FTSDE
Sbjct: 452  GQMENILKCQRCGNSSYSYSTFYVLSLAIPKASL---YSFTSKSKKIKLEDCINFFTSDE 508

Query: 818  VLSGENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFG 877
             LS +NAWDCP+C               +               F LH+           
Sbjct: 509  ELSDDNAWDCPKCRTAEYKLKKDENLSQKKRSI----------LFNLHS----------- 547

Query: 878  DSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTT 937
                            R RS+SP         R  +    A   +D+         K  T
Sbjct: 548  ----------------RPRSKSPRHRHHHHHHRHKNDD--AKKNDDATKNSKKWKSKKLT 589

Query: 938  -VKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHT 996
             +K+++F+ LP ILVIHLSRFYYDLTKKNNTVITYPLILNIILKNN  ++Y+L+  VNH+
Sbjct: 590  TIKSLDFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNKVVRYKLYATVNHS 649

Query: 997  GTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSD---KNLKISSSDVYVL 1053
            G LI+GHYTS+VNK+  H + + R  W  FDD+V+K   K   D      +ISS++VYVL
Sbjct: 650  GNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDVIKQHHKDRDDFETGRTEISSNEVYVL 709

Query: 1054 FY 1055
            FY
Sbjct: 710  FY 711

 Score =  120 bits (300), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 131/255 (51%), Gaps = 22/255 (8%)

Query: 14  DELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDALTAFVIG 73
           +++L  V+++Y  DIK  Y Q           H  YLF++Y+  + + +  +ALTAF++G
Sbjct: 6   NQILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFIVG 65

Query: 74  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHVV 133
            +Y++L+IP SLQFQTRN  YS Y  LK  Y++E  M+ V+ +VK E  +++D+ +    
Sbjct: 66  GFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQCLSDSK 125

Query: 134 GIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHN-IKVPLTEDDMDQSSPVWTAPNL 192
            I   + +KRA+S+P   L   +ASLS+       HN + VPL E  ++ S P+      
Sbjct: 126 RISRSMKRKRAYSLPLRPLPVHMASLSI-------HNQLDVPLREMPIEISKPI------ 172

Query: 193 EPNDQLKLALLPEVIPTSTFNEPERKSTSPARPSVLLE--DVPCTYHDNDASTASLNPPF 250
             ND L   L  E       NE E  + +  R S   E   +P +Y   D    SL   F
Sbjct: 173 --NDTLVKGLAKEENELKFSNELEEGTDTEGRDSTSTEPLSIP-SYLRLDTGKDSL---F 226

Query: 251 RDITADRSVTHRKDS 265
           + +++  +    +DS
Sbjct: 227 KTLSSPAAAASTRDS 241

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
            YIL156W possible pseudogene; NNN added to avoid internal
            stop codon
          Length = 656

 Score =  385 bits (990), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 225/492 (45%), Positives = 289/492 (58%), Gaps = 65/492 (13%)

Query: 578  KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSN-YKNYLE 636
            K +++P I+   N+   LS+ GLRN GNTCYINSM+QCLF  K  R LFIS   YK++++
Sbjct: 218  KKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIK 277

Query: 637  PLASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEF 696
              A        K+S   + L   MY NGG SV+P  FL+  + LRPDL IP DQQDTQEF
Sbjct: 278  KDAET------KISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEF 331

Query: 697  LMILLDRLHDELS-NQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDI 755
            L+ILLD LHDEL      ++N+Y       +D + +   EY  W   N+  NG SPID I
Sbjct: 332  LVILLDILHDELVYTDDLISNNYV------SDDINLGK-EYMPWLQNNLKANGKSPIDLI 384

Query: 756  FQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTS 815
            FQGQ+EN LQC+RCG T++NYS FY+LSLAIP    K++K   +++ RVKLEDCIN FTS
Sbjct: 385  FQGQIENCLQCQRCGNTSYNYSMFYMLSLAIP----KIAK--ENSKNRVKLEDCINFFTS 438

Query: 816  DEVLSGENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDI 875
            DE+L+GENAW+CP+C P               E            FF LH          
Sbjct: 439  DEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLH---------- 488

Query: 876  FGDSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKM 935
                                +  SP      SG          +  +D  N   +KN+K+
Sbjct: 489  --------------------KVLSP-----SSGNHHRHHHHHHHHKSDGKNKNKYKNEKL 523

Query: 936  TTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNN-DTMKYRLFGVVN 994
             T+K +NF+ LP ILVIHLSRFYY+ TKKNN VITYPLILNII+KNN D +KY+L+G++N
Sbjct: 524  ITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLIN 583

Query: 995  HTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA--------DKKHGSDKNLKIS 1046
            H G L  GHYTS+VNKDL HS+D+   +WY FDDEV+K          K+  + +  +  
Sbjct: 584  HQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFD 643

Query: 1047 SSDVYVLFYERV 1058
            SS VYVLFYER+
Sbjct: 644  SSKVYVLFYERI 655

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 58/163 (35%), Positives = 92/163 (56%), Gaps = 6/163 (3%)

Query: 7   LFTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELY-LDSMHHGRPND 65
           +F+    D+L   V  ++  DIK YY +           HT YL +L+ + + H  R   
Sbjct: 21  IFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQ 80

Query: 66  ALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVL 125
           A  AFV G +Y+FLIIP  +QFQT+NK ++ Y DLK  YE +++M N++  VK++   +L
Sbjct: 81  ATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSIL 140

Query: 126 DESVKHVVGIEHRINKKRAFSVPA--NDLSGQVASLSLDTAGP 166
           ++ +    GI  RI KKRA++ P+  + LS   +S S+ +  P
Sbjct: 141 EQDLS---GINRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKP 180

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score =  383 bits (983), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 220/487 (45%), Positives = 299/487 (61%), Gaps = 39/487 (8%)

Query: 1   MHPHTTLFTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHH 60
           M  +TT FTPEYS ELLR V+D+Y +DIK +Y             HT YL+E + D M +
Sbjct: 1   MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKN 60

Query: 61  GRPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120
               DALTA++IGCY+++LIIPQS QFQ RNK++ ++  LKK+YEN++NMTNV+LMVK E
Sbjct: 61  RNKQDALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE 120

Query: 121 IGVVLDESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAG---PQQHNIKVPLTE 177
           +  VLD   + +  +E    +KRAFS P N L  +++ L+L   G   P+ H  K     
Sbjct: 121 VDSVLDRDFRKLKDVE----RKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHK-KWDFIR 175

Query: 178 DDMDQSS------PVWTAPNLEPNDQLKLAL---LPEVIPTSTFNE--PER--------K 218
            D +  S      P+W APNLEPNDQLKLAL   +P  +   T  +  PE         K
Sbjct: 176 SDSNFHSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPK 235

Query: 219 STSPARPSVLLEDVPCT----YHDNDASTASLNPP-----FRDITADRSVTHRKDSYHSV 269
             S +  +V  ++ P      +H     T  L        F D   DR+V HRKDSYHSV
Sbjct: 236 HKSKSELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHSV 295

Query: 270 YMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLR 329
           YM D D+   +N      E++  +Q++  LQKQSIIT+PELFSILSN+ ER ++LLIDLR
Sbjct: 296 YMDDGDHDFGENKGATFPESE--VQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLR 353

Query: 330 IPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYY 389
           +  R   N+I+APN+V +DP +LWD  T TPV    +L+  LK N  F  R  FD+IVYY
Sbjct: 354 LQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLK-NSIFNKRGSFDFIVYY 412

Query: 390 SDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISVED 449
           +D+KT+M ++FDY+F+F+ L++ SQ+  L ++P+ LLGGYEKWK  L  Y  ++ I V+D
Sbjct: 413 TDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDD 472

Query: 450 YLYRPYS 456
           YLYRPYS
Sbjct: 473 YLYRPYS 479

 Score =  320 bits (820), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 156/254 (61%), Positives = 187/254 (73%), Gaps = 6/254 (2%)

Query: 578 KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEP 637
           + +S+PTIER+ N YV+LSITGLRNLG TCYINSM+QCLFA   FR LF  SNY+ +  P
Sbjct: 579 RQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNP 638

Query: 638 LASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFL 697
              +    + KLS S S+L  KMY+NGGCSVVPT FLK+ N LRPD  IPDDQQD QEFL
Sbjct: 639 ELED----TGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFL 694

Query: 698 MILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQ 757
           M+ +DRLHDELSNQ  V N +P LLLY+A+  KV   EYK WF+ ++I    SPID IFQ
Sbjct: 695 MLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQ 754

Query: 758 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDE 817
           GQ+EN L CK+CGY++++YSTFY+LSLAIP  S       +     V LEDCINMFTSDE
Sbjct: 755 GQLENGLHCKKCGYSSYSYSTFYILSLAIPKPSSSFLSSSKGN--WVNLEDCINMFTSDE 812

Query: 818 VLSGENAWDCPRCG 831
           V+S ENAWDCP+CG
Sbjct: 813 VMSRENAWDCPKCG 826

 Score =  181 bits (458), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 2/124 (1%)

Query: 937  TVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHT 996
            +++  NFVTLP +LVIHLSRFYYDLTKKN TVITYPLILNI+LKNN+T+KYRL+ VVNH 
Sbjct: 920  SIRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHN 979

Query: 997  GTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHG--SDKNLKISSSDVYVLF 1054
            G LISGHYTSLVNK+ +H ++  R +WYYFDDEVVK +  HG  S    K+SS DVYVLF
Sbjct: 980  GNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLF 1039

Query: 1055 YERV 1058
            YER+
Sbjct: 1040 YERI 1043

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  340 bits (873), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 203/475 (42%), Positives = 281/475 (59%), Gaps = 46/475 (9%)

Query: 5   TTLFTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPN 64
           ++ FTPEYS EL  RVQD+Y  DIK   PQ           HT YL E +   +  GR +
Sbjct: 8   SSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYD 67

Query: 65  DALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVV 124
           DAL+A+++GCYY++LIIPQS QFQT+NKSYS+Y D K +Y+NE NMTNV  MV+ E+  +
Sbjct: 68  DALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSI 127

Query: 125 LDESVKHVVGIEHRINKKRAFSV-------------PANDLSGQVASLSLDTAGPQQHNI 171
           LD+S +     +  I + RAFSV             P  +         L  A P     
Sbjct: 128 LDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYD--- 184

Query: 172 KVPLTEDDMDQSSPVWTAPNLEPNDQLKLAL-LPEVIPTSTFNEPERKS---------TS 221
            +P+   ++D S+P+WTAP+L PNDQLKLAL  PE+      ++  + +         T 
Sbjct: 185 SLPM---ELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNNFTI 241

Query: 222 PARPSVLLEDVPCTYHDNDASTASLNPPFRDITADRSVTHRKDSYHSVYMVDSDNLK--- 278
           P  P  +   V  T  ++D     + P       DRS THRKDSYHSVYM D+DN     
Sbjct: 242 PL-PHQIPLPVKVTDFNHDKKIQKIYP------VDRSETHRKDSYHSVYM-DNDNSAGYV 293

Query: 279 EDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNH 338
             NDE  N     +IQ+L+ LQKQ++IT PELFSILS+   ++ +LLI L +P+R+  N+
Sbjct: 294 RKNDEANN-----YIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNY 348

Query: 339 IVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTI 398
           IVA N + +DPN+LWD + N P+ +D  LE +L + + F  R  F Y+VYY+D+KT+M I
Sbjct: 349 IVAKNTINIDPNVLWDFENNCPISEDTKLEKILND-QLFNIRKSFAYVVYYTDLKTYMKI 407

Query: 399 NFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISVEDYLYR 453
           NFDY F  FYL+ +S+ + L T PT+LLGG EKWKK + +Y  E  I+  +YL++
Sbjct: 408 NFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHK 462

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  352 bits (904), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 200/251 (79%), Gaps = 8/251 (3%)

Query: 581 SIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLAS 640
           S+PTIE++ NVYVSLSITGLRNLG+TCYINSM+QCLFA + FR +F+S  Y +Y+    S
Sbjct: 596 SVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI----S 651

Query: 641 NRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMIL 700
               H  ++S S  MLF KMY+NGGCSVVP+GFLK  N +RPD KIP+DQQDTQEFL+ L
Sbjct: 652 KGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFLLFL 711

Query: 701 LDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQM 760
           LD+LHDELS+ + VANDYP LLL++ D L+V   EY  WF+ ++  NG+SPID IFQGQM
Sbjct: 712 LDQLHDELSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQM 771

Query: 761 ENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLS 820
           EN LQC+RCG++++NYSTFYVLSLAIPT     S  G++  K+V LEDCIN+FTSDEVLS
Sbjct: 772 ENCLQCQRCGHSSYNYSTFYVLSLAIPTPGT--STFGKT--KKVLLEDCINLFTSDEVLS 827

Query: 821 GENAWDCPRCG 831
           GENAWDCPRCG
Sbjct: 828 GENAWDCPRCG 838

 Score =  345 bits (885), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 207/493 (41%), Positives = 281/493 (56%), Gaps = 52/493 (10%)

Query: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDAL 67
           +TPEYS+ELL+ VQD+Y +DIKHYYP+           H EYLFE Y   +  G   DAL
Sbjct: 5   YTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQEDAL 64

Query: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127
           TAF+IG +YV+LIIPQS+QF TRNKSY IY DL+K Y++E +MTNV+LMV K++  +L +
Sbjct: 65  TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124

Query: 128 SVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDM----DQS 183
           S       + +I +KRA+SVP+  L+ Q+ SL+L+     +   +V    D +    D  
Sbjct: 125 SRDFD---DTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADDY 181

Query: 184 SPVWTAPNLEPNDQLKLALLPEV----------------------IPTSTFNEPERKSTS 221
           + +W+AP LEP+DQLKLAL P                        I  S+ +E E   T 
Sbjct: 182 TTIWSAPKLEPDDQLKLALNPPSKSSSATSSLSSFVMDQHSKKFSIGESSSDEFEPIPTQ 241

Query: 222 PARP---SVLLEDVPCTYHDNDASTASLNPPFRDIT----------ADRSVTHRKDSYHS 268
            A P   +   E    T H +  S+       +D             DR  THRKDSYHS
Sbjct: 242 EALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSYHS 301

Query: 269 VYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDL 328
           VYM++ D   +D +E+       F Q+L  LQKQ +I+  EL  IL +  ER  VLL+DL
Sbjct: 302 VYMLNED---DDTNEY------DFFQNLSRLQKQYVISCEELMDILQSD-ERNNVLLVDL 351

Query: 329 RIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVY 388
           RI +R   NHIVAPNL+ +DP  LWD     P+  D  LE  +   + F +R KF YIVY
Sbjct: 352 RISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVY 411

Query: 389 YSDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISVE 448
           Y+D+KTF+ I+FDY  +FF L+  S  T L + P ALLG YE+WK  +  YA+ + I   
Sbjct: 412 YTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVTG 471

Query: 449 DYLYRPYSQKARA 461
           DYL+RPY+  A++
Sbjct: 472 DYLFRPYASSAKS 484

 Score =  202 bits (514), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 114/133 (85%), Gaps = 2/133 (1%)

Query: 930  FKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRL 989
            +K+KK+TT+KT NF+T+P ILVIHLSRF+YDLTKKN+TVITYPLILNI+LKNN+  KYRL
Sbjct: 905  WKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRL 964

Query: 990  FGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISS 1047
            +G+VNH G LISGHYTSLVNKDL+H +  G+ KWYYFDDEVVK D  HG  D  +  +SS
Sbjct: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSS 1024

Query: 1048 SDVYVLFYERVYD 1060
            SDVYVLFYER+YD
Sbjct: 1025 SDVYVLFYERIYD 1037

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
            weakly similar to uniprot|P36026 Saccharomyces cerevisiae
            YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  318 bits (815), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 177/485 (36%), Positives = 263/485 (54%), Gaps = 50/485 (10%)

Query: 578  KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEP 637
            K Y++P I         LS+ G+RN+GNTCY+NSM+QCLF +  FR LF++  +    E 
Sbjct: 193  KQYTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFLTDKF----EM 248

Query: 638  LASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFL 697
              +     S  ++N LS+LF KMY NGGC+++P  F++   +LRPD KIP  QQDTQEFL
Sbjct: 249  FKAETNSESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFL 308

Query: 698  MILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQ 757
            M +L+RL  EL+N      D   +   + +     N  Y  W+++ +  N +SPID +F+
Sbjct: 309  MFVLERLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNLSPIDLLFR 368

Query: 758  GQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDE 817
            G +E+ L CK C  +   +S+FY+LSL IP    K S   +S  K ++LEDCIN+FT  E
Sbjct: 369  GDVESKLICKHCNESASTFSSFYILSLNIPKE--KSSLFFKS--KTIRLEDCINLFTRKE 424

Query: 818  VLSGENAWDCPRCGPXXXXXXXXXXXXLENEXXXXXXXXXXXRFFTLHTGSKRRHLDIFG 877
            +L+GEN+W CP C               + +           RFF+        H++   
Sbjct: 425  ILTGENSWACPSCETKARYNVIDNDKTYQQKHTNIGKHSKFPRFFS--------HIE--- 473

Query: 878  DSNGEGNNINNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDS--NNTGDFKNKKM 935
                                        G  +R+S +  F+    D+  N     + KK 
Sbjct: 474  ---------------------------AGKTERNSGANKFSQLKYDNLENEQRHRQQKKS 506

Query: 936  TTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNH 995
             T+ +++FV+LP ILVIHLSRF YD++KKN + I+YP+ L +   +N ++ YRL+G +NH
Sbjct: 507  ETILSVSFVSLPPILVIHLSRFCYDISKKNTSNISYPMSLTVETLDNSSVTYRLYGTINH 566

Query: 996  TGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV--KADKKHGSDKNLKISSSDVYVL 1053
             G+   GHYT+LVNK+  H  D+   KW  FDD++V  + D      +   I+++D YVL
Sbjct: 567  IGSPRGGHYTALVNKEKNHFTDLELQKWVEFDDDLVFNRTDFFKSKTEINSITNNDAYVL 626

Query: 1054 FYERV 1058
            FYER+
Sbjct: 627  FYERI 631

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 70  FVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMY 104
           +  GC+Y++L++P + QFQ  +  Y  Y  LK  Y
Sbjct: 67  YAAGCFYIYLLVPNANQFQLEDTEYGTYLQLKNNY 101

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score =  291 bits (746), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 183/253 (72%), Gaps = 15/253 (5%)

Query: 580 YSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLA 639
           Y +P +  + N+YV LSI+GLRNLGNTCYINSM+QCLFA   FR LF+S+ YK Y+    
Sbjct: 428 YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV 487

Query: 640 SNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMI 699
                  P LSNS  +LF KMYLNGGC+V+P  FLK  N LRPDL+IPD QQDTQEFL++
Sbjct: 488 D------PHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLIL 541

Query: 700 LLDRLHDEL-SNQQHVANDYPNLLLYNADVLKVSN-NEYKHWFDKNVIGNGISPIDDIFQ 757
           LLD+LH+EL SNQ  + +++P+L+ Y+ D + V N NEYK WF +++   G+S I +IFQ
Sbjct: 542 LLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQ 601

Query: 758 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDE 817
           GQ+ENSL+C+RC YT+ NYS F  LSL+IP +  K  KL       V LEDCI++F  +E
Sbjct: 602 GQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRKL-------VDLEDCISLFIENE 654

Query: 818 VLSGENAWDCPRC 830
           +L+GENAW+CP+C
Sbjct: 655 MLTGENAWNCPKC 667

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 106/168 (63%), Gaps = 3/168 (1%)

Query: 894  RERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIH 953
            + +SR  FK      +  +  T      N S++   F  KK+ T K+ +F+ LP +L+IH
Sbjct: 677  KRKSRGFFKFSKHKNRSHNDLTFSEYNHNSSSDDVKFSKKKLVTRKSTSFIKLPNLLIIH 736

Query: 954  LSRFYYD-LTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDL 1012
            LSRF    L  KNNT I YP IL I LKN +  +++L+GVVNH G L +GHYTSL+NK+ 
Sbjct: 737  LSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEP 796

Query: 1013 EHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISSSDVYVLFYERV 1058
             H ++  R KW+YFDDE VK    +   DKN+ +ISSSDVYVLFYE++
Sbjct: 797  SHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKI 844

 Score =  106 bits (265), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 101/182 (55%), Gaps = 12/182 (6%)

Query: 276 NLKEDNDEFLNVENDGFIQSLDI----LQKQSIITAPELFSILSNRVEREKVLLIDLRIP 331
           ++  +  ++ N  ND  I   D     L ++  IT  ELFSILSN  +R K+L+IDLR+ 
Sbjct: 182 DINANESKYTNFINDKTINDEDTYLKHLYEECFITPHELFSILSNPSDRLKILIIDLRLS 241

Query: 332 QRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSD 391
           +   +  I +PNL+K DP  LW+ +  TPV         L  N  F   D F YI+ YSD
Sbjct: 242 RYFNLQTIRSPNLIKFDPIELWNNRDQTPVLH----RTSLFSNPLFQKIDLFSYIIIYSD 297

Query: 392 VKTFMTI-NFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISVEDY 450
            +T     +F+Y F FF L+++S    +   P  LLGG+EKW++ + SY+++Y I   +Y
Sbjct: 298 NETTTAFESFEYNFSFFKLLMSSS---MKVTPNFLLGGFEKWEQLISSYSEQYGIETSNY 354

Query: 451 LY 452
           ++
Sbjct: 355 IF 356

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 90/193 (46%), Gaps = 42/193 (21%)

Query: 13  SDELLRRVQDLYHEDIKHYYPQXXXXXXXXXXXHTEYLFELYLDSMHHGRPNDALTAFVI 72
           SDEL + V  +Y+  IK  Y Q           +TE LFE +L         D+L +F+I
Sbjct: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKG-----NTDSLDSFII 67

Query: 73  GCYYVFLIIPQS-LQFQTRNKSY-SIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVK 130
           G +Y+ L+IP S    ++ N  Y +IY DLKK YE++ N+++++ +++ E   +L     
Sbjct: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQ---- 123

Query: 131 HVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDMDQSSPVWTAP 190
                                        S D   P  H+      ++  D S+ +W AP
Sbjct: 124 -----------------------------SFDVDAPSSHSQHEE--DNTADSSTTIWQAP 152

Query: 191 NLEPNDQLKLALL 203
            LEPNDQLKLA++
Sbjct: 153 FLEPNDQLKLAII 165

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score =  110 bits (276), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 118/251 (47%), Gaps = 39/251 (15%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656
           + GL N+GN+CY+N +IQCL        +F+ ++++ Y+    +++      L+   S L
Sbjct: 619 MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYVN--LNSKLGSKGVLARYFSRL 676

Query: 657 FNKMYLN------GG--CSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 708
            + MY N      GG    V P  F      +    K    QQD QEF   LLD LH++L
Sbjct: 677 IHTMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK-GGSQQDCQEFCQFLLDGLHEDL 735

Query: 709 SNQQHVANDYPNLLLYNADVLK-------VSNNEYKHWF--DKNVIGNGISPIDDIFQGQ 759
           +  Q   N     L   A+ L+        S+ E++ +   D +VIG       D+FQGQ
Sbjct: 736 N--QCGGNKRLAELTEEAENLREKLSLRIASSIEWERFLTTDFSVIG-------DLFQGQ 786

Query: 760 MENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVL 819
             + LQCK CG T+  Y  F VLS+ +P++ +           +  + DC + FT  E L
Sbjct: 787 YASRLQCKTCGKTSTTYQPFSVLSIPVPSKHI----------SKCSIIDCFDEFTKVENL 836

Query: 820 SGENAWDCPRC 830
             +  W CPRC
Sbjct: 837 EVDEQWSCPRC 847

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 70/146 (47%), Gaps = 33/146 (22%)

Query: 934  KMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND--------- 983
            K  + K +    LP+ L+IHL RF   L K NN ++ YP  L++     ND         
Sbjct: 850  KQPSTKKLTITRLPRNLIIHLKRFDNRLNK-NNILVQYPFTLDLTTFWANDFDGKLPLNV 908

Query: 984  ----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
                         Y+L+GV  H G+L  GHYT+ V+K +++        WYYFDD   + 
Sbjct: 909  SELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDKGIKNG-------WYYFDDTSCRP 961

Query: 1034 DKKHGSDKNLKISSSDVYVLFYERVY 1059
             K      +++  +S  YVLFY+R+Y
Sbjct: 962  IK-----NSMEPITSSAYVLFYKRIY 982

 Score = 32.7 bits (73), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 50/119 (42%), Gaps = 3/119 (2%)

Query: 319 EREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFA 378
           +  +VL ID+R        H   PN++ ++P       ++  + +  ++     E   F 
Sbjct: 190 DSSQVLFIDVRTRLDFNKGHFKVPNIICIEPVSFKSSYSDHDLEKKSMITSTNDEIVLFH 249

Query: 379 NRDKFDYIVYYS---DVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKK 434
            R +F +IV YS   D K+ +        +   L+  S + PL+     L  G++ W K
Sbjct: 250 RRQEFAFIVLYSNDTDKKSGIVYKERKTLLANLLLNHSFEKPLSNRLYVLENGFDSWTK 308

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score =  110 bits (275), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 116/250 (46%), Gaps = 41/250 (16%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL N GN+CY++ +IQCL   +   T+F++++Y+N++    ++R      L+   S L +
Sbjct: 489 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHIN--LNSRLGSKGLLARYFSQLIH 546

Query: 659 KMYLNG----------GCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 708
           +MY  G            +V+PT F      +    K  + QQD QEF   LLD LH++L
Sbjct: 547 QMYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-DNTQQDCQEFCQFLLDGLHEDL 605

Query: 709 SNQQHVANDYP-NLLLYNADVLK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQM 760
           +      N+ P   L   A+ ++        S  E++ +   +      S I D+FQGQ 
Sbjct: 606 N---QCGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTD-----FSVIVDLFQGQY 657

Query: 761 ENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLS 820
            + LQCK C  T+  Y  F VLS+ +P            + +   L DC   FT  E L 
Sbjct: 658 ASQLQCKVCQRTSTTYQPFSVLSVPVP------------STRTCTLTDCFTEFTKIETLE 705

Query: 821 GENAWDCPRC 830
            E  W CP C
Sbjct: 706 QEEQWSCPSC 715

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 58/116 (50%), Gaps = 28/116 (24%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII----------LKNN 982
            K+  + K I    LP+ L+IHL RF  ++  KNN  ++YP +L++           + NN
Sbjct: 717  KRQPSTKKITITRLPRNLIIHLKRFD-NMLNKNNVFVSYPSVLDLTAFWANDYDKKVTNN 775

Query: 983  DT----------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDD 1028
            +             Y+L+G+  H GTL +GHYT+ VNK       +G   W Y+DD
Sbjct: 776  NVELPSRGQVPPFNYQLYGIACHDGTLRAGHYTAYVNK----GAVLG---WCYYDD 824

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%)

Query: 305 ITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQD 364
           I A  L ++L        VLL+D+R        HI + +++ ++P    +  T+  + + 
Sbjct: 158 IPATLLRNLLMGPSASGTVLLVDVRPRLDFMRCHIKSSSIICIEPVSFKESYTDIDLGKK 217

Query: 365 DILEHLLKENENFANRDKFDYIVYYS 390
            ++     E   F +RDKFDYIV Y+
Sbjct: 218 SMITSPDAEIALFQDRDKFDYIVVYT 243

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score =  109 bits (272), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 118/247 (47%), Gaps = 37/247 (14%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL N+GN+CY+N +IQCL ++  F  +F++++Y+ ++     ++      L+ + + L N
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHIN--LKSKLGSKGVLARNFARLIN 666

Query: 659 KMYLNGG--------CSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN 710
            MY  G           V P  F      +    +  D QQD+QEF   LLD LH++L+ 
Sbjct: 667 TMYTEGSEQSKNDRNGPVKPAQFKLACGSINSIFR-SDLQQDSQEFCQFLLDGLHEDLN- 724

Query: 711 QQHVANDYPNLLLYNADVLK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQMENS 763
            Q  AN     L  NA+ ++        S+ E++ +   +      S I D FQGQ  + 
Sbjct: 725 -QCGANPPLKELSPNAEKMREKLSLRIASSIEWERYLTTD-----FSVIVDQFQGQYASQ 778

Query: 764 LQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGEN 823
           L+CK CG T+  Y  F VLS+ +P         G+S      + DC N FT  E L  + 
Sbjct: 779 LRCKVCGGTSTTYQAFSVLSVPVPR--------GKS----CNIIDCFNEFTKVENLETDE 826

Query: 824 AWDCPRC 830
            W CP C
Sbjct: 827 LWACPHC 833

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 68/148 (45%), Gaps = 35/148 (23%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND-------- 983
            KK  + K +    LP+ L+IHL RF  ++  KNN  + YP +L++     ND        
Sbjct: 835  KKQPSTKKLTITRLPRNLIIHLKRF-DNMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPG 893

Query: 984  ------------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
                           Y+L  V  H G+L  GHYTS V+K        G+  W YFDD  +
Sbjct: 894  VTEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDK--------GKFGWRYFDDTKI 945

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYERVY 1059
            +  K      + +  +S+ YVLFY RVY
Sbjct: 946  RPLK-----NSYECITSNAYVLFYHRVY 968

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 56/115 (48%), Gaps = 8/115 (6%)

Query: 278 KEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVN 337
           K+ N E +N E        ++    S I+A +L  ++  ++  + +L+ID+R       +
Sbjct: 163 KDINKELINTE------LFNLPLSGSGISAIQLNHLI--QIYNDTLLVIDVRPRMEFEES 214

Query: 338 HIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDV 392
           HI   N++ ++P    +  T+  + +  ++     E + FA +D F+YIV  +D 
Sbjct: 215 HIKCKNIICIEPVSFNESFTDLELQKKSMITSPSDEVKTFAKKDTFNYIVICTDT 269

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score =  107 bits (268), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 73/247 (29%), Positives = 116/247 (46%), Gaps = 33/247 (13%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656
           I GL N+GN CY+N ++QCL        +F+ + Y N++    S+R      L+ + ++L
Sbjct: 445 IVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFIN-FDSSRGSKG-LLAKNFAIL 502

Query: 657 FNKMYLNGGCS--------VVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 708
            N M+ +G  +        V    F K+   + P +     QQD QEF   LLD LH++L
Sbjct: 503 VNNMHRHGAFTPPNVRTIPVQTIQFKKICGHINP-MYSDSMQQDCQEFCQFLLDGLHEDL 561

Query: 709 ---SNQQHVA--NDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENS 763
               +++H+   +D    +     + K S  E++ +     +    S I D+FQGQ  + 
Sbjct: 562 NQNGSKKHLKQLSDEEERMREKMSIRKASALEWERF-----LLTDFSAIIDLFQGQYASR 616

Query: 764 LQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGEN 823
           LQC+ C +T+  Y TF VLS+ +P              K   + DC   FT  E L  + 
Sbjct: 617 LQCQVCEHTSTTYQTFSVLSVPVP------------RVKTCNILDCFREFTKCERLGVDE 664

Query: 824 AWDCPRC 830
            W CP+C
Sbjct: 665 QWSCPKC 671

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 68/146 (46%), Gaps = 32/146 (21%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-----------LKN 981
            KK  + K +    LPK L+I+L RF   + K NN  + YP  L++            + N
Sbjct: 673  KKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYSLDLTPYWARDFNHEAIVN 731

Query: 982  NDT--------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
             D          +YRL+GV  H+G+L  GHYTS V K         +  WY+FDD + + 
Sbjct: 732  EDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PKKGWYFFDDSLYRP 784

Query: 1034 DKKHGSDKNLKISSSDVYVLFYERVY 1059
                    + +  +   YVLFYER++
Sbjct: 785  -----ITFSTEFITPSAYVLFYERIF 805

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 321 EKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANR 380
           + +LLID+R        HI   N++ +DP    D  T+  +    ++     +   F+NR
Sbjct: 161 DALLLIDVRPRSEFVRAHIKCKNIICIDPASFKDSFTDQQIESVSLITSPHSDITFFSNR 220

Query: 381 DKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKT---PLTTVPTALL-GGYEKWKKTL 436
           DKF +I+ Y+D +  +  NF          + SQ +   PL+     +L  G+  W K  
Sbjct: 221 DKFKFIILYTDTQ--LHNNFQQRQTRILAKILSQNSVIKPLSGTKILILENGFSNWVKLG 278

Query: 437 HSY 439
            +Y
Sbjct: 279 GAY 281

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score =  107 bits (266), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 116/250 (46%), Gaps = 40/250 (16%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL N+GN+CY+N +IQCL        +F++++Y+ ++    +++      L+ S + L +
Sbjct: 736 GLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHIN--INSKLGSKGILAKSFARLVH 793

Query: 659 KMYLNGGCS-----------VVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDE 707
            MY NG  S           V P  F      +    K   +QQD QEF   LLD LH++
Sbjct: 794 SMYQNGTLSIKNHSNKKNPPVQPITFKTACGSINSLFK-GSNQQDCQEFCQFLLDGLHED 852

Query: 708 LSNQQHVANDYPNLLLYNADVLK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQM 760
           L+  Q  AN     L   A+ ++        S+ E++ +     +    S I D++QGQ 
Sbjct: 853 LN--QCGANPPLKELSTEAERMREKLSLRIASSIEWERF-----LTTDFSVIIDLYQGQY 905

Query: 761 ENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLS 820
            + L+C+ CG T+  Y TF VLS+ +P              K + L DC N FT  E L 
Sbjct: 906 ASQLKCQVCGTTSTTYQTFSVLSVPVP------------KNKSIHLLDCFNEFTKTEFLG 953

Query: 821 GENAWDCPRC 830
            +  W C  C
Sbjct: 954 KDELWSCTEC 963

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 69/143 (48%), Gaps = 34/143 (23%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND-------- 983
            KK  + KT+    LPK L+IHL RF  ++  KNN  + YPLIL++     ND        
Sbjct: 965  KKQPSTKTLTITRLPKNLIIHLKRFD-NMLHKNNVFVKYPLILDLTNYWANDFDGKLPPG 1023

Query: 984  ------------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
                          KY L GV  H G+L  GHYT+ VNK L       ++ WYYFDD V 
Sbjct: 1024 VTEELPARGQIPPFKYELSGVALHMGSLYGGHYTAYVNKGL-------KNGWYYFDDTVY 1076

Query: 1032 KADKKHGSDKNLKISSSDVYVLF 1054
            ++ K        ++ + + YVLF
Sbjct: 1077 RSIKYSS-----EMITQNAYVLF 1094

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 54/99 (54%), Gaps = 3/99 (3%)

Query: 294 QSLDILQKQ-SIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLL 352
           +++D+  K  S IT+  L +IL  + + +  LLID+R      +NHI + +++ ++P   
Sbjct: 168 KNIDVFPKTGSHITSSVLATIL--QTDPDSTLLIDVRTRHDFELNHIKSNSIICIEPISF 225

Query: 353 WDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSD 391
            +  ++  + +  ++     E E F NR+ + +I+ Y+D
Sbjct: 226 KNNYSDVDIERKSLITSPNSEIEIFKNRENYKFIILYTD 264

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score =  106 bits (265), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 121/252 (48%), Gaps = 34/252 (13%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656
           I GL N+GN+CY+N +IQC+        +F++++Y+ ++    S+R      L+ + + L
Sbjct: 604 IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHIN--LSSRLGSKGVLAKNFARL 661

Query: 657 FNKMYLNGGCSVVPTGFLKVINQLRP-----------DLKIPDDQQDTQEFLMILLDRLH 705
            + MY++   S +     K I  ++P            L     QQD+QEF   LLD LH
Sbjct: 662 IHTMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFRDSQQQDSQEFCQFLLDGLH 721

Query: 706 DELSNQQHVANDYPNLLLYNADVLK-------VSNNEYKHWFDKNVIGNGISPIDDIFQG 758
           ++L+  Q   N     L   A+ L+        S+ E++ +   +      S I D+FQG
Sbjct: 722 EDLN--QCGGNPPLKELSLEAERLRENLSLRIASSIEWERYLTTD-----FSVIVDLFQG 774

Query: 759 QMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEV 818
           Q  + L+CK C +T+  Y +F VLS+ +P       K    T K + L DC N FT  E 
Sbjct: 775 QYASRLECKVCHHTSTTYQSFSVLSVPLP------KKFDPQTRK-IDLIDCFNEFTKIEN 827

Query: 819 LSGENAWDCPRC 830
           L  +  W CP C
Sbjct: 828 LEVDEQWSCPTC 839

 Score = 72.8 bits (177), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 73/148 (49%), Gaps = 34/148 (22%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-------------- 978
            KK  + K +    LP+ L+IHL RF  ++  KNN+ I YP  L++               
Sbjct: 841  KKQPSTKKLTITRLPRNLIIHLKRFD-NMLNKNNSFIDYPFNLDLTEFWADDFDGNLPPG 899

Query: 979  ----LKNNDTMK---YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
                L     +K   YRL+GV  H G+L  GHYT+ V+K + +        WYYFDD   
Sbjct: 900  VSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGNG-------WYYFDDTTY 952

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYERVY 1059
            +  K   +DK   ISSS  YVLFY RVY
Sbjct: 953  RPLK---NDKE-PISSS-AYVLFYTRVY 975

 Score = 36.2 bits (82), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 55/112 (49%), Gaps = 3/112 (2%)

Query: 281 NDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIV 340
           N ++    ND  I++L +    S I+  +L  ++ N    + +L+ID+R       +HI 
Sbjct: 163 NSDYNKYRND-IIKNLHLPSNGSFISTIQLNELMRNF--NDSLLIIDIRSRSEFIKSHIK 219

Query: 341 APNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDV 392
           + N++ ++P    D  ++  + +  I+     E   F NR  F +IV Y+++
Sbjct: 220 SKNIICIEPISFKDSYSDYELERKSIITSPNNEIRLFNNRQSFKFIVLYTEI 271

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 80/266 (30%), Positives = 116/266 (43%), Gaps = 47/266 (17%)

Query: 585 IERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPH 644
           ++R  N+ V     GL NLGN+CY+N +IQCL   +    +F+  +YKN++    ++R  
Sbjct: 48  VKRGLNINV-----GLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHVN--LNSRLG 100

Query: 645 HSPKLSNSLSMLFNKMYL-------------NGGCSVVPTGFLKVINQLRPDLKIPDDQQ 691
               L+   S L + M               N   +V P  F      +    K    QQ
Sbjct: 101 SKGVLAKYFSQLIHNMQQQAISASGRKSTSGNERNAVQPLHFKVACGSINSLFKT-TSQQ 159

Query: 692 DTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLK-------VSNNEYKHWFDKNV 744
           D QEF   LLD LH++L+  Q   N     L   A+ ++        S+ E++ +   + 
Sbjct: 160 DCQEFCQFLLDGLHEDLN--QCGGNPALKELSEEAEAIREKLCMRIASSIEWERYLTTD- 216

Query: 745 IGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRV 804
                S I D+FQGQ  + L CK CG T+  Y  F VLS+ +P  +            R 
Sbjct: 217 ----FSVIVDLFQGQYASQLMCKVCGRTSTTYQPFSVLSVPVPRGA------------RC 260

Query: 805 KLEDCINMFTSDEVLSGENAWDCPRC 830
            L DC   FT  E L  +  W CPRC
Sbjct: 261 NLLDCFEEFTKIETLEKDEQWSCPRC 286

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 66/146 (45%), Gaps = 33/146 (22%)

Query: 934  KMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND--------- 983
            K  + K I    LP+ L+IHL RF  +L  KNN  ++YP  L++     ND         
Sbjct: 289  KQPSTKKITITRLPRNLIIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGSLPKGV 347

Query: 984  ----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
                         Y L+ V  H GTL  GHYT+ VNK+        ++ W YFDD   + 
Sbjct: 348  AELPTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNKE-------DKNGWCYFDDTCWR- 399

Query: 1034 DKKHGSDKNLKISSSDVYVLFYERVY 1059
             K    D+ +  S+   YVLFY R Y
Sbjct: 400  -KAKSEDECITTSA---YVLFYHRKY 421

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 80/268 (29%), Positives = 115/268 (42%), Gaps = 45/268 (16%)

Query: 581 SIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLAS 640
           S P   RN N  V     GL NLGN+CY+N +IQCL        +F+  +YKN++    +
Sbjct: 483 SKPLTRRNTNFTV-----GLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVN--LN 535

Query: 641 NRPHHSPKLSNSLSMLFNKMYLNGG-----------CSVVPTGFLKVINQLRPDLKIPDD 689
           ++      L+   S L + M                 +V P  F      +   L     
Sbjct: 536 SKLGSKGVLAKYFSQLIHTMQQQAASASTKQNSGDKTAVQPLHFKVACGSIN-SLFRSSS 594

Query: 690 QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLK-------VSNNEYKHWFDK 742
           QQD QEF   LLD LH++L+  Q   N     L   A+ ++        S+ E++ +   
Sbjct: 595 QQDCQEFCQFLLDGLHEDLN--QCGGNPALKELSEEAEGIREKLCMRIASSIEWERYLTT 652

Query: 743 NVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEK 802
           +      S I D+FQGQ  + L CK CG T+  Y  F VLS+ +P+ S            
Sbjct: 653 D-----FSVIVDLFQGQYASQLTCKVCGRTSTTYQPFSVLSVPVPSGS------------ 695

Query: 803 RVKLEDCINMFTSDEVLSGENAWDCPRC 830
           +  + DC   FT  E L  +  W CPRC
Sbjct: 696 KCDIIDCFKEFTKVETLEKDEQWSCPRC 723

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 63/147 (42%), Gaps = 33/147 (22%)

Query: 934  KMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND--------- 983
            K  + K I    LP+ LVIHL RF  +L  KNN  ++YP  L++     ND         
Sbjct: 726  KQPSTKKITITRLPRNLVIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGRLPPGV 784

Query: 984  ----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
                         Y L+ V  H GTL  GHYTS V+K         ++ W YFDD   + 
Sbjct: 785  AELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDKG-------DKAGWCYFDDTSWRK 837

Query: 1034 DKKHGSDKNLKISSSDVYVLFYERVYD 1060
             K  G    L       YVLFY R Y+
Sbjct: 838  AKSQGECITL-----SAYVLFYHRKYN 859

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 61/130 (46%), Gaps = 6/130 (4%)

Query: 305 ITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQD 364
           I+  EL S+L      +  LLIDLR   +   +HI    ++ ++P    D  ++T + + 
Sbjct: 164 ISPSELQSLLG----AQNALLIDLRPRIKFVESHIKTDKIMCIEPISFKDSYSDTEITRR 219

Query: 365 DILEHLLKENENFANRDKFDYIVYYSDV--KTFMTINFDYVFIFFYLMLTSQKTPLTTVP 422
            ++    +E + F  RDKFDYIV Y+D   +T          +   +  + +K    T+ 
Sbjct: 220 SLITSPNEEVQLFQERDKFDYIVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKPLQRTII 279

Query: 423 TALLGGYEKW 432
             L GG+E W
Sbjct: 280 LTLQGGFENW 289

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score =  105 bits (262), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 119/253 (47%), Gaps = 47/253 (18%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL N GN+CY++ +IQCL   +   T+F++++Y+N++    ++R      L+   S L +
Sbjct: 487 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHIN--LNSRLGSKGVLARYFSQLIH 544

Query: 659 KMYLNG----------GCSVVPTGF---LKVINQLRPDLKIPDDQQDTQEFLMILLDRLH 705
           +MY  G            +V+P  F      IN L  D      QQD QEF   LLD LH
Sbjct: 545 QMYQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFRD----RSQQDCQEFCQFLLDGLH 600

Query: 706 DELSNQQHVANDYP-NLLLYNADVLK-------VSNNEYKHWFDKNVIGNGISPIDDIFQ 757
           ++L+      N+ P   L   A+ ++        S+ E++ +   +      S I D+FQ
Sbjct: 601 EDLN---QCGNNPPLKELSEKAEKMREMMPMRIASSIEWERYLTTD-----FSVIVDLFQ 652

Query: 758 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDE 817
           GQ  + L+CK CG T+  Y  F VLS+ +P            + ++  + DC   FT  E
Sbjct: 653 GQYASQLRCKVCGRTSTTYQPFSVLSVPVP------------SSRQCTIIDCFTEFTKVE 700

Query: 818 VLSGENAWDCPRC 830
            L  +  W CP C
Sbjct: 701 TLDLDEQWSCPDC 713

 Score = 72.0 bits (175), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 72/148 (48%), Gaps = 34/148 (22%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNI-----------ILKN 981
            K+  + K I    LP+ L+IHL RF  ++  KNN  ++Y  +LN+           ++ N
Sbjct: 715  KRQPSTKKITITRLPRNLIIHLKRFD-NMLNKNNVFVSYSAVLNLTSFWANDYDKKVMNN 773

Query: 982  NDT----------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            N+             Y+L+GV  HTGTL  GHYT+ VNK       +G   W Y+DD   
Sbjct: 774  NNVELPSRGQVPPFNYQLYGVACHTGTLYGGHYTAYVNK----GATLG---WCYYDD--- 823

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYERVY 1059
              + +     N  I S + YVLFY R++
Sbjct: 824  -TNWRQIRSSNEYI-SQNAYVLFYHRIH 849

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 65/137 (47%), Gaps = 4/137 (2%)

Query: 299 LQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVN-HIVAPNLVKVDPNLLWDKKT 357
           ++  S I++  L ++++       VLLID+R P+   VN HI   +L+ ++P    D  +
Sbjct: 153 VENGSSISSLMLHNLITTPATATSVLLIDIR-PRVDFVNFHIKFESLICIEPVSFKDSHS 211

Query: 358 NTPVYQDDILEHLLKENENFANRDKFDYIVYYSDV--KTFMTINFDYVFIFFYLMLTSQK 415
           +  + +  ++     E   F  RDKF+YI+ Y+    K    I+   V +   +  + QK
Sbjct: 212 DIDIAKKSMITSPDNEIALFQERDKFEYIILYTQGSEKNDYNIHQQEVLVDLLINRSFQK 271

Query: 416 TPLTTVPTALLGGYEKW 432
           +   T    L GG+  W
Sbjct: 272 SLYNTKILTLDGGFSSW 288

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 117/260 (45%), Gaps = 41/260 (15%)

Query: 589 PNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPK 648
           P++ +  +I GL NLGN+CY+N +IQCL        +F++++Y+ ++    ++R      
Sbjct: 424 PSINLDFAI-GLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVN--VNSRLGSKGL 480

Query: 649 LSNSLSMLFNKMYLNG-----------GCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFL 697
           L+N  S L  KMY  G             +V PT F      +    K    QQD QEF 
Sbjct: 481 LANYFSQLVQKMYQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLFK-GKQQQDCQEFC 539

Query: 698 MILLDRLHDELSNQQHVANDYPNLLLYNADVLK-------VSNNEYKHWFDKNVIGNGIS 750
             LLD LH++L+  Q   N     L   A+ ++        S  E++ +   +      S
Sbjct: 540 QFLLDGLHEDLN--QCGTNPPLKELSPEAEKMRETMPMRIASAIEWERYLTTD-----FS 592

Query: 751 PIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCI 810
            I D+FQGQ  + L+CK C +T+  Y  F VLS+ +P              +   + DC 
Sbjct: 593 VIVDLFQGQYASQLRCKICAHTSTTYQAFSVLSVPVP------------RARSCTIYDCF 640

Query: 811 NMFTSDEVLSGENAWDCPRC 830
             FT  E L  +  W CP C
Sbjct: 641 KEFTKLETLEKDELWYCPYC 660

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 68/147 (46%), Gaps = 35/147 (23%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNI-----------ILKN 981
            ++  + K I    LP  L+IHL RF  ++  KNN  + YP  L++           + K+
Sbjct: 662  QRQPSTKQIIITRLPNNLIIHLKRFD-NMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKD 720

Query: 982  NDT----------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            N              YRLF V +H+GTL  GHYTS V+K        GR  W  FDD  V
Sbjct: 721  NGVSLPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFDD--V 770

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYERV 1058
               K    D+ +   + + YVLFY RV
Sbjct: 771  SWRKIRRKDEYI---TPNAYVLFYRRV 794

 Score = 39.3 bits (90), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 46/89 (51%)

Query: 304 IITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQ 363
            ++  +L S++ +  +   +LL+D+R        HI   N++ ++P    +  T++ + +
Sbjct: 155 FVSISQLHSLIRHDNDSSGILLVDIRPRMDFNDGHIKHNNVICIEPISFKESYTDSDILR 214

Query: 364 DDILEHLLKENENFANRDKFDYIVYYSDV 392
             ++    +E + F NRDKF  IV Y+D 
Sbjct: 215 KSLITASDREVDLFKNRDKFRLIVLYTDT 243

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score =  104 bits (260), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 118/250 (47%), Gaps = 43/250 (17%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL N+GN+CY+N +IQCL +      +F++++Y+ ++    +++      L+   + L +
Sbjct: 520 GLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHIN--LNSKLGSKGVLAKYFARLVH 577

Query: 659 KMYLNGGCS--------VVPTGF---LKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDE 707
            MY  G           + P  F      IN L  D    + QQD+QEF   LLD LH++
Sbjct: 578 TMYREGSFKRPLEKNKPIQPIQFKMACGSINSLFKD----NTQQDSQEFCQFLLDGLHED 633

Query: 708 LSNQQHVANDYPNLLLYNADVLK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQM 760
           L+  Q  AN     L  +A+ ++        S+ E++ +   +      S I D+FQGQ 
Sbjct: 634 LN--QCGANPPLKELSEDAEKMREKLSMRIASSIEWERFLTTD-----FSVIVDLFQGQY 686

Query: 761 ENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLS 820
            + L+CK CG T+  Y TF VLS+ +P  S               + DC N FT  E L 
Sbjct: 687 ASQLKCKVCGCTSTTYQTFSVLSVPVPHVS------------SCHILDCFNEFTKVEKLG 734

Query: 821 GENAWDCPRC 830
            +  W CP C
Sbjct: 735 TDELWSCPTC 744

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 67/148 (45%), Gaps = 34/148 (22%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND-------- 983
            KK  + K +    LP+ L+IHL RF  ++  KNN  + YP +L++     ND        
Sbjct: 746  KKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPG 804

Query: 984  ------------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
                          +Y+L  V +H G+L  GHYT+ VNK +          W+YFDD   
Sbjct: 805  VTDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNKGINRG-------WHYFDDTSY 857

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYERVY 1059
            +  K        +  + + YVLFY RVY
Sbjct: 858  RPIKNET-----ECITPNAYVLFYHRVY 880

 Score = 35.8 bits (81), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%)

Query: 323 VLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDK 382
           +LLID+R        HI A +++ V+P    +  T+  V +  ++    KE   F  RDK
Sbjct: 186 LLLIDVRPRAEFDSKHIKAKSVICVEPVSFKNSFTDLEVEKKSLITSPQKEIALFQARDK 245

Query: 383 FDYIVYYS 390
           ++YIV Y+
Sbjct: 246 YNYIVIYT 253

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  102 bits (255), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 110/246 (44%), Gaps = 36/246 (14%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL N+GN+CYIN ++QCL        +F++ +Y+ ++    ++R      L+   + L +
Sbjct: 464 GLENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHIN--MNSRLGSKGVLAKYFAKLTH 521

Query: 659 KMYLNG-------GCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 711
            MY N        G  V P  F      +   L     QQD QEF   LLD LH++L+  
Sbjct: 522 SMYQNASHKLNEKGKPVQPMEFKMACGTIN-SLFRESGQQDCQEFCQFLLDGLHEDLN-- 578

Query: 712 QHVANDYPNLLLYNADVLK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSL 764
           Q   N     L   A+ ++        S+ E++ +   +      S I D+FQGQ  + L
Sbjct: 579 QCGGNPPLKELSDEAEKMREKLSLRIASSIEWERFLTTD-----FSVIVDLFQGQYASQL 633

Query: 765 QCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENA 824
           +C+ CG T+  Y  F VLS+ +P              K   + DC   FT  E L  +  
Sbjct: 634 RCQVCGLTSTTYQPFSVLSVPVP------------HAKSCNIIDCFKEFTKVEKLETDEQ 681

Query: 825 WDCPRC 830
           W CPRC
Sbjct: 682 WSCPRC 687

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 65/148 (43%), Gaps = 34/148 (22%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-------------- 978
            KK  + K +    LP+ L+IHL RF  ++  KNN  + YP  L++               
Sbjct: 689  KKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFTLDLTPYWANDFDGRLPPG 747

Query: 979  -------LKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
                      +    Y+L+G+ +H G+L  GHYTS V+K         +  W YFDD   
Sbjct: 748  VTEELPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDKG-------PKRGWCYFDDTSF 800

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYERVY 1059
            +  +        +  + + YVLFY RVY
Sbjct: 801  RPVRNA-----TECITPNAYVLFYHRVY 823

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 67/154 (43%), Gaps = 9/154 (5%)

Query: 298 ILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKT 357
           +L   S I++  L  ++ +    +  LLIDLR     +  HI A N++ ++P     + T
Sbjct: 155 VLNTGSTISSSHLQQLIDS--HNDSTLLIDLRQRGEFSKLHINAKNVICIEPISFKAQYT 212

Query: 358 NTPVYQDDILEHLLKENENFANRDKFDYIVYY-SDVKTFMTINFDY---VFIFFYLMLTS 413
           +  + +  ++    +E   F  RD F +IV Y S+ K   + +FD      +   L+  S
Sbjct: 213 DLEIEKKSLITSPKEEIGLFRARDTFKFIVLYTSEDKESHSRSFDLQQQAILLDLLINHS 272

Query: 414 QKTPL--TTVPTALLGGYEKW-KKTLHSYAQEYH 444
              PL   T    L  G+  W  +      +E+H
Sbjct: 273 FAKPLNANTRVYVLKAGFSNWVSEGRQCIGEEHH 306

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score =  101 bits (252), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 110/241 (45%), Gaps = 25/241 (10%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL NLGN+CY+N +IQC+        +F+  +Y  ++    +++      L+   + L +
Sbjct: 566 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHIN--INSKLGSKGILAKYFARLVH 623

Query: 659 KMY-----LNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQH 713
            MY      +   S+ P  F      +    K    QQD QEF   LLD LH++L+  Q 
Sbjct: 624 MMYKEQVDSSKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLN--QC 680

Query: 714 VANDYPNLLLYNADV----LKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 769
            +N     L   A+     L +       W  +  +    S I D+FQGQ  + L+CK C
Sbjct: 681 GSNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLRCKVC 738

Query: 770 GYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPR 829
            +T+  Y  F VLS+ IP          ++++ ++ +EDC   FT  E L  E  W CP 
Sbjct: 739 NHTSTTYQPFTVLSIPIP---------KKNSQNKITIEDCFKEFTKCENLEVEEQWLCPH 789

Query: 830 C 830
           C
Sbjct: 790 C 790

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 67/149 (44%), Gaps = 35/149 (23%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-------------L 979
            ++  + K +    LP+ L++HL RF  +   KNN  + YP +L++               
Sbjct: 792  QRQPSTKQLTVTRLPRNLIVHLKRFD-NFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPG 850

Query: 980  KNNDTM---------KYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEV 1030
             N+D +         KY L+GV  H GTL  GHYT+ V K L       +  W YFDD  
Sbjct: 851  VNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTK 903

Query: 1031 VKADKKHGSDKNLKISSSDVYVLFYERVY 1059
             K  K      N     S+ YVLFY RVY
Sbjct: 904  YKPVKNQTDAIN-----SNAYVLFYHRVY 927

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score =  100 bits (250), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 108/241 (44%), Gaps = 25/241 (10%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL NLGN+CY+N +IQC+        +F+  +Y  ++    +++      L+   + L +
Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHIN--INSKLGSKGILAKYFARLVH 620

Query: 659 KMY-----LNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQH 713
            MY      +   S+ P  F      +    K    QQD QEF   LLD LH++L+  Q 
Sbjct: 621 MMYKEQVDASKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLN--QC 677

Query: 714 VANDYPNLLLYNADV----LKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 769
            +N     L   A+     L +       W  +  +    S I D+FQGQ  + L+CK C
Sbjct: 678 GSNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKIC 735

Query: 770 GYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPR 829
           G+T+  Y  F VLS+ IP          +  +  + +EDC   FT  E L  +  W CP 
Sbjct: 736 GHTSTTYQPFTVLSIPIPR---------KVPQNEITIEDCFKEFTKCENLEVDEQWLCPH 786

Query: 830 C 830
           C
Sbjct: 787 C 787

 Score = 75.5 bits (184), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 70/149 (46%), Gaps = 35/149 (23%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-------------L 979
            K+  + K +    LP+ L+IHL RF  +L  KNN  + YP +L++               
Sbjct: 789  KRQPSTKQLTVTRLPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPG 847

Query: 980  KNNDTM---------KYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEV 1030
             N+D +         KY L+GV  H GTL  GHYT+ V K L       R  W YFDD  
Sbjct: 848  VNDDELPVRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------RKGWLYFDDTK 900

Query: 1031 VKADKKHGSDKNLKISSSDVYVLFYERVY 1059
             K  K         +++S+ YVLFY RVY
Sbjct: 901  FKPVKNKTD-----VTNSNAYVLFYHRVY 924

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 99.8 bits (247), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/253 (30%), Positives = 121/253 (47%), Gaps = 39/253 (15%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNY--LEPLASNRPHHSPKLSNSLS 654
           I GL+N+GN+CY+N +IQCL        +F++ +++ Y  L     ++   +  LS  + 
Sbjct: 746 IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKLIH 805

Query: 655 MLFNKMYL--NGGCSVVPTG--FLKVINQLRPDLKIPDD------QQDTQEFLMILLDRL 704
           +++N   L  NG  +   +G  F+K I Q R      ++      QQD QEF   LLD L
Sbjct: 806 LMYNHSTLKNNGDKTKKKSGNNFIKPI-QFRMACGSINNLFKNCSQQDCQEFCQFLLDAL 864

Query: 705 HDELSNQQHVANDYPNLLLYNADVLK-------VSNNEYKHWFDKNVIGNGISPIDDIFQ 757
           H++L+  Q  +N     L   A+ ++        S+ E++ +     +    S I D+FQ
Sbjct: 865 HEDLN--QCGSNPPLKELSTKAESMREKLSLRIASSIEWERY-----LTTDFSVIVDLFQ 917

Query: 758 GQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDE 817
           GQ  + LQCK C +T+  Y  F VLS+ IP +            K + L DC   FT  E
Sbjct: 918 GQYASRLQCKTCIHTSTTYQPFSVLSVPIPKK------------KNLNLLDCFKDFTKIE 965

Query: 818 VLSGENAWDCPRC 830
            L  +  W CP C
Sbjct: 966 NLEVDEQWFCPNC 978

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 67/147 (45%), Gaps = 34/147 (23%)

Query: 934  KMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTM-------- 985
            K  + K +    LP+ L+IHL RF  +   KNN +I YP IL++     D          
Sbjct: 981  KQPSTKKLTITRLPRNLIIHLKRFD-NNLNKNNNLIDYPFILDLTQFWADDFDGELPPGV 1039

Query: 986  -------------KYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVK 1032
                         KYRL+G   H G+L  GHYT+ VNK +       R+ WYYFDD   +
Sbjct: 1040 TDELPKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNKGI-------RNGWYYFDDTNYR 1092

Query: 1033 ADKKHGSDKNLKISSSDVYVLFYERVY 1059
              K           SS+ YVLFY R+Y
Sbjct: 1093 PIKNEREP-----ISSNAYVLFYHRIY 1114

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 110/241 (45%), Gaps = 25/241 (10%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL NLGN+CY+N +IQC+        +F+  +Y  ++    +++      L+   + L +
Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHIN--INSKLGSKGILAKYFARLVH 620

Query: 659 KMY---LNGG--CSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQH 713
            MY   ++G    S+ P  F      +    K    QQD QEF   LLD LH++L+  Q 
Sbjct: 621 MMYKEQVDGSKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLN--QC 677

Query: 714 VANDYPNLLLYNADV----LKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 769
            +N     L   A+     L +       W  +  +    S I D+FQGQ  + L+CK C
Sbjct: 678 GSNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKVC 735

Query: 770 GYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPR 829
            +T+  Y  F VLS+ IP          +++   + +EDC   FT  E L  +  W CP 
Sbjct: 736 SHTSTTYQPFTVLSIPIPK---------KNSRNNITIEDCFREFTKCENLEVDEQWLCPH 786

Query: 830 C 830
           C
Sbjct: 787 C 787

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 68/149 (45%), Gaps = 35/149 (23%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-------------L 979
            K+  + K +    LP+ L++HL RF  +L  KNN  + YP +L++               
Sbjct: 789  KRQPSTKQLTITRLPRNLIVHLKRFD-NLLNKNNDFVIYPFLLDLTPFWANDFDGVFPPG 847

Query: 980  KNNDTM---------KYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEV 1030
             N+D +         KY L+GV  H GTL  GHYT+ V K L       +  W YFDD  
Sbjct: 848  VNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTK 900

Query: 1031 VKADKKHGSDKNLKISSSDVYVLFYERVY 1059
             K  K      N     S+ YVLFY RVY
Sbjct: 901  YKPVKNKADAIN-----SNAYVLFYHRVY 924

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 111/243 (45%), Gaps = 29/243 (11%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL N+GN+CY+N ++QC+        +F++++Y+ ++    +++      L+   + L +
Sbjct: 584 GLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHIN--INSKLGSKGVLARYFARLAH 641

Query: 659 KMYLNG------GCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQ 712
            M+            V PT F   I  +    +   +QQD QEF   LLD LH++L+   
Sbjct: 642 IMHQTSYDQEKKAAIVRPTQFRMAIASINSMFR-NTNQQDCQEFCQFLLDGLHEDLN--- 697

Query: 713 HVANDYPNLLLYNA-----DVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCK 767
              N+ P   L        ++L +       W  +  +    S I D+FQGQ  + L+C 
Sbjct: 698 QCGNNPPLKELSEEAEKKRELLSLRIASSIEW--ERFLTTNFSVIIDLFQGQYASRLKCS 755

Query: 768 RCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDC 827
            C  T+  Y  F VLS+ +PT           T+  V L DC N FT  E L  +  W+C
Sbjct: 756 VCSNTSTTYQPFSVLSVPLPT----------GTKSSVNLMDCFNEFTKCEKLEHDEYWNC 805

Query: 828 PRC 830
           P C
Sbjct: 806 PTC 808

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 69/149 (46%), Gaps = 35/149 (23%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNNDT------- 984
            KK  + K +    LP+ L+IHL RF   + K N  +I YP  L++     ND        
Sbjct: 810  KKQPSTKQLTITRLPRNLIIHLKRFDNRMNK-NTKLIDYPFNLDLTSFWANDKDDRLPPG 868

Query: 985  --------------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEV 1030
                           KY L+ V NH G+L  GHYTS VNK L          WYYFDD+ 
Sbjct: 869  VSIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNKGLSRG-------WYYFDDQN 921

Query: 1031 VKADKKHGSDKNLKISSSDVYVLFYERVY 1059
             +  KK       ++ +S+ YVLFY RV+
Sbjct: 922  YRLVKKTS-----EVVNSNAYVLFYRRVH 945

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score = 99.0 bits (245), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 110/241 (45%), Gaps = 25/241 (10%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL NLGN+CY+N +IQC+        +F+  +Y  ++    +++      L+   + L +
Sbjct: 564 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHIN--INSKLGSKGILAKYFARLVH 621

Query: 659 KMY-----LNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQH 713
            MY      +   S+ P  F      +    K    QQD QEF   LLD LH++L+  Q 
Sbjct: 622 MMYKKQVDSSKKDSISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLN--QC 678

Query: 714 VANDYPNLLLYNADV----LKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 769
            +N     L   A+     L +       W  +  +    S I D+FQGQ  + L+CK C
Sbjct: 679 GSNPPLKELSQEAETRRERLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKTC 736

Query: 770 GYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPR 829
            +T+  Y  F VLS+ IP          ++++ ++ +EDC   FT  E L  +  W CP 
Sbjct: 737 NHTSTTYQPFTVLSIPIP---------KKNSQNKITIEDCFKEFTKCENLEIDEQWLCPH 787

Query: 830 C 830
           C
Sbjct: 788 C 788

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 67/149 (44%), Gaps = 35/149 (23%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-------------L 979
            K+  + K +    LP+ L+IHL RF  +L  KNN  + YP +L++               
Sbjct: 790  KRQPSTKQLTITRLPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPG 848

Query: 980  KNNDTM---------KYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEV 1030
             N+D +         KY L+GV  H GTL  GHYTS V K L          W YFDD  
Sbjct: 849  VNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTSYVKKGLSRG-------WLYFDDTK 901

Query: 1031 VKADKKHGSDKNLKISSSDVYVLFYERVY 1059
             +  K      N     S+ YVLFY RVY
Sbjct: 902  YRPAKNQTDAIN-----SNAYVLFYHRVY 925

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 119/266 (44%), Gaps = 39/266 (14%)

Query: 581 SIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLAS 640
           S P I+ +  ++    I GL N+GN CY+N ++QCL        +F+ + Y N++     
Sbjct: 412 SKPPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFIN--FD 469

Query: 641 NRPHHSPKLSNSLSMLFNKMYLNGG-----CSVVPTGFLKV------INQLRPDLKIPDD 689
           N       L+ + + L + M+ +G        + P   ++       IN +  D      
Sbjct: 470 NMRGSKGLLAKNFANLVHTMHRHGAFKPLNSRITPVQTIQFKKTCGHINSIYSD----SM 525

Query: 690 QQDTQEFLMILLDRLHDEL---SNQQHVA--NDYPNLLLYNADVLKVSNNEYKHWFDKNV 744
           QQD QEF   LLD LH++L     ++H+   ++       N  + K S  E++ +     
Sbjct: 526 QQDCQEFCQFLLDGLHEDLNQNGGKKHLKQLSEEEERTRENMSIRKASALEWERF----- 580

Query: 745 IGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRV 804
           +    S + D+FQGQ  + LQC+ C +T+  Y TF VLS+ +P R M  + L        
Sbjct: 581 LLTDFSAVIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVP-RIMTCNVL-------- 631

Query: 805 KLEDCINMFTSDEVLSGENAWDCPRC 830
              DC   FT  E L     W C RC
Sbjct: 632 ---DCFREFTKCEKLGIGEQWSCSRC 654

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 71/146 (48%), Gaps = 32/146 (21%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILN-------------IIL 979
            KK  + K +    LPK L+I+L RF   +  KNN  + YP  L+             II 
Sbjct: 656  KKQPSTKQLKITRLPKKLIINLKRFDNQM-HKNNVFVQYPCFLDLTPYWARDFNHEAIID 714

Query: 980  KNNDT------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
            ++  T       +YRL+GV  H+G+L  GHYTS V K  +         WY+FDD + + 
Sbjct: 715  EDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGPQKG-------WYFFDDTIYRL 767

Query: 1034 DKKHGSDKNLKISSSDVYVLFYERVY 1059
             +      N +  + + YVLFYER++
Sbjct: 768  IR-----FNNEFITPNAYVLFYERIF 788

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%)

Query: 321 EKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANR 380
           +  LL+D+R        HI   +++ +DP    D  T+T V +  +      E E F+ R
Sbjct: 163 DAFLLVDVRPRPEFIKAHIKCKHIMCIDPASFKDSYTDTLVERVSLAASPQLEIELFSKR 222

Query: 381 DKFDYIVYYSDVK 393
           + F  IV Y+D +
Sbjct: 223 NTFKNIVLYTDTQ 235

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 98.2 bits (243), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 112/258 (43%), Gaps = 51/258 (19%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL NLGN+CY+N +IQCL        +F++ +YKN++    +++      L+   S L +
Sbjct: 524 GLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHIN--FNSKLGSKGVLAKYFSQLVH 581

Query: 659 KMYLNGG----------------CSVVPTGF---LKVINQLRPDLKIPDDQQDTQEFLMI 699
            MY                     +V P  F      IN L  D      QQD QEF   
Sbjct: 582 NMYRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTINSLFRDC----SQQDCQEFCQF 637

Query: 700 LLDRLHDELSNQQHVANDYPNLLLYNADVLK-------VSNNEYKHWFDKNVIGNGISPI 752
           LLD LH++L+  Q   N     L   A+ ++        S+ E++ +   +      S I
Sbjct: 638 LLDGLHEDLN--QCGGNPRLKELSEEAEKIREKLSMRIASSIEWERYLTTD-----FSVI 690

Query: 753 DDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINM 812
            D+FQGQ  + L+C+ CG T+  Y  F VLS+ +P+             K   + DC   
Sbjct: 691 VDLFQGQYASQLKCQVCGRTSTTYQPFSVLSVPLPSL------------KSCNILDCFQE 738

Query: 813 FTSDEVLSGENAWDCPRC 830
           FT  E L  +  W CP C
Sbjct: 739 FTKVETLEKDEQWSCPDC 756

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 70/147 (47%), Gaps = 33/147 (22%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND-------- 983
            K+  + K I    LP+ L+IHL RF  ++  KNN  ++YP  L++     ND        
Sbjct: 758  KRQPSTKKITITRLPRNLIIHLKRFD-NMMNKNNVFVSYPHTLDLTPFWANDFDGRLPPG 816

Query: 984  -----------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVK 1032
                          Y+L+ V +HTGTL  GHYT+ V+K  +         W YFDD   +
Sbjct: 817  VTELPTRGQVPPFSYKLYAVASHTGTLYGGHYTAYVHKGSQRG-------WCYFDDTNWR 869

Query: 1033 ADKKHGSDKNLKISSSDVYVLFYERVY 1059
              +   SD   +  +S+ YVLFY RVY
Sbjct: 870  RSR---SDN--ECITSNAYVLFYHRVY 891

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 60/126 (47%), Gaps = 4/126 (3%)

Query: 314 LSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKE 373
           L N +    VLLIDLR       +HI +P+++ ++P    D  ++  + +  ++     E
Sbjct: 167 LQNLMAASSVLLIDLRPRMEFIKSHIKSPSVICIEPISFKDTYSDLDLAKKSMITSPNCE 226

Query: 374 NENFANRDKFDYIVYYS--DVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALL-GGYE 430
            E F+ RD F +IV Y+  D +T          +   L  +  K PL  V   +L GG+E
Sbjct: 227 IELFSKRDTFQFIVLYTHEDGRTQYYKQQQLKLLDLLLSRSFDK-PLDKVKVLILEGGFE 285

Query: 431 KWKKTL 436
           +W + +
Sbjct: 286 EWLREI 291

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 112/250 (44%), Gaps = 39/250 (15%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656
           I GL N+GN CY+N ++QCL        +F+ + Y N++     N       L+ + + L
Sbjct: 463 IVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFIN--FGNTRGSKGLLAKNYATL 520

Query: 657 FNKMYLNGG--------CSVVPTGFLKV---INQLRPDLKIPDDQQDTQEFLMILLDRLH 705
            + M+ +G           V    F KV   IN +  D      QQD QEF   LLD LH
Sbjct: 521 VHNMHRHGAFKPPHSRTTPVQTLQFKKVCGHINSIYSD----SMQQDCQEFCQFLLDGLH 576

Query: 706 DEL---SNQQHVA--NDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQM 760
           ++L     ++H+   ++    +  +  + K S  E++ +   +      S I D+FQGQ 
Sbjct: 577 EDLNQNGGKKHLKQLSEQEERMRESMSIRKASALEWERFLLTD-----FSAIIDLFQGQY 631

Query: 761 ENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLS 820
            + LQC+ C +T+  Y TF VLS+ +P              +   + DC   FT  E L 
Sbjct: 632 ASRLQCQACEHTSTTYQTFSVLSVPVPRI------------RTCNILDCFREFTKCEKLG 679

Query: 821 GENAWDCPRC 830
            +  W C +C
Sbjct: 680 VDEQWSCSKC 689

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 69/146 (47%), Gaps = 32/146 (21%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-----------LKN 981
            KK  + K +    LPK L+I+L RF   + K NN  + YP  L++            + N
Sbjct: 691  KKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPCFLDLTPYWARDFNHESIVN 749

Query: 982  NDT--------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
             D          +YRL+GV  H+G+L  GHYTS V K  +         WY+FDD V   
Sbjct: 750  EDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGPQKG-------WYFFDDSVYCP 802

Query: 1034 DKKHGSDKNLKISSSDVYVLFYERVY 1059
             +      N +  + + YVLFYER++
Sbjct: 803  IR-----FNDEFITPNAYVLFYERIF 823

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 53/125 (42%), Gaps = 2/125 (1%)

Query: 317 RVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENEN 376
           R     +L+ID+R        HI   N++ ++P    D  T+  V +  +      E + 
Sbjct: 173 RFHGGSILVIDIRPRSEFIKAHIKCKNIICIEPVSFKDSFTDQQVGKISLATSPQSEIDL 232

Query: 377 FANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLT-SQKTPLTTVPTALLG-GYEKWKK 434
           F+NRD F YIV Y+D + +   +     I   ++   S   PL      +L  G+  W K
Sbjct: 233 FSNRDTFKYIVLYTDTQLYGDFHQRQTRILTKILCQHSVLKPLGGTKVLILANGFSNWVK 292

Query: 435 TLHSY 439
              +Y
Sbjct: 293 LGGAY 297

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 95.9 bits (237), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/251 (29%), Positives = 112/251 (44%), Gaps = 43/251 (17%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            GL N+GN+CYIN +IQC+FA      +F++  Y  ++     ++      LS++ + L 
Sbjct: 525 VGLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHIN--KQSKLGSKGVLSHNFAKLL 582

Query: 658 NKMYLNGGCSVVPT--GFLKV---------INQLRPDLKIPDDQQDTQEFLMILLDRLHD 706
             MY       +    G +K          +N L  D      QQD  EF   LLD LH+
Sbjct: 583 KDMYEENSSKKIGKKHGAVKTLQFKMACASVNSLFKDA----SQQDCLEFCQFLLDGLHE 638

Query: 707 ELSNQQHVANDYPNLLLYNADVLK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQ 759
           +L+  Q  AN     L   A+ ++        S+ E++ +   +      S I D+FQGQ
Sbjct: 639 DLN--QCGANPPLKELSPEAEKMRENLSLRVASSIEWERYLTTD-----FSIIVDLFQGQ 691

Query: 760 MENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVL 819
             + L+CK C  T+  Y  F VLS+ +P+        G+S      L DC   FT  E L
Sbjct: 692 YASQLRCKVCNRTSTTYQAFSVLSVPVPS--------GKS----CGLLDCFIEFTKTENL 739

Query: 820 SGENAWDCPRC 830
             +  W CP C
Sbjct: 740 EVDEQWFCPSC 750

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 65/147 (44%), Gaps = 34/147 (23%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNNDT------- 984
            KK  + K +    LP+ L+IHL RF  ++  KNN  + YP IL++     ND+       
Sbjct: 752  KKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNIFVRYPQILDLTPFWANDSDGKLPPG 810

Query: 985  -------------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
                           YRL+G   H GTL  GHYTS V+K  E         W YFDD V 
Sbjct: 811  ITDEIPARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDKGPEKG-------WIYFDDTVY 863

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYERV 1058
            +  +        +  S   YVLFY R+
Sbjct: 864  RPVRFQN-----EFISPSAYVLFYHRI 885

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 60/116 (51%), Gaps = 5/116 (4%)

Query: 281 NDEFLNVENDGFIQSLDILQKQ---SIITAPELFSILSNRVEREKVLLIDLRIPQRSAVN 337
           N + + ++ D  +Q +  +  +   S I+  EL S++  +++ + +LLID+R       +
Sbjct: 163 NRDAIEIDKDSILQDIRYINGKRSGSGISCSELLSLM--KMKEDSLLLIDVRPKLEYDAH 220

Query: 338 HIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDVK 393
           HI   N++ ++P    +  ++  + +  ++     E + F  R +F YI+ Y+D++
Sbjct: 221 HIKTKNIICIEPISFKESYSDQQIEKTSMIPSPKHEIQLFQRRSEFQYIILYTDLE 276

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 107/249 (42%), Gaps = 33/249 (13%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
           TGL N+ N+CY+N +IQCL +      L++++ +   +     N+      LS + + L 
Sbjct: 458 TGLENVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLTQIN--VENKLGSKGFLSKNFANLI 515

Query: 658 NKMYLNGGCS---------VVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 708
             MY               V P  F      +   +     +QD QEF   LLD LH++L
Sbjct: 516 QTMYKKSAFQPYNPNFLHPVAPLEFKNACGMMN-SIYAESTEQDCQEFCEFLLDGLHEDL 574

Query: 709 SNQQHVANDYPNLLLYNADVLK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQME 761
           +  Q   N  P  L  N   L+        S  E++ +   N      SPI ++FQGQ  
Sbjct: 575 N--QCSGNPRPKELSANEAELRESLSMRIASEIEWESFLTTN-----FSPIINLFQGQYA 627

Query: 762 NSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSG 821
           + LQC  C +T+  Y  F +LS+ +P+          S  +   + DC   FT  E L  
Sbjct: 628 SRLQCLICQHTSTTYQPFSLLSIPVPSMVF-------SNGQTCNILDCFKEFTKCERLDN 680

Query: 822 ENAWDCPRC 830
           +  W CP+C
Sbjct: 681 DEKWFCPKC 689

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 68/149 (45%), Gaps = 34/149 (22%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND-------- 983
            +K  + K +    LPK L+IH  RF  +   KNN  + YP  L++  L  ND        
Sbjct: 691  RKQISTKQLKITRLPKNLIIHFKRFD-NFMNKNNIFVQYPYQLDLTSLWVNDYDGKLPPN 749

Query: 984  ------------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
                          KY+L  V  H+G L SGHYT+ V+K L          W+ FDD   
Sbjct: 750  FNEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDKGLYRG-------WFRFDDASY 802

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYERVYD 1060
            +   K G++      + D Y+LFY+R+Y+
Sbjct: 803  RP-VKFGTE----FLTPDAYLLFYQRIYE 826

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 62/141 (43%), Gaps = 8/141 (5%)

Query: 303 SIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVY 362
           S I   +L  +LS+   +  +LLID+R  +     HI AP ++ + P       T+  + 
Sbjct: 167 SFILPEKLHDLLSSH--KRNLLLIDVRTRKEFDTLHIDAPIILPIGPLSFKSTFTDLQIE 224

Query: 363 QDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLM--LTSQKTPLTT 420
           Q  +L    +E   F  R++F YIV Y+      T  +  V   F ++    S++     
Sbjct: 225 QTSLLTSTFQERNYFKKRNQFRYIVLYTKDDNDTTYYYTQVISLFNILTIAASKRNIDQI 284

Query: 421 VPTALL--GGYEKWKKTLHSY 439
            P+  +  GG   W +  HSY
Sbjct: 285 CPSIFILKGGITSWVQ--HSY 303

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 73/252 (28%), Positives = 109/252 (43%), Gaps = 43/252 (17%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656
           I GL N GN CY+N ++QCL        +F+ + Y N++   +S        L+ + + L
Sbjct: 445 IVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSK--GSKGLLAKNFATL 502

Query: 657 FNKMYLNGG--------CSVVPTGFLKV---INQLRPDLKIPDDQQDTQEFLMILLDRLH 705
              M+ N            V    F K+   IN +  D      QQD QEF   LLD LH
Sbjct: 503 VRNMHRNSAFMPVNSRTTPVQTIQFKKICGHINSIYSD----SMQQDCQEFCQFLLDGLH 558

Query: 706 DELSNQQHVANDYPNLLLYNAD-------VLKVSNNEYKHWFDKNVIGNGISPIDDIFQG 758
           ++L+  Q+   ++   L    +       + K S  E++ +     +    S I D+FQG
Sbjct: 559 EDLN--QNGGKEHLKQLTEEEEQKREKMTIRKASALEWERF-----LLTDFSAIIDLFQG 611

Query: 759 QMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEV 818
           Q  + LQC+ C  T+  Y TF VLS+ +P  +               + DC   FT  E 
Sbjct: 612 QYASRLQCQACDRTSTTYQTFSVLSVPVPRITT------------CNILDCFREFTKCEK 659

Query: 819 LSGENAWDCPRC 830
           L  +  W CPRC
Sbjct: 660 LGIDELWSCPRC 671

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 70/146 (47%), Gaps = 32/146 (21%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-----------LKN 981
            KK  + K +    LPK L+I+L RF   + K NN  + YP  L++            + N
Sbjct: 673  KKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYFLDLTPYWARDFNHEAIVN 731

Query: 982  NDT--------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
             D          +YRL+GV  H+G+L  GHYTS V K         +  WY+FDD + + 
Sbjct: 732  EDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PKKGWYFFDDSIYRP 784

Query: 1034 DKKHGSDKNLKISSSDVYVLFYERVY 1059
             +      N +  + + YVLFYER++
Sbjct: 785  IR-----FNDEFITPNAYVLFYERIF 805

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 2/89 (2%)

Query: 305 ITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQD 364
           I A +L S+L      + +LLID+R        HI   N++ ++P    D  T+  +   
Sbjct: 147 IDAGKLSSML--HFHGDTLLLIDVRPRSDFTKAHIKCKNIICIEPVSFKDSFTDRQLENV 204

Query: 365 DILEHLLKENENFANRDKFDYIVYYSDVK 393
            ++     + + F+NR+ F YIV Y+D +
Sbjct: 205 SLITSSQSDIDLFSNRNMFKYIVLYTDAQ 233

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 94.0 bits (232), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 112/246 (45%), Gaps = 36/246 (14%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL N+GN+CYIN +IQCL        +F++++Y+ ++    +++      L+   + L +
Sbjct: 516 GLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHIN--LNSKLGSKGVLAKHFARLIH 573

Query: 659 KMYLNGGC-------SVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 711
           +M+ +          +V P  F      +    +    QQD+QEF   LLD LH++L+  
Sbjct: 574 QMHQSAAFKKSDKNKAVRPYEFKMACGSINSLFR-ESGQQDSQEFCQFLLDGLHEDLN-- 630

Query: 712 QHVANDYPNLLLYNADVLK-------VSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSL 764
           Q   N     L   A+ ++        S+ E++ +  ++      S I D+FQGQ  + L
Sbjct: 631 QCGGNPPLKELSEEAEKMRERLSMRIASSIEWERYLTRD-----FSVIVDLFQGQYASQL 685

Query: 765 QCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENA 824
           +CK C +T+  Y  F +L+  +P              K   L DC   FT  E L  +  
Sbjct: 686 RCKVCNHTSTTYQPFSILAAPVP------------HAKSCYLLDCFKEFTKLEQLEKDEE 733

Query: 825 WDCPRC 830
           W CP C
Sbjct: 734 WLCPYC 739

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 70/148 (47%), Gaps = 34/148 (22%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII-LKNND-------- 983
            KK  + K +    LP+ L+IHL RF  +L  KNN ++ YP  L++     ND        
Sbjct: 741  KKQPSTKKLTITRLPRNLIIHLKRFD-NLLNKNNVLVNYPFFLDLTPFWANDFDGRLPPG 799

Query: 984  ------------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
                          KY+L+ V +H+G+L  GHYT+ V+K L          WYYFDD   
Sbjct: 800  VTDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGLNKG-------WYYFDDTGY 852

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYERVY 1059
            +  +        +  +S+ YVLFY RVY
Sbjct: 853  RPMRTP-----TECITSNAYVLFYHRVY 875

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 48/99 (48%), Gaps = 2/99 (2%)

Query: 293 IQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLL 352
           I S   L+    I+A EL  +L  + +   +LL+D+R        HI A N++ ++P   
Sbjct: 142 ISSDKELKTGGFISAKELEFLL--KSDDRNILLVDVRQRSEFEETHIKASNVICIEPISF 199

Query: 353 WDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSD 391
               T+  + +  ++     E + F  R++F +++ Y+D
Sbjct: 200 KSSYTDLELEKKSMITSPNVEIDIFKRRNEFTFVILYTD 238

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 110/255 (43%), Gaps = 49/255 (19%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYL---EPLASN------------ 641
           I GL+N+GN+CY+N +IQCL        +F+++ Y+ ++     L S             
Sbjct: 558 IVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFARLIH 617

Query: 642 --RPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMI 699
               H +PKL N+               V P  F   +  +    K    QQD QEF   
Sbjct: 618 LMHNHANPKLKNNY--------------VRPAQFKMAVGSVNTLFK-NCSQQDCQEFCQF 662

Query: 700 LLDRLHDELSNQQHVAN----DYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDI 755
           LLD LH++L+  Q  +N    +  +    N + L +       W  +  +    S I D+
Sbjct: 663 LLDGLHEDLN--QCGSNPPLKELSSAAEKNREKLSLRIASSIEW--ERFLTTDFSVIVDL 718

Query: 756 FQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTS 815
           FQGQ  + LQC+ C +T+  Y  F VLS+ IP     +         +V + DC   FT 
Sbjct: 719 FQGQYASRLQCEVCKHTSTTYQPFSVLSVPIPRVPKGV---------KVNILDCFKDFTK 769

Query: 816 DEVLSGENAWDCPRC 830
            E+L  +  W CP C
Sbjct: 770 LELLDTDEQWLCPTC 784

 Score = 72.0 bits (175), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 73/149 (48%), Gaps = 34/149 (22%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTM------- 985
            KK  + K +    LP+ L+IHL RF      KNN  I YP IL++     D         
Sbjct: 786  KKQRSTKKLTITRLPRNLIIHLKRFDN-NLNKNNNFIDYPFILDLTQFWVDDFDGKLPPG 844

Query: 986  --------------KYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
                          KY+L+GV +H G+L  GHYT+ V+K  +H        WYYFDD   
Sbjct: 845  VRDELPKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGPKHG-------WYYFDDTNY 897

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYERVYD 1060
            ++ K    +KN  I+SS  Y+LFY R+YD
Sbjct: 898  RSIK----NKNEPITSS-AYLLFYHRIYD 921

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 69/142 (48%), Gaps = 4/142 (2%)

Query: 294 QSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLW 353
           Q L  ++  S+I++ +L  +L  + +   VLLID+R     + +HI    ++ V+P    
Sbjct: 154 QELFSMKNGSLISSYQLKQLLYGKNDNTSVLLIDIRPRLEFSKSHIKHEEIICVEPISFK 213

Query: 354 DKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTS 413
           D  ++  V +  ++    +E + F  R++F++I+ Y++ K     N   VF+   L+  S
Sbjct: 214 DSYSDEEVAKKSLITSPNEEIDLFNKRNEFEFIILYTNDKEKAYYNQQMVFLEI-LLTHS 272

Query: 414 QKTPLTTVPTALL---GGYEKW 432
              PL +  T +L    G   W
Sbjct: 273 FAKPLDSWKTKVLILENGISSW 294

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 81.3 bits (199), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 109/258 (42%), Gaps = 52/258 (20%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYL---EPLASN-----------R 642
           I GL N+ N+CY+N +IQCL +      + +++++  ++     L S            +
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQ 487

Query: 643 PHHSPKLSNSLSML---FNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMI 699
             HS ++    S+       +     C+ V + +                QQD QEF   
Sbjct: 488 DMHSQQVKTGRSLFSYPVKTIDFKNACASVSSIYSG------------SQQQDCQEFCEF 535

Query: 700 LLDRLHDELSNQQHVANDYPNLLLYNAD-------VLKVSNNEYKHWFDKNVIGNGISPI 752
           LLD LH++L+       + P   L + +        ++V+++    W  +N + N  S I
Sbjct: 536 LLDGLHEDLN---QCGGNPPARELTDQEERLREGLCMRVASS--MAW--ENFLHNNFSLI 588

Query: 753 DDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINM 812
            D+F GQ  + L+C  C YT+  Y  F +LS+ +P           S   R  + DC   
Sbjct: 589 IDLFAGQYGSQLRCCVCQYTSTTYQPFTLLSVPVPL---------SSRVSRCSIIDCFQE 639

Query: 813 FTSDEVLSGENAWDCPRC 830
           FT  E L  +  W CP+C
Sbjct: 640 FTKCERLDKDEEWFCPQC 657

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 71/154 (46%), Gaps = 43/154 (27%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNI--------------- 977
            +K  + K +    LPK L+IH  RF  ++  KNN  I YP  L++               
Sbjct: 659  RKQPSTKQLKITRLPKNLIIHFKRFD-NMMNKNNIFIQYPYELDLTPFWVNDFNGELPLG 717

Query: 978  -----ILKNNDT--MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEV 1030
                 + K       KY+L  V  H GTL SGHYT+ VNK      D+G   WYYFDD  
Sbjct: 718  MTNSLLTKGGQVGPFKYQLNAVACHMGTLGSGHYTAYVNK----GPDVG---WYYFDD-- 768

Query: 1031 VKADKKHGSDKNLKISSS----DVYVLFYERVYD 1060
                    S + +KI++     D Y+LFY RVY+
Sbjct: 769  -------SSHRIVKIATEYMNPDAYLLFYHRVYN 795

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 14/92 (15%)

Query: 305 ITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQD 364
           +T P+L +ILS+  ++  VLLID+R       +HI +  ++ +DP       +  P Y  
Sbjct: 160 LTVPQLQTILSD--QKISVLLIDVRKRYEFEFSHINSVAVLPLDP------ISFKPTYTI 211

Query: 365 DILEHL------LKENENFANRDKFDYIVYYS 390
           D LE +      + E + F  R+++D IV Y+
Sbjct: 212 DQLEKISFINSPMHELQLFQKRNEYDVIVLYT 243

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 97/207 (46%), Gaps = 17/207 (8%)

Query: 594 SLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYL---EPLASNRPHHSPKLS 650
           SL ITGL NLGNTCY+NS +QC+     FR  F+ S Y+  L    PL   + H +   S
Sbjct: 317 SLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGY-QGHVAEAFS 375

Query: 651 NSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN 710
             +  LF    +    +  P  F   I      +     QQD+QEFL  LLD LH++L+ 
Sbjct: 376 ELIRCLFGDKLVQFS-AYAPNHFKATIGHFN-SMFSGYLQQDSQEFLAFLLDSLHEDLNR 433

Query: 711 QQHVANDYPNLLLYNAD------VLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSL 764
                      L   AD      V K++++ +K    +N      S I D+F G  +++L
Sbjct: 434 IDKKPYVEKPSLPSTADLNDFRIVKKLADDTWKAHLLRND-----SVITDLFVGLYKSTL 488

Query: 765 QCKRCGYTTFNYSTFYVLSLAIPTRSM 791
           +C  C   +  +  +  L+L +P +SM
Sbjct: 489 ECPECQNISITFDPYNDLTLPLPVKSM 515

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 62/144 (43%), Gaps = 22/144 (15%)

Query: 922  NDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPL----IL 975
            NDS      K  +  T K I     P +L+IHL RF      + K + V+ +P+    I 
Sbjct: 914  NDSWYCPTCKEHRQAT-KQIQLWNAPDVLLIHLKRFENQQSFSDKIDDVVQFPITDFDIS 972

Query: 976  NIILKNNDTMK--YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
              ++  +D     Y L  V NH G L  GHYT+      ++S D    KWYYFDD  V  
Sbjct: 973  EHLVYKDDPRGNVYDLIAVDNHYGGLGGGHYTAYA----KNSTD---GKWYYFDDSRVTE 1025

Query: 1034 DKKHGSDKNLKISSSDVYVLFYER 1057
                 S       +   Y+LFY R
Sbjct: 1026 TVAENS------ITGAAYLLFYLR 1043

 Score = 38.9 bits (89), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 802 KRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           K + L DC+N+F+  E+LS  ++W CP C
Sbjct: 894 KEITLNDCLNLFSKPEILSLNDSWYCPTC 922

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 104/226 (46%), Gaps = 40/226 (17%)

Query: 594 SLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRP-----HHSPK 648
           S  ITGL NLGNTCY+NS +QCL      R  F+   Y  + + +  N P     + +  
Sbjct: 289 SSGITGLYNLGNTCYMNSALQCLVHIPELRDYFL---YNCFEDEINCNNPLGYQGYVARA 345

Query: 649 LSNSLSMLFNKMYLNGGCSVV----PTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRL 704
            S  +  LF    L+ G ++     PTGF   I      +     QQD+QEF+  LLD L
Sbjct: 346 FSGLVQNLFGCKTLSSGSTLTPAYSPTGFKSTIGHFN-SMFSGYMQQDSQEFITFLLDGL 404

Query: 705 HDELS-------------NQQHVANDYPNLLLYNADVLK-VSNNEYKHWFDKNVIGNGIS 750
           H++L+             + +  +ND+        +V+K ++ + +K    +N      S
Sbjct: 405 HEDLNRIVDKPYIEKPSLSPEDDSNDF--------NVIKRLAEDTWKLHLQRN-----DS 451

Query: 751 PIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKL 796
            I D+F G  E++LQC  C   +  +  +  L+L +P  ++   K+
Sbjct: 452 VITDLFVGLYESTLQCPECNNVSITFDPYNDLTLPLPVNTVWHCKV 497

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 69/147 (46%), Gaps = 24/147 (16%)

Query: 920  GGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI--- 974
            G NDS      K  +  T K I     P +L+IHL RF      + K + V+ +P+    
Sbjct: 896  GMNDSWYCPSCKEHRQAT-KQIQLWDTPDVLLIHLKRFENLRSFSDKIDEVVHFPITGLD 954

Query: 975  LNIILKNNDTMK---YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDD-EV 1030
            ++  L N    +   Y L  V NH G L  GHYT+       ++ ++  SKWYYFDD  V
Sbjct: 955  MSPYLVNKGDPRGTIYDLVAVDNHYGGLGGGHYTA-------YAKNVDDSKWYYFDDSRV 1007

Query: 1031 VKADKKHGSDKNLKISSSDVYVLFYER 1057
             +   + G      I+SS  Y+LFY R
Sbjct: 1008 TETTPERG------IASS-AYLLFYVR 1027

 Score = 39.7 bits (91), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 795 KLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           K  +  EK++ L DC+ +F+  EVL   ++W CP C
Sbjct: 871 KRQQEEEKKITLHDCLKLFSKREVLGMNDSWYCPSC 906

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 75.5 bits (184), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 101/210 (48%), Gaps = 13/210 (6%)

Query: 594 SLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYK---NYLEPLASNRPHHSPKLS 650
           S    GL NLGNTCY+NS +QCL     F+  F+ + Y+   N   PL  ++ H +   +
Sbjct: 342 SKGTIGLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLG-HKGHIAWAFA 400

Query: 651 NSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELS- 709
           + +  LF K + +   S  P  F   I  L   +     QQD+QEFL  LLD LH++L+ 
Sbjct: 401 SMVQALFGKRH-SAATSYSPRNFKNTIGHLN-SMFSGYQQQDSQEFLAFLLDGLHEDLNR 458

Query: 710 --NQQHVANDYPNLLLYNADV-LKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 766
              + +V  + P L   +     KV        + K+ + N  S I D+F G  +++L C
Sbjct: 459 IIEKPYV--EKPELTSTDDTAEFKVIKKLADDTWGKHKLRND-SVITDLFVGLYKSTLIC 515

Query: 767 KRCGYTTFNYSTFYVLSLAIPTRSMKLSKL 796
             C  T+  +  +  L+L +P  S   +K+
Sbjct: 516 PVCKKTSVTFDPYNDLTLPLPVNSTWSNKV 545

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 66/152 (43%), Gaps = 23/152 (15%)

Query: 914  STPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITY 971
            STP   G  DS    + K  +  T K I     P IL+IHL RF      + K    + +
Sbjct: 972  STPEVLGATDSWFCPNCKEHRQAT-KQIELWNAPDILLIHLKRFENQRSFSDKIADTVHF 1030

Query: 972  P-----LILNIILKNNDTMK-YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYY 1025
            P     +   ++ KN D    Y L  V NH G L  GHYT+ V      ++D    KWYY
Sbjct: 1031 PITDLDMTPYLVYKNEDKGDIYDLIAVDNHYGGLGGGHYTAYVK-----NID---GKWYY 1082

Query: 1026 FDDEVVKADKKHGSDKNLKISSSDVYVLFYER 1057
            FDD  V       S     I+ S  Y+LFY R
Sbjct: 1083 FDDSRVSETLPERS-----IAGS-AYLLFYRR 1108

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 22/32 (68%)

Query: 799 STEKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           S EK++ L DC+ +F++ EVL   ++W CP C
Sbjct: 957 SGEKKITLHDCLTLFSTPEVLGATDSWFCPNC 988

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 75.5 bits (184), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 94/213 (44%), Gaps = 37/213 (17%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            GL NLGNTCY+NS +QCL      R  F    YKN +     N       ++N+ S L 
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEIN--LDNPLGFQGNIANAFSALV 455

Query: 658 NKMYLNG---GCSVVPTGFLKVI---NQLRPDLKIPDDQQDTQEFLMILLDRLHDELS-- 709
             +Y N      S  P+ F   I   NQ+         QQD+QEFL  LLD LH++L+  
Sbjct: 456 QNLYKNQFIPSASYAPSQFKLTIGHYNQMFSGYF----QQDSQEFLAFLLDGLHEDLNRI 511

Query: 710 -NQQHV----------ANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQG 758
            ++ +V           NDY  +    AD L+              +    S I D+F G
Sbjct: 512 KDKPYVEKPSLADGSDVNDYNIIARLAADTLEAH------------LKRNDSIIIDLFVG 559

Query: 759 QMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSM 791
             +++L+C  C + +  +  +  L+L IP  S+
Sbjct: 560 LYKSTLKCPVCNHVSITFDPYCDLTLPIPVESV 592

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 65/146 (44%), Gaps = 22/146 (15%)

Query: 920  GGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYD--LTKKNNTVITYP----- 972
            G NDS      K+ +  + K I   + P IL IHL RF      + K + V+ +P     
Sbjct: 978  GINDSWYCPKCKHHRQAS-KQIQLWSTPDILTIHLKRFETQGSFSDKIDDVVDFPINGLD 1036

Query: 973  LILNIILKNNDTMK-YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            L  +I+ K+   +  Y L  V NH G L  GHYT+ +   +++       KWYYFDD  V
Sbjct: 1037 LSKHILDKSTSQLNIYDLIAVDNHYGGLGGGHYTAYIKNLIDN-------KWYYFDDSRV 1089

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYER 1057
                   S       +   Y+LFY R
Sbjct: 1090 SETVPERS------VAGSAYLLFYMR 1109

 Score = 39.3 bits (90), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 792 KLSKLGRSTE-KRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           K  +LG+  E K + LED +N+F   EVL   ++W CP+C
Sbjct: 949 KTRELGQDKEEKNITLEDSLNLFERAEVLGINDSWYCPKC 988

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 106/246 (43%), Gaps = 31/246 (12%)

Query: 589 PNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPK 648
           PN      I G++N GN CY+N +IQCL     F   F+ + Y   +    ++R  H   
Sbjct: 335 PNYTSPTVIKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTIN--VNSRLGHQGL 392

Query: 649 LSNSLSMLFNKMYLNGGCSVVP----TGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRL 704
           +  + + +    +     ++ P    T F +    L P+      Q D  EF + LL+ +
Sbjct: 393 VVKNWAKIIQAFFQVSQENIQPAVSITEFREQWANLFPEYG-KYQQHDCSEFCLRLLEEI 451

Query: 705 HDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSL 764
           H++ SN     N    + +          ++Y+  ++    GN  S I D F+GQ+++ L
Sbjct: 452 HED-SNWGRPQNSDAAMQV----------DDYREAWNLYRKGNS-SYIVDTFKGQIKSQL 499

Query: 765 QCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENA 824
            C+ C   + NY  F +L+L IP  SM              + DC+       VL+G++ 
Sbjct: 500 TCQVCQTQSNNYEPFSILNLPIPLVSM------------CHIYDCMKELFKVHVLTGDDR 547

Query: 825 WDCPRC 830
           W C  C
Sbjct: 548 WYCSTC 553

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 68/141 (48%), Gaps = 19/141 (13%)

Query: 921  GNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILK 980
            G+D       K K  +T+ T     +P++L+IH +RF  +L  K    + YP +L++   
Sbjct: 544  GDDRWYCSTCKTKTHSTLGT-TITNVPEVLIIHFNRFD-NLLNKKECFVKYPYLLDLSQG 601

Query: 981  NNDTMK----YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKK 1036
            N    K    Y+L  V  HTGTL SGHYT+   K+ E+        WY+FDD   K    
Sbjct: 602  NGLLGKCDVPYKLVAVACHTGTLFSGHYTAYCFKNSENG-------WYHFDDTQCKP--- 651

Query: 1037 HGSDKNLKISSSDVYVLFYER 1057
                 N +  S   Y+LFY++
Sbjct: 652  ---VSNGECISQSAYLLFYQK 669

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 105/233 (45%), Gaps = 57/233 (24%)

Query: 594 SLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRP-HHSPKLSNS 652
           S  ITGL NLGNTCY+NS +QCL      R  F+   Y  +   + S+ P  +   ++ +
Sbjct: 298 SQGITGLTNLGNTCYMNSALQCLVHIPELRDYFL---YDGFTSEINSDNPLGYQGNIAKA 354

Query: 653 LSMLFNKMY-------------------LNGGCSVVPTGFLKVINQLRPDLKIPDDQQDT 693
            S+L   ++                   + G C+ + +G++               QQD+
Sbjct: 355 FSLLVKSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYM---------------QQDS 399

Query: 694 QEFLMILLDRLHDELSNQQHVANDYPNL----LLYNADVL------KVSNNEYKHWFDKN 743
           QEFL  LLD LH++L N+ H   D P +    L  N+DV       K++ + +K    +N
Sbjct: 400 QEFLAFLLDGLHEDL-NRVH---DKPYIEKPSLSPNSDVTDRDTIKKLAEDTWKMHLLRN 455

Query: 744 VIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKL 796
                 S + D+F    E++L+C  C   +  +  +  L+L +P  +   SK+
Sbjct: 456 -----DSIVTDLFVALYESTLECPECRNVSITFDPYNDLTLPLPVNTTWHSKV 503

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 64/143 (44%), Gaps = 23/143 (16%)

Query: 922  NDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYP-----LI 974
            NDS      K+ +  T K I   + P +L+IHL RF      + K +  + +P     + 
Sbjct: 888  NDSWYCPTCKDHRQAT-KQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMT 946

Query: 975  LNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1034
             +++ ++     Y L  V NH G L  GHYT+ V  +          KW+YFDD  V   
Sbjct: 947  EHLVHEDPRGSIYDLIAVDNHFGGLGGGHYTAYVKTN---------DKWFYFDDSRVTET 997

Query: 1035 KKHGSDKNLKISSSDVYVLFYER 1057
            K   S     I+ S  Y+LFY R
Sbjct: 998  KPESS-----IAGS-AYLLFYLR 1014

 Score = 38.9 bits (89), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 795 KLGRSTEKR-VKLEDCINMFTSDEVLSGENAWDCPRC 830
           K     EKR + L DC+ +F+  EVLS  ++W CP C
Sbjct: 860 KEAEGQEKRAISLHDCLKLFSKKEVLSMNDSWYCPTC 896

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 72.0 bits (175), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 93/212 (43%), Gaps = 28/212 (13%)

Query: 594 SLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRP-----HHSPK 648
           S    GL NLGNTCY+NS +QCL      R  F+   Y  + + +  N P     H +  
Sbjct: 317 STGTIGLSNLGNTCYMNSGLQCLVHIPQIRDYFV---YNGFEKEINVNNPLGFQGHMARS 373

Query: 649 LSNSLSMLFNKMYLNGGCSVVPTGFLKVI---NQLRPDLKIPDDQQDTQEFLMILLDRLH 705
               +  LF          V PT F   +   N +    +    QQD+QEFL  LLD LH
Sbjct: 374 FHGLIQSLFGDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQ----QQDSQEFLAFLLDSLH 429

Query: 706 DELSNQQHVANDY-------PNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQG 758
           ++L+  + V   Y       P   + + D +K   NE   W  K+ +    S I DIF G
Sbjct: 430 EDLN--RIVEKPYVEKPSLKPGDDINDFDTIKKLANE--TW--KSHLMRNDSIITDIFVG 483

Query: 759 QMENSLQCKRCGYTTFNYSTFYVLSLAIPTRS 790
             +++L+C  C   +  +  +  L+L +P  S
Sbjct: 484 MYKSTLECPECSNVSITFDPYNDLTLPLPINS 515

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 786 IPTRSMKLSKLGRST--EKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           I  + ++  KL  S   E+   L+DC+N+F+  EVL   ++W CP C
Sbjct: 873 ISNKELESIKLAESAHVEQETTLKDCLNLFSKKEVLGMSDSWYCPNC 919

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 65/146 (44%), Gaps = 22/146 (15%)

Query: 920  GGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPL---- 973
            G +DS    + K  +  T K I     P + +IHL RF      + K +  I +P+    
Sbjct: 909  GMSDSWYCPNCKEHRQAT-KKIELWNTPDVFLIHLKRFENTRSFSDKIDATILFPIEDLD 967

Query: 974  ILNIILKNNDTMK--YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            +   ++  +D     Y L  V NH G +  GHYT+ V        ++    WYYFDD  V
Sbjct: 968  MSEYLVYKDDPRGSVYDLIAVDNHYGGMGGGHYTAYVK-------NLTDQNWYYFDDSRV 1020

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYER 1057
                K   +K++  S+   Y+LFY R
Sbjct: 1021 ---SKTSPEKSIAGSA---YLLFYLR 1040

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 71.6 bits (174), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 100/216 (46%), Gaps = 33/216 (15%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRP-HHSPKLSNSLSML 656
           TGL NLGN+CY+NS +QCL      +  F+   Y  Y E + +  P  +   ++ + + L
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFL---YGGYEEDVNTQNPLGYKGLVAQAFAAL 390

Query: 657 FNKMYLNGGCSVV---PTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQH 713
              ++     S     P  F  +I Q +  +     QQD+QEFL  LLD LH++L     
Sbjct: 391 IKSLFDERSSSAFAFSPREFKSIIGQ-QNSMFAGFLQQDSQEFLAFLLDGLHEDL----- 444

Query: 714 VANDYPNLLLYNADVLK--------VSNNEYKH-----WFDKNVIGNGISPIDDIFQGQM 760
                 N ++    V K        V+N E  H      +DK+ + N  S I D+F G  
Sbjct: 445 ------NRIIEKPFVEKPELSPDEDVNNREVIHRLASKTWDKHKLRND-SVILDLFVGLY 497

Query: 761 ENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKL 796
           +++L C  C  T+  +  +  L+L +P  S+  SK+
Sbjct: 498 KSTLTCPVCDKTSVTFDPYSDLTLPLPVESIWTSKV 533

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 58/129 (44%), Gaps = 21/129 (16%)

Query: 937  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI-LNII--LKNNDTMK---YR 988
              K I     P IL IHL RF   +  + K + V+ +P+  LN+   L   D  +   Y 
Sbjct: 935  ATKQIQLWNSPDILTIHLKRFESRHSFSDKISDVVDFPICGLNMSDHLVCEDAEQNNLYD 994

Query: 989  LFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISSS 1048
            L  V NH G L  GHYT+     ++        KWYYFDD  V       +D    +S +
Sbjct: 995  LVAVDNHYGGLGGGHYTAFAKNPVD-------GKWYYFDDSRVSE-----TDPETSVSGA 1042

Query: 1049 DVYVLFYER 1057
              Y+LFY R
Sbjct: 1043 -AYLLFYRR 1050

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 801 EKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           E+R+ L DC+ +F+  EVLS  ++W CP C
Sbjct: 900 ERRISLFDCLKLFSKPEVLSAADSWYCPTC 929

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 97/208 (46%), Gaps = 16/208 (7%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYL--EPLASNRPHHSPKLSNSLSML 656
           GL NLGNTCY+NS +QCL      R  F+ S Y+  L  + L   + + +   S+ +  L
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDNLIGYKGYVAKAFSSLVQNL 383

Query: 657 FNKMYLNGG--CSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN-QQH 713
           F       G   S  P  F   +      +     QQD+QEFL  LLD LH++L+     
Sbjct: 384 FGDTITKQGTNSSFGPNHFKSTVGHFNS-MFSGYLQQDSQEFLAFLLDSLHEDLNRIINK 442

Query: 714 VANDYPNLLL---YN--ADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKR 768
            + + P+L     YN  A +  +++  +K    +N      S I D+F G  +++L+C  
Sbjct: 443 PSTEKPSLKEGDDYNDPAVIKSLADETWKMHLLRN-----DSVITDLFVGMYKSTLECPE 497

Query: 769 CGYTTFNYSTFYVLSLAIPTRSMKLSKL 796
           C   +  +  +  L+L +P  S   SK+
Sbjct: 498 CTNVSITFDPYSDLTLPLPVDSTWSSKV 525

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 68/146 (46%), Gaps = 22/146 (15%)

Query: 920  GGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYP---LI 974
            G NDS      K  +  + K I     P +L+IHL RF      + K +  + +P   L 
Sbjct: 888  GLNDSWYCPHCKEHRQAS-KRIQLWNTPDVLLIHLKRFENQRSFSDKIDATVNFPIENLD 946

Query: 975  LNIILKNNDTMK---YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            ++  L + D  +   Y L+ V NH G L  GHYT+ V   +++       KWYYFDD  V
Sbjct: 947  MSPYLVHKDDPRGTVYDLYAVDNHYGGLGGGHYTAYVKNFIDN-------KWYYFDDSRV 999

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYER 1057
                 + +D    +S S  Y+LFY R
Sbjct: 1000 -----YETDPEKSVSGS-AYLLFYLR 1019

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 761 ENSLQCKRCGYT---TFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDE 817
           E SL+  R  ++     N+    VL   +    +K  +    ++K + L DC+N+F+  E
Sbjct: 827 EWSLESSRLAFSEEKVINWENPGVLQ-NVELEELKTQREVDGSDKEITLNDCLNLFSKRE 885

Query: 818 VLSGENAWDCPRC 830
           VL   ++W CP C
Sbjct: 886 VLGLNDSWYCPHC 898

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 95/205 (46%), Gaps = 9/205 (4%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656
           I GL NLGN+CY+NS +QCL      R  F+   ++  +    SN   +  +++ + + L
Sbjct: 297 IVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDIN--TSNPLGYQGQIAQAFAAL 354

Query: 657 FNKMYLNGGCSV---VPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQH 713
              ++ +   ++    P  F  +I      +     QQD+QE L  LLD LH++L+    
Sbjct: 355 VKSLFDDKASALQAFSPRAFKSIIGH-HNGMFAGFLQQDSQELLAFLLDGLHEDLNRIMK 413

Query: 714 VANDYPNLLLYNADV--LKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGY 771
                   L  + DV  + V  N     ++K+ + N  S I D+F G  +++L C  C  
Sbjct: 414 KPFVEKPELASSDDVNDIDVIRNLASLTWEKHKLRNE-SVIVDLFVGLYKSTLTCPACDR 472

Query: 772 TTFNYSTFYVLSLAIPTRSMKLSKL 796
            +  +  F  L+L +P  S   +K+
Sbjct: 473 VSVTFDPFSDLTLPLPVESFWSAKV 497

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 63/147 (42%), Gaps = 24/147 (16%)

Query: 920  GGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI--- 974
            G  DS    + K  +  T K I     P IL IHL RF   +  + K + V+ +P+    
Sbjct: 888  GAADSWYCPNCKEHRQAT-KQIQLWNTPDILTIHLKRFENRHSFSDKISDVVDFPITGLD 946

Query: 975  ----LNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEV 1030
                L     N ++M Y L  V NH G L  GHYT+ V   ++        KWYYFDD  
Sbjct: 947  MSEHLVCHDPNQNSM-YDLIAVDNHYGGLGGGHYTAYVKNFMD-------GKWYYFDDSR 998

Query: 1031 VKADKKHGSDKNLKISSSDVYVLFYER 1057
            V   +        +  S   Y+LFY R
Sbjct: 999  VSETEAE------RAISGAAYLLFYRR 1019

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 4/46 (8%)

Query: 789 RSMKLSKLG--RSTEKR--VKLEDCINMFTSDEVLSGENAWDCPRC 830
           R+M L +    RS +++  + L DC+ +F+  EVL   ++W CP C
Sbjct: 853 RNMALEEAQKHRSEQEKGHISLTDCLELFSKSEVLGAADSWYCPNC 898

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 104/216 (48%), Gaps = 17/216 (7%)

Query: 590 NVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKL 649
           N+  S    GL NLGNTCY+NS +QC+     FR  F+   ++   E    N   +   +
Sbjct: 322 NLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQK--EVNEGNPLGYQGYM 379

Query: 650 SNSLSMLFNKMY---LNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHD 706
           + + S L   ++   +    +  P+ F   +      +     QQD+QEFL  LLD LH+
Sbjct: 380 ARAFSDLIQSLFGDNITSTTAYSPSYFKSTLGHFN-SMFSGYLQQDSQEFLAFLLDSLHE 438

Query: 707 ELSN-QQHVANDYPNLLLY----NADVLK-VSNNEYKHWFDKNVIGNGISPIDDIFQGQM 760
           +L+   +    + P+L L     + DV+K ++++ +K    +N      S I D+F    
Sbjct: 439 DLNRIDKKPYVEKPSLPLTANLNDFDVVKRLADDTWKAHLLRND-----SVITDLFVAMY 493

Query: 761 ENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKL 796
           +++L+C  C  T+  +  +  L+L +P  S+  +K+
Sbjct: 494 KSTLKCPECQNTSVTFDPYNDLTLPLPVASIWHTKV 529

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 64/152 (42%), Gaps = 22/152 (14%)

Query: 914  STPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVIT--Y 971
            S P     NDS      K  +  T K I     P IL+IHL RF    +  +  V T  +
Sbjct: 949  SKPEILSSNDSWYCPHCKEHRQAT-KQIELWNTPDILLIHLKRFENQRSFSDKIVDTVFF 1007

Query: 972  PL----ILNIILKNNDTMK--YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYY 1025
            P+    I   ++   D     Y L  V NH G L  GHYT+       ++ +   +KWYY
Sbjct: 1008 PITDFDISEHLVYKEDPRGNVYDLIAVDNHYGGLGGGHYTA-------YAKNANDNKWYY 1060

Query: 1026 FDDEVVKADKKHGSDKNLKISSSDVYVLFYER 1057
            FDD  V       S     I+ S  Y+LFY R
Sbjct: 1061 FDDSRVSVTAPEKS-----IAGS-AYLLFYVR 1086

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 798 RSTEKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           +  E+ + L+DC+ +F+  E+LS  ++W CP C
Sbjct: 933 KQEERHITLDDCLKLFSKPEILSSNDSWYCPHC 965

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 99/209 (47%), Gaps = 26/209 (12%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
           TGL NLGNTCY+NS +QCL      R  F+   Y+N +     N   +   ++ + S L 
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEIN--EENPLGYHGYVARAFSDLI 421

Query: 658 NKMYLN------GGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 711
            K++ N         +  P+ F   +      +     QQD+QEFL  LLD LH++L+  
Sbjct: 422 QKIFQNRLSVMQRNGAFPPSMFKSTVGHFN-SMFSGYMQQDSQEFLAFLLDSLHEDLN-- 478

Query: 712 QHVANDY---PNLLL------YNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMEN 762
           + +  +Y   P+L        +N  V K++++ ++    +N      S I D+F G  ++
Sbjct: 479 RIIKKEYIEKPSLSPGDDVDDWNV-VKKLADDTWEMHLKRNC-----SVITDLFVGMYKS 532

Query: 763 SLQCKRCGYTTFNYSTFYVLSLAIPTRSM 791
           +L C  C   +  +  +  ++L +P  ++
Sbjct: 533 TLYCPECKNVSITFDPYNDVTLPLPVDTV 561

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 67/152 (44%), Gaps = 22/152 (14%)

Query: 914  STPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITY 971
            S P   G +DS      K  +  T K I     P IL+IHL RF      + K +  + +
Sbjct: 968  SKPEILGLSDSWYCPTCKEHRQAT-KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNF 1026

Query: 972  P-----LILNIILKNNDTMK-YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYY 1025
            P     L  N++ K++     Y L+ V NH G L  GHYT+ V        +   +KWYY
Sbjct: 1027 PITDLDLSKNVVYKDDPRGSIYDLYAVDNHYGGLGGGHYTAYVK-------NFANNKWYY 1079

Query: 1026 FDDEVVKADKKHGSDKNLKISSSDVYVLFYER 1057
            FDD  V       S     I+ S  Y+LFY R
Sbjct: 1080 FDDSRVTETVPENS-----IAGS-AYLLFYIR 1105

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%)

Query: 794 SKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           S+   + E+ + L+DC+ +F+  E+L   ++W CP C
Sbjct: 948 SERSNAKERTITLDDCLQLFSKPEILGLSDSWYCPTC 984

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 99/208 (47%), Gaps = 24/208 (11%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
           TGL NLGNTCY+NS +QCL      R  F+   Y++ +     N   +   ++ + S L 
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEIN--EENPLGYHGYVARAFSDLV 421

Query: 658 NKMYLN------GGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 711
            K++ N         +  P+ F   I      +     QQD+QEFL  LLD LH++L+  
Sbjct: 422 QKLFQNRMSIMQRNAAFPPSMFKSTIGHFNS-MFSGYMQQDSQEFLAFLLDSLHEDLN-- 478

Query: 712 QHVANDY-------PNLLLYNADVL-KVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENS 763
           + +  +Y       P   + + +V+ K++++ ++    +N      S I D+F G  +++
Sbjct: 479 RIIKKEYTEKPSLSPGDDVNDWNVVKKLADDTWEMHLKRNC-----SVITDLFVGMYKST 533

Query: 764 LQCKRCGYTTFNYSTFYVLSLAIPTRSM 791
           L C  C   +  +  +  ++L +P  ++
Sbjct: 534 LYCPECQNVSITFDPYNDVTLPLPVDTV 561

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 58/129 (44%), Gaps = 21/129 (16%)

Query: 937  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPL----ILNIILKNND--TMKYR 988
              K I     P IL+IHL RF      + K +  + +P+    +   ++  +D   + Y 
Sbjct: 994  ATKQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSRYVVYKDDPRGLIYD 1053

Query: 989  LFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISSS 1048
            L+ V NH G L  GHYT+ V        +   +KWYYFDD  V       S     I+ S
Sbjct: 1054 LYAVDNHYGGLGGGHYTAYVK-------NFADNKWYYFDDSRVTETAPENS-----IAGS 1101

Query: 1049 DVYVLFYER 1057
              Y+LFY R
Sbjct: 1102 -AYLLFYIR 1109

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 785 AIPTRSMKLSKLGRST--EKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
            +P + ++ +KL RS   E+ + L+DC+ +F+  E+L   ++W CP C
Sbjct: 941 TLPNKELENAKLERSNAKERTITLDDCLQLFSKPEILGLTDSWYCPTC 988

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 95/212 (44%), Gaps = 23/212 (10%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRP-HHSPKLSNSLSM 655
           I GL NLGNTCY+NS +QCL         F+   YK Y   +  N P  H   ++++   
Sbjct: 338 IMGLSNLGNTCYMNSALQCLLHIPELNEYFL---YKGYEREININNPLGHKGDVAHAFGH 394

Query: 656 LFNKMYLNG-GCSV--VPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELS--- 709
           L   ++    G S    P  F   I      L     QQD+QEFL  LLD LH++L+   
Sbjct: 395 LLYSLFAPSYGQSTFYAPRNFKNTIGHYN-SLFAGYGQQDSQEFLAFLLDGLHEDLNRVI 453

Query: 710 -----NQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSL 764
                N+    ND    +     ++ ++ N + +   +N      S I D+F G  +++L
Sbjct: 454 EKPYVNKPEFPND--GQIDDTDQIVLLAANMWDYIKKRND-----SVIMDLFVGLYKSTL 506

Query: 765 QCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKL 796
            C  C + +  +  +  L+L +P  +   +K+
Sbjct: 507 VCPNCNHVSITFDPYNDLTLPLPIENYWSTKV 538

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 55/127 (43%), Gaps = 21/127 (16%)

Query: 939  KTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYP---LILNIIL---KNNDTMKYRLF 990
            K I     P IL+IHL RF      + K +  + +P   L ++  L   K  +   Y L 
Sbjct: 936  KQIELWNTPDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDVYDLI 995

Query: 991  GVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISSSDV 1050
             V NH G L  GHYT+     ++        KWYYFDD  V       S     I+ S  
Sbjct: 996  AVDNHYGGLGGGHYTAYCRNFID-------GKWYYFDDSRVNEVSPENS-----IAGS-A 1042

Query: 1051 YVLFYER 1057
            Y+LFY R
Sbjct: 1043 YLLFYRR 1049

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 792 KLSKLGRSTEKR-VKLEDCINMFTSDEVLSGENAWDCPRC 830
           ++ K    TEK  + L+ C+ +F+  E+L   ++W CP C
Sbjct: 889 EVRKTRAQTEKSSITLDSCLRLFSQPEILGSADSWYCPNC 928

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 93/206 (45%), Gaps = 17/206 (8%)

Query: 596 SITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYK---NYLEPLASNRPHHSP---KL 649
            I GL NLGNTCY+NS +QCL      R  F    Y+   N   PL  N    +     +
Sbjct: 287 GIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGYNGTVATAFGNLI 346

Query: 650 SNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 709
            N  S  +N+       S  P  F   + Q    +     QQD+QEFL  LLD LH++L 
Sbjct: 347 QNLYSYHWNQQQYQ---SYSPNRFKMTLGQAN-SMFAGYMQQDSQEFLAFLLDSLHEDL- 401

Query: 710 NQQHVAN--DYPNLLLYN--ADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQ 765
           N+ H     + P L      AD   V     K W D ++  N  S I+D+F G  +++L+
Sbjct: 402 NRIHDKPYIEKPTLETSEELADENAVKQLAKKTW-DAHLARND-SVINDLFVGMYKSTLK 459

Query: 766 CKRCGYTTFNYSTFYVLSLAIPTRSM 791
           C  C   +  +  +  L+L +P  ++
Sbjct: 460 CPTCKNISITFDPYNDLTLPLPISTV 485

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 73/152 (48%), Gaps = 26/152 (17%)

Query: 914  STPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITY 971
            S P   G NDS      K  +  T K +     P+IL+IHL RF      + K + V+ +
Sbjct: 855  SKPEVLGINDSWYCPKCKEHRQAT-KQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDF 913

Query: 972  PL--------ILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKW 1023
            P+        +++ +++  D   Y LF V NH G L  GHYTS V  ++++       +W
Sbjct: 914  PIEGLDMTPYVVDSVVE--DGCIYDLFAVDNHYGGLGGGHYTSYVKNNIDN-------RW 964

Query: 1024 YYFDDEVVKADKKHGSDKNLKISSSDVYVLFY 1055
            YYFDD  V +     +D    ++ S  Y+LFY
Sbjct: 965  YYFDDSRVSS-----TDPKKSVAGS-AYLLFY 990

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 804 VKLEDCINMFTSDEVLSGENAWDCPRC 830
           + L+ C+ +F+  EVL   ++W CP+C
Sbjct: 845 ITLDSCLKLFSKPEVLGINDSWYCPKC 871

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 97/198 (48%), Gaps = 17/198 (8%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRP-HHSPKLSNSLSMLF 657
           GL NLGNTCY+NS +QCL      R  F+   YK + + +  + P  +   ++ S ++L 
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFL---YKVFEKEINLDNPLGYQGHVARSFAILI 399

Query: 658 NKMY---LNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL---SNQ 711
             ++   L    S  PT F   +      +     QQD+QEF+  LLD LH++L   +N+
Sbjct: 400 QNLFKDELLPSLSYSPTTFKSTVGHFNS-MFSGYLQQDSQEFIAFLLDGLHEDLNRITNK 458

Query: 712 QHVANDY--PNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 769
             V      P   + N +V+K   ++    ++ +++ N  S I DIF G  +++L C  C
Sbjct: 459 PVVEKPSLKPEDDVSNQEVIKKLADDT---WNSHLLRND-SIITDIFVGLYKSTLHCPEC 514

Query: 770 GYTTFNYSTFYVLSLAIP 787
              +  +  +  L+L +P
Sbjct: 515 DNLSVTFDPYNDLTLPLP 532

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 69/149 (46%), Gaps = 22/149 (14%)

Query: 920  GGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI--- 974
            G NDS      K  +  T K +   + P IL+IHL RF      + K +  + +P+    
Sbjct: 925  GMNDSWYCPTCKEHRQAT-KQLQLWSTPDILLIHLKRFENQSSFSDKIDDTVYFPITDLD 983

Query: 975  LNIILKNNDTMK---YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            L+  + NND  K   Y L  V NH G L  GHYT+ V    ++ VD    KWYYFDD  V
Sbjct: 984  LSPYVVNNDESKSTIYDLVSVDNHYGGLGGGHYTAYV----KNFVD---KKWYYFDDSRV 1036

Query: 1032 KADKKHGSDKNLKISSSDVYVLFYERVYD 1060
                   S     I+ S  Y+LFY R  D
Sbjct: 1037 TETVPERS-----IAGS-AYLLFYMRRSD 1059

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 801 EKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           EK++ L+DC+N+F   EVL   ++W CP C
Sbjct: 906 EKKITLDDCLNLFAKKEVLGMNDSWYCPTC 935

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 65.1 bits (157), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 97/207 (46%), Gaps = 22/207 (10%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYK---NYLEPLASNRPHHSPKLSNSLS 654
           TGL NLGNTCY+NS +QCL      R  F+ + Y+   N   PL  +  + +   S+ + 
Sbjct: 361 TGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENPLGYH-GYVARAFSDLIQ 419

Query: 655 MLF----NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN 710
            LF    N M  NG  +  PT F   I      +     QQD+QEFL  LLD LH++L+ 
Sbjct: 420 KLFQNKLNIMQRNG--AFPPTMFKSTIGHFNS-MFSGYMQQDSQEFLAFLLDSLHEDLNR 476

Query: 711 QQHVANDYPNLLLYNADV------LKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSL 764
               A      L  + DV       K++++ ++    +N      S I D+F G  +++L
Sbjct: 477 IIKKAYIEKPSLSPDDDVNDWNVIKKLADDTWELHLKRNR-----SVITDLFVGMYKSTL 531

Query: 765 QCKRCGYTTFNYSTFYVLSLAIPTRSM 791
            C  C   +  +  +  ++L +P  ++
Sbjct: 532 YCPECKDVSTTFDPYNDVTLPLPVDTV 558

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 66/152 (43%), Gaps = 22/152 (14%)

Query: 914  STPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITY 971
            S P   G NDS      K  +  T K I     P IL+IHL RF      + K +  + +
Sbjct: 971  SKPEILGLNDSWYCPTCKEHRQAT-KQIQLWNTPDILLIHLKRFESQRSFSDKIDDTVNF 1029

Query: 972  P-----LILNIILKNNDTMK-YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYY 1025
            P     L  +++ K++     Y L+ V NH G L  GHYT+ V   +++       KWYY
Sbjct: 1030 PITDLDLSEHVVYKDDPRGSIYDLYAVDNHYGGLGGGHYTAYVKNFMDN-------KWYY 1082

Query: 1026 FDDEVVKADKKHGSDKNLKISSSDVYVLFYER 1057
            FDD  V       S       +   Y+LFY R
Sbjct: 1083 FDDSRVTETVPENS------VAGSAYLLFYIR 1108

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 786 IPTRSMKLSKLGR--STEKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           +P   ++  KL R  + E+ + L DC+ +F+  E+L   ++W CP C
Sbjct: 941 LPNTELEKVKLERCNAKERTITLNDCLQLFSKPEILGLNDSWYCPTC 987

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 92/204 (45%), Gaps = 11/204 (5%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYK---NYLEPLASNRPHHSPKLSNSLSM 655
           GL NLGNTCY+NS +QCL     F+  F+ + Y+   N   PL  ++ H +      +  
Sbjct: 350 GLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEINVDNPLG-HKGHIAWAFGTLIQS 408

Query: 656 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELS---NQQ 712
           LF K   N   S  P  F   I  L   +     QQD+QEFL  LLD LH++L+   ++ 
Sbjct: 409 LFGKRN-NLISSYSPRHFKTTIGHLN-SMFAGYQQQDSQEFLAFLLDGLHEDLNRIVDKP 466

Query: 713 HVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYT 772
           +V     N      +   +       W    +  + +  I D+F G  +++L C  C   
Sbjct: 467 YVEKPELNPTDDVTEFETIKKLADDTWLKHKLRNDSV--ILDLFVGLYKSTLICPTCKKV 524

Query: 773 TFNYSTFYVLSLAIPTRSMKLSKL 796
           +  +  +  L+L +P  S   +K+
Sbjct: 525 STTFDPYNDLTLPLPVDSTWSNKV 548

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 84/195 (43%), Gaps = 27/195 (13%)

Query: 873  LDIFGDSNGEGNNINNTMI--FERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDF 930
            L +  DS GE   + NT +   +RER+    K +      +  STP   G  DS      
Sbjct: 907  LKVNWDSPGE---VPNTELEASKRERNAQEEKKITLHDCLTLFSTPEVLGATDSWYCPSC 963

Query: 931  KNKKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI---LNIILKNNDTM 985
            K  +  T K I     P IL+IHL RF      + K   ++ +P+    ++  L   D  
Sbjct: 964  KEHRQAT-KQIELWNTPDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKDDK 1022

Query: 986  K---YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKN 1042
            K   Y L  V NH G L  GHYT+ V   L++       KWYYFDD  V       S   
Sbjct: 1023 KGTIYDLIAVDNHYGGLGGGHYTAYVKNFLDN-------KWYYFDDSRVNETVPERS--- 1072

Query: 1043 LKISSSDVYVLFYER 1057
              I+ S  Y+LFY R
Sbjct: 1073 --IAGS-AYLLFYRR 1084

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 786 IPTRSMKLSKLGRST--EKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           +P   ++ SK  R+   EK++ L DC+ +F++ EVL   ++W CP C
Sbjct: 917 VPNTELEASKRERNAQEEKKITLHDCLTLFSTPEVLGATDSWYCPSC 963

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 96/206 (46%), Gaps = 20/206 (9%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
           TGL NLGNTCY+NS +QCL      R  F+ + Y++ +     N   +   ++ + S L 
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEIN--EENPLGYHGYVARAFSDLV 421

Query: 658 NKMYLNGGCSVV------PTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 711
            K++ N   S+       P+ F   +      +     QQD+QEFL  LLD LH++L+  
Sbjct: 422 QKLFHNKLSSMQRNAAFPPSMFKSTVGHFN-SMFSGYMQQDSQEFLAFLLDSLHEDLNRI 480

Query: 712 QHVANDYPNLLLYNAD------VLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQ 765
              A      L  + D      V K++++ ++    +N      S I D+F G  +++L 
Sbjct: 481 IKKAYIEKPSLSPDDDVNDWNVVKKLADDTWEMHLKRNC-----SVITDLFVGLYKSTLY 535

Query: 766 CKRCGYTTFNYSTFYVLSLAIPTRSM 791
           C  C   +  +  +  ++L +P  ++
Sbjct: 536 CPECKNVSITFDPYNDVTLPLPVDTV 561

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/171 (30%), Positives = 74/171 (43%), Gaps = 22/171 (12%)

Query: 895  ERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHL 954
            ERS +  +++         S P   G NDS      K  +  T K I     P IL++HL
Sbjct: 955  ERSNAKERIITLDDCLQLFSKPEILGLNDSWYCPTCKEHRQAT-KQIQLWNTPDILLVHL 1013

Query: 955  SRF--YYDLTKKNNTVITYPLIL-----NIILKNNDTMK-YRLFGVVNHTGTLISGHYTS 1006
             RF      + K +  + +P+       +++ K++     Y L+ V NH G L  GHYT+
Sbjct: 1014 KRFESQRSFSDKIDATVNFPVTALDLSKHVVHKDDPRGSIYDLYAVDNHYGGLGGGHYTA 1073

Query: 1007 LVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISSSDVYVLFYER 1057
             V        +   SKWYYFDD  V       S     IS S  Y+LFY R
Sbjct: 1074 YVK-------NFADSKWYYFDDSRVTETVPENS-----ISGS-AYLLFYIR 1111

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 745 IGNGISPIDDIFQGQMENSLQCKR-CGYTTFNYSTFYVLSLAIPTRSMKLSKLGRST--E 801
           I + I  IDDI   + E S   +       FN+         +P   ++ +KL RS   E
Sbjct: 906 ISHEILSIDDILVCEWEESGSNEAFSNDKIFNWEN----PAPLPNIELENAKLERSNAKE 961

Query: 802 KRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           + + L+DC+ +F+  E+L   ++W CP C
Sbjct: 962 RIITLDDCLQLFSKPEILGLNDSWYCPTC 990

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 94/236 (39%), Gaps = 66/236 (27%)

Query: 594 SLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSL 653
           S    GL NLGNTCY+NS +QCL     F   F+ + Y+  +     N   +   ++N+ 
Sbjct: 410 STGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEIN--LDNPIGYQGNVANAF 467

Query: 654 SMLFNKMYLN--------------------------GGCSVVPTGFLKVINQLRPDLKIP 687
             L +K++                            G C+ + +G+L             
Sbjct: 468 GKLIHKLFEERIIDNESEKSSFSINSFSPTNFKSTVGYCNSMFSGYL------------- 514

Query: 688 DDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGN 747
             QQD+QEFL  +LD LH++L           N +L    V K S  E  ++ D  VI  
Sbjct: 515 --QQDSQEFLAFILDGLHEDL-----------NRILKKPFVEKPSLPENSNYKDYKVIKK 561

Query: 748 ------------GISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSM 791
                         S + D+F G  +++LQC  C   +  +  +  L+L +P  ++
Sbjct: 562 LADDTWEAHLKRNDSIVTDLFVGMYKSTLQCPDCHNVSVTFDPYNDLTLPLPVETI 617

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 58/129 (44%), Gaps = 21/129 (16%)

Query: 937  TVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYP-----LILNIILKNNDTMK-YR 988
              K I     P IL+IHL RF      + K + V+ +P     L  +I+  + +    Y 
Sbjct: 1102 ATKQIELWNTPDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYD 1161

Query: 989  LFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISSS 1048
            L  V NH G L  GHYT+ V   ++        KWYYFDD  V       +D    IS S
Sbjct: 1162 LIAVDNHYGGLGGGHYTAYVKNFVDQ-------KWYYFDDSRVSL-----ADPQRSISGS 1209

Query: 1049 DVYVLFYER 1057
              Y+LFY R
Sbjct: 1210 -AYLLFYVR 1217

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 21/30 (70%)

Query: 801  EKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
            EK + L+DC+ +F+  E+L  +++W CP C
Sbjct: 1067 EKTILLDDCLRLFSKPEILGLQDSWYCPTC 1096

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 66/135 (48%), Gaps = 25/135 (18%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLIL--NIILKNNDTMKYRLFGV 992
            + +    LP  L++HL RF Y   + +N    + + YPLIL  N   K  DT+KY L G+
Sbjct: 511  RAVELKKLPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGI 570

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH------GSDKNLKI 1045
            V H G     GHY +L   +        +  W ++DDE V++  +       G +K    
Sbjct: 571  VIHVGDGPQMGHYVALCKTE--------KYGWLFYDDETVESVSEETVLKFIGDEK---- 618

Query: 1046 SSSDVYVLFYERVYD 1060
            + S  YVLFY+++ D
Sbjct: 619  TQSTAYVLFYKKLGD 633

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLAS--NRPHHSPKLSNSLS 654
           + G  N GNTCY NS++QCL+    FR   +    +N ++        P + P+  +  S
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNLPEFRLNILQYPERNLMDQRVRKLEMPGYKPRCFSEAS 184

Query: 655 MLFNKMYLNGGCSV 668
             F K     G SV
Sbjct: 185 --FEKPQTTTGASV 196

 Score = 35.4 bits (80), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 12/79 (15%)

Query: 752 IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCIN 811
           I++IFQG + N ++C  C   T     F    L +P   +++ + G +  +RV     + 
Sbjct: 437 INEIFQGTLTNKVRCLTCDNVTSREEAF----LDLP---IEVKENGDTDIQRV-----LK 484

Query: 812 MFTSDEVLSGENAWDCPRC 830
            ++  E+L+G N ++C +C
Sbjct: 485 YYSQREMLNGSNKFNCSQC 503

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 64/133 (48%), Gaps = 25/133 (18%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNNT----VITYPLILNI--ILKNNDTMKYRLFGV 992
            + +   +LPK L +HL RF Y   K  N      I YPLILN      ++ +  YRL GV
Sbjct: 557  RLVGLKSLPKTLSLHLKRFKYSEEKNANVKLFNKIHYPLILNASSTFDSSVSKSYRLQGV 616

Query: 993  VNHTGTLI-SGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA-DKKH-----GSDKNLKI 1045
            V H G     GHY SL + +L      G   W  FDDE V++ D+ +     GS +    
Sbjct: 617  VVHMGNGPHHGHYVSLCHTEL-----FG---WLLFDDETVESVDESYVLDFVGSHE---- 664

Query: 1046 SSSDVYVLFYERV 1058
            S +  YVLFY  +
Sbjct: 665  SPTTAYVLFYSEI 677

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N GNTCY NS++QCL+    FR
Sbjct: 160 VFGYENFGNTCYCNSVLQCLYHLPEFR 186

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 63/122 (51%), Gaps = 22/122 (18%)

Query: 939  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIILKNNDTMK- 986
            K + F + PK+L + L RF YD     L K N+      ++   P +   +LKN +  + 
Sbjct: 386  KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETES 445

Query: 987  --YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNL 1043
              Y+L GV+ HTG + +GHY +++  DL         +WY FDDE V K D+K   D+N 
Sbjct: 446  HIYKLHGVLVHTGDISTGHYYTMIKPDL-------GDQWYRFDDERVWKVDRKQVFDENF 498

Query: 1044 KI 1045
             +
Sbjct: 499  GL 500

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 87/234 (37%), Gaps = 62/234 (26%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G RN G TCY+NS++Q  F  K FR L        Y  P    +P      ++S+ +  
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YEIPTDEEKP------NDSVPLAL 255

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S +P   L++      D      Q D QE   IL+DRL   +   +     
Sbjct: 256 QRAFYQLQVSNLPLDTLELTRSFGWDSADAFTQHDVQELNRILMDRLETRMKGTK----- 310

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 777
                                     V G     + ++F G+M++ ++CK   Y +    
Sbjct: 311 --------------------------VEGK----LSELFVGKMKSYIKCKNVDYESSRVE 340

Query: 778 TFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
            F+ + L +      L  L +S E  +++          E++ GEN +  P  G
Sbjct: 341 EFWDIQLNVK----DLKNLQQSFENYIEV----------ELMDGENQYAAPDFG 380

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 61/135 (45%), Gaps = 27/135 (20%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNNTV-----ITYPLILNIILKNNDTM--KYRLFG 991
            + +    LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY L G
Sbjct: 548  RLVGLKQLPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAG 606

Query: 992  VVNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH------GSDKNLK 1044
            +V H G     GHY SL   +        +  W  FDDE V+A K+       G   N+ 
Sbjct: 607  IVVHMGGGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTGESPNM- 657

Query: 1045 ISSSDVYVLFYERVY 1059
               +  YVLFY+ +Y
Sbjct: 658  ---ATAYVLFYKAMY 669

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N GNTCY NS++QCL+   + R
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLR 165

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 62/135 (45%), Gaps = 27/135 (20%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNNTV-----ITYPLILNIILKNNDTM--KYRLFG 991
            + +    LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY+L G
Sbjct: 551  RLVGLKQLPDTLALHLKRFKYS-EKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAG 609

Query: 992  VVNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH------GSDKNLK 1044
            +V H G     GHY SL   +        +  W  FDDE V+A K+       G   N+ 
Sbjct: 610  IVVHMGGGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTGESPNM- 660

Query: 1045 ISSSDVYVLFYERVY 1059
               +  YVLFY+ ++
Sbjct: 661  ---ATAYVLFYKAMH 672

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N GNTCY NS++QCL+   + R
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSLR 166

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 81/191 (42%), Gaps = 40/191 (20%)

Query: 598 TGLRNLGNTCYINSMIQCLF--AAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
            GL NLGN+CY+NS++Q L      ++   F+ S +   +   A+N      KL N++  
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGVPSWSLDFLGSEFPLDVVYPANNLKCQWIKLLNAMKH 382

Query: 656 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 715
              K+Y NG   + PT F K I +   +    + QQD  EFL  LLD L           
Sbjct: 383 E-PKLYANG---IKPTTFKKCIGKNHEEFS-SNRQQDAMEFLTFLLDSLD---------- 427

Query: 716 NDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 775
                                +++F  N  G   S  +D+ +  ME+ LQC +CG   ++
Sbjct: 428 ---------------------RNFFSDNSAG--ASNPNDLMRFMMEDRLQCNKCGKVKYS 464

Query: 776 YSTFYVLSLAI 786
           Y     + L +
Sbjct: 465 YEPAEAIQLPL 475

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 20/121 (16%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNI--------ILKNNDTMK 986
            K + F + P IL + L RF YD       K N    +P  +++        + +N ++ K
Sbjct: 384  KGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCK 443

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNLKI 1045
            Y L GV+ HTG + +GHY +++  DL+        +WY FDDE V K  KK   ++N  +
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKPDLQ-------DQWYRFDDEKVWKVTKKQVFEENFGM 496

Query: 1046 S 1046
            +
Sbjct: 497  N 497

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 87/235 (37%), Gaps = 64/235 (27%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G RN G TCY+NS++Q  F  K FR L        Y  P  +  P      ++S+ +  
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YQIPTENESP------NDSVPLAL 253

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S +P   L++      D      Q D QE   IL+DRL + +         
Sbjct: 254 QRAFYQLQVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMK-------- 305

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 776
                                       G  +   ++++F G+M++ ++C    Y +   
Sbjct: 306 ----------------------------GTPVEGKLNELFVGKMKSYIKCINVDYESSRV 337

Query: 777 STFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
             F+ L L +  +++K             LE+    +   E+++GEN +     G
Sbjct: 338 EDFWDLQLNV--KNLK------------GLEESFKNYIEIELMNGENQYAAQDFG 378

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
            YBL067C (REAL)
          Length = 748

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 61/135 (45%), Gaps = 27/135 (20%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNNTV-----ITYPLILNIILKNNDTM--KYRLFG 991
            + +    LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY L G
Sbjct: 550  RLVGLKQLPDTLALHLKRFKYS-EKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSG 608

Query: 992  VVNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH------GSDKNLK 1044
            +V H G     GHY SL   ++      G   W  FDDE V+A K+       G   N+ 
Sbjct: 609  IVVHMGGGPQHGHYVSLCKHEI-----FG---WLLFDDETVEAVKEEAVLEFTGESPNM- 659

Query: 1045 ISSSDVYVLFYERVY 1059
               +  YVLFY+  Y
Sbjct: 660  ---ATAYVLFYKTKY 671

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N GNTCY NS++QCL+   + R
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSVR 166

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 79/192 (41%), Gaps = 44/192 (22%)

Query: 598 TGLRNLGNTCYINSMIQCLF--AAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
            GL NLGN+CY+NS++QCLF    K +    +  ++   +    +N      KL+N++  
Sbjct: 323 CGLINLGNSCYLNSVLQCLFNGGVKGWSLKGLGQDFPQDVLYPTNNFKCQLIKLNNAMK- 381

Query: 656 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 715
           +  + Y  G   + P  F K + Q   +      QQD+ EFL  L+D L           
Sbjct: 382 VEPQNYPEG---IRPKSFKKCVGQSHEEFS-SGRQQDSMEFLGYLVDVL----------- 426

Query: 716 NDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 775
                                    DK +  NG +P +D+ +  ME+ LQC  CG   ++
Sbjct: 427 -------------------------DKKIFKNGSNP-NDLMKFTMEDRLQCTNCGKVKYS 460

Query: 776 YSTFYVLSLAIP 787
                 L L +P
Sbjct: 461 SEAAESLQLPMP 472

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 50/101 (49%), Gaps = 15/101 (14%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 992
            + +    LP+IL +HL RF Y   +  N      ITYPL L +  K + ++  KY L GV
Sbjct: 541  RVVGLKKLPRILALHLKRFKYSEAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGV 600

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVK 1032
            V H G     GHY S+   D     + G   W +FDDE V+
Sbjct: 601  VLHMGGGPQHGHYVSVCKTD-----NFG---WLFFDDETVE 633

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 23/43 (53%), Gaps = 7/43 (16%)

Query: 588 NPNVYVSL-------SITGLRNLGNTCYINSMIQCLFAAKTFR 623
           NP V V +        I G  N GNTCY NS++QCLF    FR
Sbjct: 97  NPKVAVGMPFGDGSNKIFGYENFGNTCYCNSILQCLFNLTEFR 139

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
            YBL067C (REAL)
          Length = 745

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 59/134 (44%), Gaps = 27/134 (20%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNNTV-----ITYPLILNIILKNNDTM--KYRLFG 991
            + +    LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY L G
Sbjct: 548  RLVGLKQLPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAG 606

Query: 992  VVNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH------GSDKNLK 1044
            +V H G     GHY SL            +  W  FDDE V+A K+       G   N+ 
Sbjct: 607  IVVHMGGGPQHGHYVSLCKHQ--------KFGWLLFDDETVEAVKEETVLEFTGESANM- 657

Query: 1045 ISSSDVYVLFYERV 1058
               +  YVLFY+ V
Sbjct: 658  ---ATAYVLFYKAV 668

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N GNTCY NS++QCL+     R
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLR 165

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 60/129 (46%), Gaps = 17/129 (13%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNII--LKNNDTMKYRLFGV 992
            +++    LP  L +HL RF Y  TK +N      + YPL L++     N+   KY L G+
Sbjct: 604  RSVGLKQLPHTLALHLKRFKYSETKNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSGI 663

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISS--SD 1049
            V H G     GHY SL   D     + G   W  FDDE V++  +      +  SS  + 
Sbjct: 664  VVHMGGGPQHGHYVSLCKND-----NFG---WLLFDDETVESVSEKTVLDFVGDSSTLTT 715

Query: 1050 VYVLFYERV 1058
             YVLFY  +
Sbjct: 716  AYVLFYREL 724

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N GNTCY NS++QCL+    FR
Sbjct: 130 VFGFENFGNTCYCNSVLQCLYNMTEFR 156

 Score = 38.9 bits (89), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 49/141 (34%), Gaps = 38/141 (26%)

Query: 690 QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGI 749
            QD  EFL  LL+ L D L+N      D               + E+   F         
Sbjct: 494 HQDAHEFLNFLLNELSDYLNNGAKSGKD---------------DEEHSLNF--------- 529

Query: 750 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDC 809
             I DIFQG + N ++C  C   T     F    + +P  S               ++  
Sbjct: 530 --IKDIFQGTLTNRVKCFTCDNITSRDEPFLDFPIEVPDDS------------ETDIQAL 575

Query: 810 INMFTSDEVLSGENAWDCPRC 830
           +  F   E+LSG N + C  C
Sbjct: 576 LQNFDQREMLSGPNKFYCNVC 596

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 61/134 (45%), Gaps = 23/134 (17%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTMK--YRLFGV 992
            + +    LP IL +HL RF Y   K  N      + YPL LN+    + +++  Y L GV
Sbjct: 638  RIVGLKQLPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGV 697

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH-----GSDKNLKIS 1046
            V H G+    GHY SL   D        +  W  FDDE V++  +        D N   +
Sbjct: 698  VIHMGSSPQHGHYVSLCKND--------KFGWLLFDDETVESVSESTVLEFTGDPN---N 746

Query: 1047 SSDVYVLFYERVYD 1060
             +  YVLFY+ + D
Sbjct: 747  QATAYVLFYKEIKD 760

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N GNTCY NS++QCL+    FR
Sbjct: 171 VFGYENFGNTCYCNSVLQCLYNLYEFR 197

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1297

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 60/143 (41%), Gaps = 32/143 (22%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRF--YYDLTKKNNTVITYPLI---------------L 975
            K     + I   + P+IL++HL RF  +Y  T K N  + +PL                 
Sbjct: 961  KLRQATRQIELWSTPEILLVHLKRFESHYSSTGKLNNTVHFPLTGLDMSPHLPCRDGDGD 1020

Query: 976  NIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDD-EVVKAD 1034
                       Y L  V NH G L SGHYT+ V   ++        KWY FDD EV + D
Sbjct: 1021 GDGDDGGRENVYDLIAVDNHFGGLGSGHYTAYVKNPVD-------DKWYLFDDSEVREVD 1073

Query: 1035 KKHGSDKNLKISSSDVYVLFYER 1057
             +        ++SS  Y+LFY R
Sbjct: 1074 AE-------SVASSFGYLLFYRR 1089

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 87/209 (41%), Gaps = 21/209 (10%)

Query: 594 SLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSL 653
           S    GL NLG+TC+INS++QCL      R  F+ + +   L     N   +  +++ + 
Sbjct: 347 SSGTMGLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELN--TRNSLGYGGRVAGAF 404

Query: 654 SMLFNKMYLNGGC---SVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELS- 709
           + +   ++ +      +   + F   I   RP L  P  QQD+ E +  LL  LH++L+ 
Sbjct: 405 AEVVQALFGDKIAQFPTYAASNFRATIGYFRPALG-PYVQQDSHEVVAFLLGALHEDLNR 463

Query: 710 -------NQQHVANDYPNLLLYNADVLKVSNNE---YKHWFDKNVIGNGISPIDDIFQGQ 759
                   Q   +      +  +A        E      W    +  + +  I D+F G 
Sbjct: 464 APEGPRVGQAGESTGVGASVGASAGTRNRGRGERLAADTWSRYKLQNDSV--ITDLFAGM 521

Query: 760 MENSLQCKRC--GYTTFNYSTFYVLSLAI 786
           ++++L C  C     TF+  T   + LA+
Sbjct: 522 LKSTLTCLTCRRSSVTFDPCTELAVPLAV 550

 Score = 39.7 bits (91), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 27/40 (67%), Gaps = 1/40 (2%)

Query: 791 MKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           ++  + GR  ++   LEDC+++FT+ EVL+  ++W CP C
Sbjct: 921 VRHERAGRQKQE-TTLEDCLDLFTAPEVLNTADSWYCPAC 959

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 88/234 (37%), Gaps = 62/234 (26%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G RN G TCY+NS++Q  F  K FR L        Y  P     P+      +S+ +  
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YGIPTNGENPN------DSVPLAL 250

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S  P   L++      D      Q D QE   IL+DRL + +         
Sbjct: 251 QRAFYQLQVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDRLENRM--------- 301

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 777
                       K +N E K              +++IF G+M++ ++CK   Y +    
Sbjct: 302 ------------KGTNVEGK--------------LNEIFVGKMKSYIRCKNVDYESSRVE 335

Query: 778 TFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
            F+ + L +         L  S E  +++          E+++GEN +  P  G
Sbjct: 336 DFWDIQLNVKN----FKSLQESFENYIEV----------ELMNGENQYAAPDFG 375

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 59/120 (49%), Gaps = 20/120 (16%)

Query: 939  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIILKNNDTMK- 986
            K + F + P +L + L RF YD     L K N+       +   P +   +LK     K 
Sbjct: 381  KGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKN 440

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNLKI 1045
            Y+L GV+ HTG + +GHY +++   LE        +WY FDDE V K DKK   D+N  +
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKPTLE-------DQWYRFDDEKVWKVDKKQVFDENFGL 493

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 92/237 (38%), Gaps = 60/237 (25%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G  NLGN+CY+NS++QCLF         + +N      PL    P  +  L   L  + 
Sbjct: 333 CGFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYP--TTNLKCQLIKIL 390

Query: 658 NKMYLNGGC---SVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHV 714
           N   LN       + P  F   + Q   + K  ++QQD  EFL  LL++L   L      
Sbjct: 391 NAFKLNPENYPEGIKPQSFKNYVGQSNKEFK-SNNQQDATEFLTFLLEQLEKTL------ 443

Query: 715 ANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTF 774
                          K  NN                  ++I +  ME+ +QC+ CG   +
Sbjct: 444 --------------FKKDNNP-----------------NNIMKFIMEDKIQCQSCGNVKY 472

Query: 775 NYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENA-WDCPRC 830
           +Y          PT  ++L   G +  + + +E   N F      +GEN  +DCP C
Sbjct: 473 SYE---------PTEYIQLPLDGTNNPQNL-VETLTNFF------NGENIDFDCPTC 513

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 40/83 (48%), Gaps = 14/83 (16%)

Query: 977  IILKNNDTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKAD 1034
            II  N D   YRL  VV H G +  SGHY + + K ++  +     KW  ++DE +V +D
Sbjct: 724  IIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDEL-----KWVLYNDEKIVVSD 778

Query: 1035 KKHGSDKNLKISSSDVYVLFYER 1057
                   N+     D Y+ FY R
Sbjct: 779  -------NIDEIKKDGYIYFYSR 794

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
            similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 64/133 (48%), Gaps = 25/133 (18%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 992
            +T+    LPKIL +HL RF Y    ++N      I YPL L +  K++  +   Y L G+
Sbjct: 583  RTVGLKQLPKILSLHLKRFKYSEKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELNGI 642

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH------GSDKNLKI 1045
            V H G     GHY ++   D+      G   W  +DDE V++  +       G +K++  
Sbjct: 643  VIHMGGGPQHGHYVAICKHDM-----FG---WLLYDDETVESIDEETVFKFVGDEKDM-- 692

Query: 1046 SSSDVYVLFYERV 1058
              +  YVLF++ V
Sbjct: 693  --TTAYVLFFKEV 703

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 594 SLSITGLRNLGNTCYINSMIQCLFAAKTFRT 624
           S  + GL N GNTCY NS++QCLF     RT
Sbjct: 129 STKVFGLENFGNTCYCNSVLQCLFNLSELRT 159

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 12/79 (15%)

Query: 752 IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCIN 811
           +  +FQG M NS++C  C   T +   F  L  AIP           + ++ V ++D ++
Sbjct: 509 VQSLFQGTMINSIKCLTCDNVTSSDELF--LDFAIPV----------NEDEEVNIQDMLS 556

Query: 812 MFTSDEVLSGENAWDCPRC 830
            F   E+L+G N + C  C
Sbjct: 557 NFNQREMLNGANKFYCDSC 575

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 58/135 (42%), Gaps = 25/135 (18%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 992
            +T+    LP  L +HL RF Y      N      I YPL LN+      ++  KY+L G+
Sbjct: 618  RTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGI 677

Query: 993  VNHTGTL-ISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH------GSDKNLKI 1045
            V H G+    GHY ++   D        +  W  FDDE      +       G +K    
Sbjct: 678  VVHMGSSPQQGHYVAICKTD--------KYGWLLFDDETASWINEEEVLSFIGDEK---- 725

Query: 1046 SSSDVYVLFYERVYD 1060
            S +  YVLFYE V D
Sbjct: 726  SQNTAYVLFYEEVKD 740

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLAS 640
           I G  N GNTCY NS++QCL+    F+   + ++ ++   P  S
Sbjct: 154 IFGYENFGNTCYCNSVLQCLYHLDDFKLNLLKTSLRSSSLPECS 197

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 96/236 (40%), Gaps = 57/236 (24%)

Query: 598 TGLRNLGNTCYINSMIQCLF--AAKTFRTLFISSNYK-NYLEPLASNRPHHSPKLSNSLS 654
            GL NLGN+CYINS++QCL     KT+    +  ++  + L P ++N      KL+N++ 
Sbjct: 322 CGLINLGNSCYINSVLQCLLNGGVKTYSLSALGESFPLDVLYP-STNMKCQLIKLNNAIK 380

Query: 655 MLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHV 714
            L  ++Y +G   + P  F K I Q   +    + QQD  EFL    D L          
Sbjct: 381 -LEPELYPSG---IRPRSFKKCIGQAHEEFS-SERQQDALEFLSFFNDTL---------- 425

Query: 715 ANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTF 774
                                     DK +     +   D+ +  +EN LQC +CG    
Sbjct: 426 --------------------------DKKIFSRSENNPSDLMRYIIENRLQCTKCG--KV 457

Query: 775 NYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
            Y+T    S+ +P      S+  +S   R+     +  F  +E+      + CP+C
Sbjct: 458 KYTTDINESMLVPLEENSDSQHSQSLLDRL-----VEYFHGEEL-----DFKCPQC 503

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 58/127 (45%), Gaps = 21/127 (16%)

Query: 939  KTINFVTLPKILVIHLSRFYYD--LTKKNNTVITYPLILNI--ILKNNDTMKYRLFGVVN 994
            KT+ F  LPK L +HL RF  D  +  K    I YPL L +     N+    Y L GVV 
Sbjct: 531  KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 995  HTG-TLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV-----KADKKHGSDKNLKISSS 1048
            H G +   GHY S+   +        +  W  +DDE +     +A   H  + N  I++ 
Sbjct: 591  HVGASPTHGHYVSICKHE--------KYGWLMYDDETIESIPEEAVTSHVGEPNNPITA- 641

Query: 1049 DVYVLFY 1055
              YVLFY
Sbjct: 642  --YVLFY 646

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 70/185 (37%), Gaps = 42/185 (22%)

Query: 649 LSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 708
           L + +  +    YL+G   V P  F+K++ +  P L     QQD  EFL  LL+ + D  
Sbjct: 378 LKDIMECITENRYLSG--VVSPAEFVKLLKRQNP-LFNSTMQQDAHEFLNFLLNNISDFA 434

Query: 709 SNQQHVANDYPNLLLYNADVLKVSNNE---YKHWFDKNVIGNGISPIDDIFQGQMENSLQ 765
                          Y ++ LK SN E     H F           + D F+G + N ++
Sbjct: 435 GK-------------YKSNYLKSSNEEECEISHDF-----------VKDQFEGVLLNRIK 470

Query: 766 CKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAW 825
           C  C   + N   F    + I              ++ + ++D    F   E+L G N +
Sbjct: 471 CLTCDCVSANEEPFLDFPIEI------------QNDEAINIQDTFRSFYQREILCGPNKF 518

Query: 826 DCPRC 830
            C  C
Sbjct: 519 YCNEC 523

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N G+TCY NS++QC++    FR
Sbjct: 120 VFGYENFGHTCYCNSVLQCIYNLPEFR 146

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 98/247 (39%), Gaps = 66/247 (26%)

Query: 596 SITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
            + GL N+G+TC+++S+IQ +     F    +S  + N  +  +  +      +S +L  
Sbjct: 131 GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSGTKC-----VSCALDE 185

Query: 656 LFNKMYLNG----GCSVVPTGFLKVIN---QLRPDLKIPDDQQDTQEFLMILLDRLHDEL 708
           +    Y NG      S V  GF+ +++    +   L +   QQD  E+   LL++LH + 
Sbjct: 186 IACDFYGNGPGTGKSSSVSKGFVNLLSASWHINHHL-VGSSQQDAHEYWQFLLNQLHTD- 243

Query: 709 SNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISP-----IDDIFQGQMENS 763
                                              V G+  +P        IFQG ++N+
Sbjct: 244 --------------------------------HARVFGSSKAPDCQCITHRIFQGYLKNT 271

Query: 764 LQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGEN 823
           LQC +CG++         LSL I                  KLEDC++ F  +E L+ + 
Sbjct: 272 LQCSQCGFSKTTIDPIMDLSLEIKNNP--------------KLEDCLDHFQREETLT-DF 316

Query: 824 AWDCPRC 830
            ++C  C
Sbjct: 317 HYECQSC 323

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 60/129 (46%), Gaps = 24/129 (18%)

Query: 937  TVKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNI---ILKNND----TMK 986
             VK +     P +LVI L RF + L   + K N  + +PL LN+   + +  D     + 
Sbjct: 329  VVKQLTLHKAPNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIA 388

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKIS 1046
            Y L  VV+H GT+  GHYT++   +          +W+ F+D VV +  +       ++ 
Sbjct: 389  YDLLNVVSHQGTVDQGHYTTVSKTE--------DGQWFKFNDSVVTSVTEE------QVL 434

Query: 1047 SSDVYVLFY 1055
                Y+LFY
Sbjct: 435  EQQAYLLFY 443

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 57/118 (48%), Gaps = 20/118 (16%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNI-------ILKNNDTMK- 986
            K + F + P +L + L RF YD       K N    +P  +++       +L+ N   + 
Sbjct: 380  KGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRW 439

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNL 1043
            Y L GV+ HTG + +GHY +L+   LE        +WY FDDE V K  KK   D+N 
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLE-------DQWYRFDDERVWKVSKKQAFDENF 490

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/234 (20%), Positives = 83/234 (35%), Gaps = 62/234 (26%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G RN G TCY+NS++Q  F  K FR L        Y  P +   P       +S+ +  
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV-------YQIPTSQENP------KDSVVLAL 249

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S  P   +++      D      Q D QE   IL+DRL   +         
Sbjct: 250 QRAFYQLQVSQYPLDTMELTRSFGWDNVEAFTQHDVQELNRILMDRLETRMKGT------ 303

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 777
                        V N                  +++IF G+M++ ++C    Y +    
Sbjct: 304 ------------TVENK-----------------LNEIFVGKMKSFIKCINVDYESARTE 334

Query: 778 TFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
            F+ + + +  +++K             L+D    +   E++ GEN +     G
Sbjct: 335 DFWDIQMNV--KNLK------------GLKDSFENYIEVELMDGENQYAAQDYG 374

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 60/129 (46%), Gaps = 17/129 (13%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNI--ILKNNDTMKYRLFGV 992
            + I    LPK LV+HL RF Y   K  N      + YP  LNI  +  ++ + KY L  +
Sbjct: 533  RLIGIKELPKHLVVHLKRFKYCEEKNCNIKLFNKVNYPFTLNISSVFDDSISKKYELNSI 592

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA--DKKHGSDKNLKISSSD 1049
            V H G     GHY +L     +H        W  +DDE V+A  D+      N +  S+ 
Sbjct: 593  VVHIGESPQLGHYVTLC----KHK----SYGWLIYDDETVQAVSDELVSRILNNEQRSAT 644

Query: 1050 VYVLFYERV 1058
             Y+LFYE V
Sbjct: 645  AYLLFYEEV 653

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%)

Query: 590 NVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFIS 628
           N  V   + G +N G TCY NS++Q LF   +FR   I 
Sbjct: 98  NYDVGERVFGFQNFGYTCYCNSILQALFNIGSFRDGIIG 136

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 89/235 (37%), Gaps = 64/235 (27%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G RN G TCY+NS++Q  F  K FR L        Y  P      H SP  +NS+ +  
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YEIPTE----HESP--NNSVPLAL 251

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S +P   L++      D      Q D QE   IL+DRL +           
Sbjct: 252 QRAFYQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLEN----------- 300

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 776
                                    N+ G  +   +++IF G+M++ ++C    Y +   
Sbjct: 301 -------------------------NMKGTPVEGKLNEIFVGKMKSYIKCINVDYESARV 335

Query: 777 STFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
             F+ L L +  ++ K             L++  + +   E+++GEN +     G
Sbjct: 336 EDFWDLQLNV--KNFK------------NLQESFDNYIEMELMNGENQYAAQDYG 376

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 26/112 (23%)

Query: 939  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIILK------- 980
            K + F + P +L + L RF YD     + K N+      T+   P +   +LK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSEN 441

Query: 981  -NNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
             + +   Y L GV+ H+G + +GHY +L+   +E        +WY FDDE V
Sbjct: 442  KDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 61/134 (45%), Gaps = 24/134 (17%)

Query: 932  NKKMTTVKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNII-------LKN 981
            N K   ++ +    LP +LV+ L RF + +   + K N  I +P  L++        +  
Sbjct: 329  NTKQNAIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVGE 388

Query: 982  NDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDK 1041
               + Y L G+++H G++  GHYTS+          I   +W+ F+D +V A  +     
Sbjct: 389  TPAIVYELIGLISHQGSVNQGHYTSICK--------IPGGQWFKFNDSMVTAVAE----- 435

Query: 1042 NLKISSSDVYVLFY 1055
             + +     Y+LFY
Sbjct: 436  -IDVLKEQAYLLFY 448

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 22/135 (16%)

Query: 581 SIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLAS 640
           SIP++E+         + GL N+G+TC+++S+IQ L         +I  +  + L     
Sbjct: 125 SIPSVEKRN------GLAGLVNMGSTCFMSSIIQTL-----IHNPYILKHSMDQLHSTTC 173

Query: 641 NRPHHSPKLSNSLSMLFNKMYLNGGCSVVPT------GFLKVIN-QLRPDLKIPD-DQQD 692
           +  + S  +S ++  + +  Y   G S   T      GF+ +++   R +  +    QQD
Sbjct: 174 DLQNSSSCMSCAVDQIISDFY---GASKSETSETNQQGFVNLLSCSWRKNKNLAGYSQQD 230

Query: 693 TQEFLMILLDRLHDE 707
             EF   LL++LH++
Sbjct: 231 AHEFWQFLLNQLHND 245

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar to
            uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13 or
            uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
            ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 59/130 (45%), Gaps = 23/130 (17%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNNT----VITYPLILNIILKNNDTMK--YRLFGV 992
            + +    LPK L +HL RF Y   + +N      ++YPL L +    N ++   Y L G+
Sbjct: 559  RVVGLKQLPKTLALHLKRFKYSEQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSGI 618

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHG-----SDKNLKIS 1046
            V H G     GHY SL   +        +  W  FDDE V+A  +        DK+   +
Sbjct: 619  VVHMGGGPQHGHYISLCKNE--------KFGWLLFDDETVEAISEQAVLQYTGDKD---T 667

Query: 1047 SSDVYVLFYE 1056
             +  YVLFY+
Sbjct: 668  MTTAYVLFYQ 677

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 70/173 (40%), Gaps = 36/173 (20%)

Query: 661 YLNGGCSVVPTGFLKVI---NQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
           YL G   V P+ F++++   N L   +      QD  EFL+ LL+ + D L  Q   A  
Sbjct: 412 YLTG--VVTPSAFIEMLKRENVLFSSMM----HQDAHEFLIFLLNEISDFLDKQNKNA-- 463

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 777
             N  +Y++   + ++   K++            + DIFQG + N ++C  C  TT    
Sbjct: 464 -LNSKIYDSSQGRRNSGTVKNF------------VSDIFQGTLTNRIKCLTCDNTTARDE 510

Query: 778 TFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
            F    + +                 + +++ +  F   E+L G N + C  C
Sbjct: 511 PFLDFPIEV------------QENVDIDIQEILESFHQKEMLHGPNKFYCDEC 551

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           I G  N GNTCY NS++QCL+    FR
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFR 175

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 87/204 (42%), Gaps = 51/204 (25%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLS-ML 656
           TGL N GN C+INS IQ L       T ++S+  ++  E  AS  P H     N L+ ML
Sbjct: 76  TGLVNPGNDCFINSSIQALVPLDKLTT-YLSATLED--EKTASTLPLH-----NGLATML 127

Query: 657 FNKMYLNGGCSVVPTGFLKVINQLRPDL--KIPDDQQDTQEFLMILLDRLHDELSNQQHV 714
                L      V +   + I QL      KI   Q D  EF  ++L+RL++E       
Sbjct: 128 LELQQLRSDPKSVSSK--RFIQQLETIFGGKISRQQNDAHEFTQLILERLNEE------- 178

Query: 715 ANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTT- 773
                NL L +AD+                      P    F+G + N L C +CG T+ 
Sbjct: 179 -----NLTLDHADL--------------------TVP----FKGIVGNHLVCLQCGRTSH 209

Query: 774 FNYSTFYVLSLAIPTR-SMKLSKL 796
            N   FY+  L +P + S+KLS L
Sbjct: 210 VNEQPFYIYELTLPQQGSVKLSDL 233

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 13/89 (14%)

Query: 926  NTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYDLT--KKNNTVITYP---LILNIILK 980
            NT + K+     V+   F   P+I +IHLSR  ++     +N   + +    L+   ILK
Sbjct: 309  NTSEIKS---VIVRKSTFAEFPEIFLIHLSRSVFNGMNYSRNPCQVEFEEEILLPRQILK 365

Query: 981  NN-----DTMKYRLFGVVNHTGTLISGHY 1004
            ++     +T+KY+L  +V HTG+   GHY
Sbjct: 366  DHQCVGFETVKYKLKSIVKHTGSHYQGHY 394

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 63/141 (44%), Gaps = 21/141 (14%)

Query: 922  NDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNI- 977
            +D N   D  N     +K +    LP +LV+ L RF + L   + K N ++ +PL LN+ 
Sbjct: 333  HDFNYHCDRCNTTQNAIKRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMR 392

Query: 978  -ILKNNDT--MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1034
                 +D   + + L G++ H GT+  GHY +       H        W+ F+D +V + 
Sbjct: 393  NYCDGDDVPDIIFELIGIIAHRGTVNEGHYIAFTKVTTGH--------WFKFNDSMVSSI 444

Query: 1035 KKHGSDKNLKISSSDVYVLFY 1055
             +       ++     Y+LFY
Sbjct: 445  TEE------ELLQEQAYLLFY 459

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 62/146 (42%), Gaps = 36/146 (24%)

Query: 582 IPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASN 641
           IP +ER         + GL N+G+TC+++S++QCL     F        ++  +  L S 
Sbjct: 127 IPKLERRD------GLQGLLNMGSTCFMSSIVQCLIHNPYF--------FQFSINQLHSQ 172

Query: 642 R-PHHSP--KLSNSLSMLFNKMYLNGGCSVVPTG------------FLKVINQLRPDLKI 686
           R P   P   +S +L  +  + Y  G   ++  G            +   I       KI
Sbjct: 173 RCPLQDPLSCISCALDRMVWEFY--GHPELIKNGEDDSNNSRTSDEYAGFIGLFVSSWKI 230

Query: 687 PDD-----QQDTQEFLMILLDRLHDE 707
            ++     QQD  E+   LL++LH++
Sbjct: 231 NENLAGYFQQDAHEYWQFLLNQLHND 256

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 88/235 (37%), Gaps = 64/235 (27%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G RN G TCY+NS++Q  F  K FR L        Y  P      H SP  +NS+ +  
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YEIPTE----HESP--NNSVPLAL 251

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S +P   +++      D      Q D QE   IL+DRL +           
Sbjct: 252 QRAFYQLQVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLEN----------- 300

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 776
                                    N+ G  +   + +IF G+M++ ++C    Y +   
Sbjct: 301 -------------------------NMKGTPVEGKLSEIFVGKMKSYIKCVNVDYESARV 335

Query: 777 STFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
             F+ L L +  ++ K             L++  + +   E+++GEN +     G
Sbjct: 336 EDFWDLQLNV--KNFK------------NLQESFDNYIEMELMNGENQYAAQDYG 376

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 26/112 (23%)

Query: 939  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIILKNN----- 982
            K + F + P +L + L RF YD     + K N+      T+   P +   +LK +     
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGD 441

Query: 983  ---DTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
               +   Y L GV+ H+G + +GHY +L+   +E        +WY FDDE V
Sbjct: 442  KSRNPYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 83/235 (35%), Gaps = 64/235 (27%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G RN G TCY+NS++Q  F  K FR L        Y  P A   P      ++S+++  
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLV-------YQIPTADENP------NDSVALAL 305

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S  P   L++      D      Q D QE   IL+DRL   +         
Sbjct: 306 QRAFYQLQVSNYPLDTLELTRSFGWDTAEAFTQHDVQELNRILMDRLESRMK-------- 357

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 776
                                       G  +   + D+F G+M++ ++C    Y +   
Sbjct: 358 ----------------------------GTSVEGKLTDVFVGKMKSYIKCVNIDYESSRV 389

Query: 777 STFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
             F+ + L +      L  L  + E  +++          E++ GEN +     G
Sbjct: 390 EDFWDIQLNVKG----LEGLANAFENYIEV----------ELMDGENQYAAQDYG 430

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 20/121 (16%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILN--------IILKNNDTMK 986
            K + F + P++L + L RF YD       K N    +P  ++        ++ K      
Sbjct: 436  KGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNN 495

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNLKI 1045
            Y L GV+ HTG + +GHY +++    +        KWY FDDE V +  KK   D+N  +
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKPTTD-------DKWYRFDDEKVWRVTKKQVFDENFGL 548

Query: 1046 S 1046
            +
Sbjct: 549  N 549

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 89/236 (37%), Gaps = 62/236 (26%)

Query: 596 SITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
              GL+N G TCY+NS++Q  +  K FR L        Y  P     P      SNS+ +
Sbjct: 197 GFVGLKNQGATCYLNSLLQSYYFTKYFRKLV-------YHIPTDGETP------SNSVPL 243

Query: 656 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 715
              + +     S  P    ++      D      Q D QE   IL+DRL ++        
Sbjct: 244 ALQRAFYKLQRSSEPLDTFELTRSFGWDTGDAFTQHDVQELNRILMDRLENK-------- 295

Query: 716 NDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 775
                        +K +  E K              +++IF G+M++ ++C    Y +  
Sbjct: 296 -------------MKATEVEGK--------------LNEIFVGKMKSYIKCVNVEYESSR 328

Query: 776 YSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
              F+ + L +      L+ L ++ E  +++          E++ GEN +   R G
Sbjct: 329 VEDFWDIQLNVKG----LNGLNQAFENYIEV----------EMMDGENQYAAQRYG 370

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 20/118 (16%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNI-------ILK-NNDTMK 986
            K + F + P +L + L RF YD       K N    +P  +++       + K   ++M 
Sbjct: 376  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMM 435

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNL 1043
            Y L GV+ HTG + +GHY +++   L+        KWY FDD+ V +  KK   ++N 
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIKPGLD-------DKWYRFDDDKVWQVTKKQVFEQNF 486

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 88/234 (37%), Gaps = 62/234 (26%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G RN G TCY+NS++Q  F  K FR L        Y  P  +  P      +NS+ +  
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV-------YQIPTENESP------NNSVPLAL 249

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S  P   L++      D      Q D QE   IL+DRL + +         
Sbjct: 250 QRSFYQLQVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM--------- 300

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 777
                                   K     G+  +++IF G+M++ ++C    Y +    
Sbjct: 301 ------------------------KGTSVEGM--LNEIFVGKMKSYIKCIDVDYESSRVE 334

Query: 778 TFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
            F+ L L +  ++MK             L++  + +   E+L+GEN +     G
Sbjct: 335 DFWDLQLNV--KNMK------------GLKESFDNYIEIELLNGENQYQAQDYG 374

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 48/104 (46%), Gaps = 18/104 (17%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNIILKNNDTMK-------Y 987
            K + F + P +L + L RF YD       K N    +P  +++     D+ K       Y
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVY 439

Query: 988  RLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
             L GV+ H G + +GHY +L+   LE        +WY FDDE V
Sbjct: 440  NLHGVLVHAGDISTGHYYTLIKPGLE-------DQWYRFDDERV 476

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 105/261 (40%), Gaps = 49/261 (18%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLS-- 654
           I GL N GNTC++NS++Q L ++K            N +E  + N  +   K + +L   
Sbjct: 57  IAGLVNDGNTCFMNSVLQSLASSKELAAFL-----DNVIENGSEN--NGDIKFTETLREL 109

Query: 655 -MLFNKMYLNGGCSVVPTGFLKVI-NQLRPDLKIPDDQQDTQEFLMILLDRLHDEL---- 708
            ++ NK Y            LK + N    ++ +  DQ+D QEF   +L  L   +    
Sbjct: 110 LLILNKKYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLEKNIKKPS 169

Query: 709 SNQQHVAN-----DYPNLLLYNADVLKVSNNEY---KHWFDKNVIGNG----------IS 750
           + ++   N     D P+  L   D L      Y   +     +V+ N           I+
Sbjct: 170 TEKKEERNNIKESDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVLENPDQKLYSPFKLIT 229

Query: 751 PIDDIFQGQMENSLQCKRCGYT-TFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDC 809
           P+D    G     + C  CG      YS F  LSL +P+ S+  S L        KL + 
Sbjct: 230 PLD----GITAERIGCLTCGENGGIRYSVFSGLSLNLPSESLNQSTL--------KLSEL 277

Query: 810 INMFTSDEVLSGENAWDCPRC 830
           +N +   E++ G    +C RC
Sbjct: 278 LNEWVKPEIIEG---VECNRC 295

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 55/120 (45%), Gaps = 20/120 (16%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLT----KKNNTVITYPLILNII--------LKNNDTMK 986
            K + F + P IL + L RF YD       K N    +P   +            NN+   
Sbjct: 378  KGVIFESFPPILHLQLKRFEYDFNFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCI 437

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNLKI 1045
            Y L GV+ HTG + +GHY +++  DLE        +WY FDDE V K  KK   ++N  +
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKPDLE-------DQWYRFDDEKVWKVTKKQVFEENFGL 490

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 87/235 (37%), Gaps = 64/235 (27%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G RN G TCY+NS++Q  F  K FR L        Y  P  S  P      ++S+ +  
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YKIPTESETP------NSSVPLAL 247

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S +P   L++      D      Q D QE   IL+DRL + +         
Sbjct: 248 QRAFYQLQVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM--------- 298

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 776
                                      +G  +   + ++F G+M++ ++C    Y +   
Sbjct: 299 ---------------------------LGTPVEGKLSELFVGKMKSYIKCVNVEYESSRV 331

Query: 777 STFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
             F+ L L +  +++K             L+D    +   E+++GEN +     G
Sbjct: 332 EDFWDLQLNV--KNLKC------------LKDSFENYIEIELMNGENQYAAQDFG 372

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 89/235 (37%), Gaps = 64/235 (27%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G RN G TCY+NS++Q  F  K FR L        Y  P      H SP  +NS+ +  
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YEIPTE----HESP--NNSVPLAL 251

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S +P   L++      D      Q D QE   IL+DRL +           
Sbjct: 252 QRAFYQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLEN----------- 300

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 776
                                    N+ G  +   +++IF G+M++ ++C    Y +   
Sbjct: 301 -------------------------NMKGTPVEGKLNEIFVGRMKSYIKCINVDYESSRV 335

Query: 777 STFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
             F+ L + +  ++ K             L++  + +   E+++GEN +     G
Sbjct: 336 EDFWDLQMNV--KNFK------------NLQESFDNYIEMELMNGENQYAAQDYG 376

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 25/111 (22%)

Query: 939  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIILK------- 980
            K + F + P +L + L RF YD     + K N+      T+   P +   +LK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGD 441

Query: 981  NNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            N +   Y L GV+ H+G + +GHY +L+   +E        +WY FDDE V
Sbjct: 442  NGNPYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 485

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 67/147 (45%), Gaps = 39/147 (26%)

Query: 929  DFKNKKMTT----VKTINFVTLPKILVIHLSRFYYDLT---KKNNTVITYPLILNI--IL 979
            DF  KK       +K      LP +LV+ L RF + ++   +K N  I +P IL++   L
Sbjct: 328  DFFCKKCQAQQNPIKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYL 387

Query: 980  KNND------TMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
            K+N       ++ Y L G+++HTG++  GHY +           I   +W+ F+D +V  
Sbjct: 388  KDNQNPDEDPSILYELIGIISHTGSVNEGHYVAFCK--------IENGEWFKFNDSMVT- 438

Query: 1034 DKKHGSDKNLKISSSDV-----YVLFY 1055
                      KI   DV     Y+LFY
Sbjct: 439  ----------KILEKDVLKEQAYLLFY 455

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 93/231 (40%), Gaps = 57/231 (24%)

Query: 596 SITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLE-PLASNRPHHSPKLSNSLS 654
            + GL N+G+TCY++S++QC+         F+   + N     +ASN        S ++S
Sbjct: 135 GMAGLVNMGSTCYMSSIMQCIIHNPYMIRYFMCQQHSNNCTLKMASNCT------SCAIS 188

Query: 655 MLFNKMYLNG---------GCSVVPTGFLKVINQLRPDLKIPDD-----QQDTQEFLMIL 700
            +    Y N            +    GF   IN L    K+ ++     QQD  E+   +
Sbjct: 189 SIIADFYGNSVQNDYKSKKNNNNKHEGF---INLLTCSWKVNENLAGYSQQDAHEYWQFI 245

Query: 701 LDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQM 760
           L+ +H +  +  H  +D                       DK  + N +  +   FQG +
Sbjct: 246 LNHIHQDYKSSMHSHSD-----------------------DK--LCNCV--VHSSFQGSL 278

Query: 761 ENSLQCKRC---GYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLED 808
           ++S+ C  C     TTF+   F  LSL I  +   L++   +  K+ +L D
Sbjct: 279 KSSIVCPECNNDSKTTFD--PFIDLSLGIKDKH-TLTECLDNFHKKEQLHD 326

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 10/112 (8%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL+NLGNTCY+N+ +QCLF  +  R + +  NYK       ++  H   K+   L   F+
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMIL--NYKQSSSVSPADEVHQ--KIVLELRNCFD 165

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPD------DQQDTQEFLMILLDRL 704
            +      +V+P   L V+ +  P     D       QQD +E    L   L
Sbjct: 166 SLDKKKFQAVMPLMLLNVLRKAYPQFAERDPQGGFYKQQDAEELFTQLFHSL 217

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 59/129 (45%), Gaps = 17/129 (13%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 992
            + +    LP  L +HL RF Y   +  N      + YPL L++    + ++  KY L GV
Sbjct: 534  RIVGLKQLPHTLALHLKRFKYSEEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTGV 593

Query: 993  VNHT-GTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISS--SD 1049
            V H  G+   GHY SL   D        +  W  FDDE V++  +    +    SS  + 
Sbjct: 594  VIHMGGSPQHGHYVSLCKND--------KFGWLLFDDETVESVTEKTVLEFTGDSSNQAT 645

Query: 1050 VYVLFYERV 1058
             YVLFY+ +
Sbjct: 646  AYVLFYKEL 654

 Score = 39.7 bits (91), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 59/141 (41%), Gaps = 36/141 (25%)

Query: 690 QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGI 749
           QQD  EFL  LL+ L + L N  H++  +P            SN      F   VI    
Sbjct: 422 QQDAHEFLNFLLNELSEYLQN--HIS--HP------------SNKPTDIPFKNYVI---- 461

Query: 750 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDC 809
               D+FQG + N ++C  C   T     F    L  P        +G   ++ + ++D 
Sbjct: 462 ----DLFQGVLTNRIKCLTCDNITSRDEPF----LDFP--------IGVKGDENIDIQDV 505

Query: 810 INMFTSDEVLSGENAWDCPRC 830
           +  + + E+L+G N + C +C
Sbjct: 506 LRCYHTREMLNGSNKFYCSQC 526

 Score = 36.6 bits (83), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N GNTCY NS++QCL+     R
Sbjct: 136 VFGYENFGNTCYCNSVLQCLYNLTELR 162

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 85/235 (36%), Gaps = 64/235 (27%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G RN G TCY+NS++Q  F  K FR L        Y  P      H SP  +NS+ +  
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YEIPTE----HESP--NNSVPLAL 251

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S +P   +++      D      Q D QE   IL+DRL +           
Sbjct: 252 QRAFYQLQVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLEN----------- 300

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGI-SPIDDIFQGQMENSLQCKRCGYTTFNY 776
                                    N+ G  +   +++IF G+M++ ++C    Y +   
Sbjct: 301 -------------------------NMKGTPVEGKLNEIFVGKMKSYIKCINVDYESARV 335

Query: 777 STFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
             F+ L L +                   L+   + +   E+++GEN +     G
Sbjct: 336 EDFWDLQLNVKNFE--------------NLQGSFDNYIEMELMNGENQYAAQDYG 376

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 26/112 (23%)

Query: 939  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIIL-------- 979
            K + F + P +L + L RF YD     + K N+      T+   P +   +L        
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGD 441

Query: 980  KNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            K+ +   Y L GV+ H+G + +GHY +L+   +E        +WY FDDE V
Sbjct: 442  KDKNPYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 61/135 (45%), Gaps = 29/135 (21%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 992
            + +    LP IL +HL RF Y   +K+N      I YPL L++    N ++  KY L GV
Sbjct: 547  RMVGLKQLPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGV 606

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKK--------HGSDKNL 1043
            V H G+    GHY  +   +        +  W  +DDE V++ K+        H  D+  
Sbjct: 607  VIHMGSGPQHGHYVCICRNE--------KFGWLLYDDETVESIKEETVLQFTGHPGDQ-- 656

Query: 1044 KISSSDVYVLFYERV 1058
                +  YVLFY+  
Sbjct: 657  ----TTAYVLFYKET 667

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N GNTCY NS++QCL+    FR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 65/142 (45%), Gaps = 32/142 (22%)

Query: 926  NTGDFKN--KKMTTVKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNIILK 980
            N G  +N  K+MT  K      LP +LV+ L RF + +   + K N  I YP  LN+   
Sbjct: 327  NCGSVQNPIKQMTIAK------LPPVLVLQLKRFEHLMNGNSVKLNEKIAYPTYLNMAPF 380

Query: 981  NNDT-------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
             + +       M Y L  V++H G++  GHYTS+          I   +W+ F+D ++ +
Sbjct: 381  CHQSESRPVPDMMYELVAVISHEGSVNQGHYTSM--------CKIPGGQWFRFNDSMIVS 432

Query: 1034 DKKHGSDKNLKISSSDVYVLFY 1055
              +  + +         Y+LFY
Sbjct: 433  ISEEEALRQ------QAYLLFY 448

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 90/250 (36%), Gaps = 68/250 (27%)

Query: 596 SITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHS--------P 647
            + GL N+G+TC+++S+IQ L              +  Y+     N+ H S         
Sbjct: 134 GLCGLVNMGSTCFMSSIIQTLV-------------HNPYVLKTCMNQVHFSRCDIQDSAS 180

Query: 648 KLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDD-----QQDTQEFLMILLD 702
             S +L  + +  Y     +   +     ++ L    KI  +     QQD  EF    L+
Sbjct: 181 CFSCALDRIVSNFYGPAADASFTSQQKGFVDLLLCSWKINRNLAGYSQQDAHEFWQFFLN 240

Query: 703 RLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMEN 762
           +LH                    AD ++V+  +     + N I +        FQG + +
Sbjct: 241 QLH--------------------ADHVRVTGKKSSKPEECNCISH------SAFQGSLRS 274

Query: 763 SLQCKRC-GYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSG 821
           S+ C  C   +   +     LSL I  ++              KL DC+  F   E L+ 
Sbjct: 275 SILCTDCHDGSNITFDPMMDLSLEIKNKN--------------KLVDCLKSFHEGETLTD 320

Query: 822 ENAWDCPRCG 831
            N   CP CG
Sbjct: 321 FNH-RCPNCG 329

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 60/126 (47%), Gaps = 22/126 (17%)

Query: 938  VKTINFVTLPKILVIHLSRFYYDLTKKN---NTVITYPLILNI-----ILKNNDTMKYRL 989
            +K +    LP +LV+ L RF +    +N   N  I +P  LN+       +NN ++ Y L
Sbjct: 323  IKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYEL 382

Query: 990  FGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISSSD 1049
             GV++H GT+  GHY + +  D         + W+ F+D +V +  +       ++    
Sbjct: 383  NGVISHIGTVNEGHYIATLKLD--------SNNWFKFNDSMVTSISEE------EVLKDQ 428

Query: 1050 VYVLFY 1055
             Y+LFY
Sbjct: 429  AYLLFY 434

 Score = 38.5 bits (88), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 103/270 (38%), Gaps = 77/270 (28%)

Query: 578 KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEP 637
           ++ S PT+     ++      G  N+G+TC+++S++Q L         FI  N       
Sbjct: 107 RNISFPTVTNRDGLH------GFVNMGSTCFMSSILQVLI-----HNPFIVQNS------ 149

Query: 638 LASNRPHHSPKL---SNSLSMLFNKMYLNGGCSVVPTGFLKVINQ--------LRPDLKI 686
             S   + S K+   +N +S   +++      + V     K INQ        L    KI
Sbjct: 150 -MSQSHYSSCKIRNPNNCISCALDEIIAESYGNFVKYNNGKPINQYHDGFISMLNCSWKI 208

Query: 687 PDD-----QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFD 741
            D+     QQD  EFL  +L+RLH +      + + Y N    N D              
Sbjct: 209 NDNFAGYSQQDAHEFLQFILNRLHRDYK----LTSTYTN----NTDSCSC---------- 250

Query: 742 KNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYV-LSLAIPTRSMKLSKLGRST 800
                     I  IFQG++++S+ C  C   +   +  Y+ LSL I              
Sbjct: 251 ---------LIHSIFQGKLKSSIVCPECHDNSKTVTDPYIDLSLDI-------------- 287

Query: 801 EKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           + +  L  C++ F   E L   N + CP C
Sbjct: 288 KDKATLYQCLDSFHKKETLHDYN-YHCPNC 316

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 89/236 (37%), Gaps = 60/236 (25%)

Query: 598 TGLRNLGNTCYINSMIQCLF--AAKTFRT-LFISSNYKNYLEPLASNRPHHSPKLSNSLS 654
            GL NLGN+CY+NS +QCLF    K + T +  +S   N + P A+N      KL  +L 
Sbjct: 331 CGLINLGNSCYLNSTLQCLFNGGVKGWDTDMLGNSPSLNVVYP-ANNLKSQLTKLRTALK 389

Query: 655 MLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHV 714
                +Y  G   + P  F K I     +      QQD  EF    +D L          
Sbjct: 390 EE-PTIYKQG---IRPKSFKKCIGGSHEEFS-SGRQQDALEFFTYFVDEL---------- 434

Query: 715 ANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTF 774
                                     DK +  N     +D+ +  ME+ LQC+ C    +
Sbjct: 435 --------------------------DKKLFKNSDYNPNDLMKFMMEDRLQCQECHGVKY 468

Query: 775 NYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           +  T  V+ L +           + +     LE+ IN + S EV+     + CP C
Sbjct: 469 STETSNVIQLPL-----------QESNDAQDLEERINAYFSGEVIE----FKCPNC 509

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 55/120 (45%), Gaps = 11/120 (9%)

Query: 592 YVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSN 651
           ++S +  GL+NLGNTCY+NS +Q L+  K  R   +  NYK   E   S   HH  +L +
Sbjct: 54  HLSQTPVGLKNLGNTCYMNSTLQALYQIKPLRDEVL--NYKVPREK-PSEEQHH--QLVS 108

Query: 652 SLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDD------QQDTQEFLMILLDRLH 705
            L   F ++      SV P   L ++ +  P     D       QQD +E    + + L 
Sbjct: 109 ELRRCFQQLKDKPQESVTPMLLLAMLRKCYPQFAERDQESGFYKQQDAEELFTQIFNSLR 168

 Score = 35.8 bits (81), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 976  NIILKNNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            N+    N +  Y L GV+ H G    SGHY S +  +++ +      KWY F+D+ V
Sbjct: 369  NLAQGENPSCVYNLIGVITHQGANSESGHYQSFIRDEVDEN------KWYRFNDDKV 419

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 107/258 (41%), Gaps = 53/258 (20%)

Query: 578 KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEP 637
           K  S+PT  R   +Y      GL NLG+TC+++S++Q L      +  F++S +      
Sbjct: 123 KQVSLPTSLRRDGLY------GLLNLGSTCFMSSILQSLIHNTYIQYWFLNSGHA---RR 173

Query: 638 LASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDD-----QQD 692
            A   P  S  +S +L  + ++ Y +        GFL +   L    KI  +     QQD
Sbjct: 174 CALRDP--SSCISCALDRIISECYGSLSERNDHAGFLSL---LTCSWKINQNFAGYSQQD 228

Query: 693 TQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPI 752
             EFL  LL++LH +   ++ V  D           ++ S+++  H             +
Sbjct: 229 AHEFLQFLLNQLHCDYKRERQVDEDKE---------VRSSSSQLCHCI-----------V 268

Query: 753 DDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINM 812
              FQG + +S+ C  C   +         ++  P   + L   G+ T     L DC++ 
Sbjct: 269 HSSFQGTLRSSIVCPECQDDS--------KTMLDPFLDLSLDIKGQRT-----LYDCLDS 315

Query: 813 FTSDEVLSGENAWDCPRC 830
           F   E L  +  + CPRC
Sbjct: 316 FHRREQLH-DFDYHCPRC 332

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 53/102 (51%), Gaps = 16/102 (15%)

Query: 938  VKTINFVTLPKILVIHLSRFYYDLTKKN---NTVITYPLILNIIL-----KNNDTMKYRL 989
            +K +    L   LV+ L RF +  + +N   N  + +PL L++       +   ++ YRL
Sbjct: 339  IKQLTIERLAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRL 398

Query: 990  FGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
             GVV+H+GT+  GHYT+++         +   +W+ F+D ++
Sbjct: 399  SGVVSHSGTVNEGHYTAVLQ--------LNSGEWFKFNDSMI 432

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 77/191 (40%), Gaps = 40/191 (20%)

Query: 598 TGLRNLGNTCYINSMIQCLF--AAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
            GL NLGN+CY+NS++Q L       +   F+ S +   +   ASN      KL N++  
Sbjct: 323 CGLINLGNSCYLNSVLQSLLNGGVPNWSLDFLGSEFPLDVVYPASNLKCQWIKLLNAMKC 382

Query: 656 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 715
              ++Y NG   + PT F K + +   +    + QQD  EFL  L D L  +  +    A
Sbjct: 383 E-PEIYPNG---IKPTTFKKCVGKSHEEFS-SNRQQDAMEFLTFLSDLLDRKFFSDSSSA 437

Query: 716 NDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 775
           +  PN                                 D+ +  ME+ LQC +CG   ++
Sbjct: 438 DSNPN---------------------------------DLVRFMMEDRLQCNKCGKVKYS 464

Query: 776 YSTFYVLSLAI 786
           Y     + L +
Sbjct: 465 YEPAEAIQLPL 475

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 59/142 (41%), Gaps = 34/142 (23%)

Query: 932  NKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTV---ITYPLILNIILKNNDTMK-- 986
            N     +K +    LP +LV+ L RF + L   N  +   I +P  LN  +KN  + K  
Sbjct: 340  NSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLN--MKNYCSTKEK 397

Query: 987  -------------YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
                         Y L G+V+H GT+  GHY +           I   +W+ F+D +V +
Sbjct: 398  DKHSENGKVPDIIYELIGIVSHKGTVNEGHYIAF--------CKISGGQWFKFNDSMVSS 449

Query: 1034 DKKHGSDKNLKISSSDVYVLFY 1055
              +       ++     Y+LFY
Sbjct: 450  ISQE------EVLKEQAYLLFY 465

 Score = 39.3 bits (90), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 103/240 (42%), Gaps = 48/240 (20%)

Query: 582 IPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASN 641
           +P++ER         ++GL N+G+TC+++S++QCL     F    +S  + N  +  + +
Sbjct: 127 VPSMERRD------GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPD 180

Query: 642 RPHHSPKLSNSLSMLFNKMYLNGGCSVVP-----TGFLKVINQLRPDLKIPDD-----QQ 691
           +   S  L   +  L+  +      S        TGF+ +   L    KI  +     QQ
Sbjct: 181 KC-FSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYL---LTCAWKINQNLAGYSQQ 236

Query: 692 DTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISP 751
           D  EF   +++++H      Q    D PN      +V + +N + +              
Sbjct: 237 DAHEFWQFIINQIH------QSYVLDLPNA----KEVSRANNKQCE------------CI 274

Query: 752 IDDIFQGQMENSLQCKRC---GYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLED 808
           +  +F+G +E+S+ C  C     TT +   F  LSL I  +  KL +   S  K+ +L+D
Sbjct: 275 VHTVFEGSLESSIVCPGCQNNSKTTID--PFLDLSLDIKDKK-KLYECLDSFHKKEQLKD 331

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 61/135 (45%), Gaps = 25/135 (18%)

Query: 932  NKKMTTVKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNI--ILKNNDT-- 984
            N     +K ++   LP +LV+ L RF + L   + K N  I YP  LN+     + D+  
Sbjct: 337  NTSQDAIKRLSIYKLPSVLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNMRDYCSSGDSDV 396

Query: 985  ----MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSD 1040
                + Y L GVV H GT+  GHY +        +  +   +W+ F+D +V +  +    
Sbjct: 397  DVPDLIYELIGVVAHKGTVNEGHYVA--------TTKVAGRQWFKFNDSMVSSVTQE--- 445

Query: 1041 KNLKISSSDVYVLFY 1055
               +  +   Y+LFY
Sbjct: 446  ---EALNEQAYLLFY 457

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 63/141 (44%), Gaps = 30/141 (21%)

Query: 582 IPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASN 641
           +P++ER   ++      GL NLG+TC+++S++Q L     F    IS ++       +  
Sbjct: 127 VPSVERRDGLH------GLLNLGSTCFMSSILQILIRNPYFFNFSISQSH-------SKK 173

Query: 642 RPHHSPK--LSNSLSMLFNKMYLNGGCSVVPTG-------FLKVINQLRPDLKIPDD--- 689
            P   PK  +S +L  +  + Y   G S   TG       +   I  L    KI ++   
Sbjct: 174 CPIQDPKSCISCALEKMVCEFY---GSSAYSTGDVEPQAMYSGFIGLLVCSWKINENLAG 230

Query: 690 --QQDTQEFLMILLDRLHDEL 708
             QQD  EF   LL++LH + 
Sbjct: 231 YSQQDAHEFWQFLLNQLHHDF 251

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 52/126 (41%), Gaps = 15/126 (11%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHS-PKLSNSLSMLF 657
           G +N+GNTCY+NS +Q L+  K  R L +S N        A++    S  K+   L   F
Sbjct: 109 GFQNMGNTCYLNSTLQALYRIKPLRELILSYNGSETATSSAADSTVESHKKIVLELQRCF 168

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDD------QQDTQEFL--------MILLDR 703
             +      SV+P   L  + +  P     D       QQD +E          ++  D+
Sbjct: 169 QNLKNKSFKSVMPMVLLTALRKCYPQFAERDSQMGFYKQQDAEELFTQLFHSLSVVFGDK 228

Query: 704 LHDELS 709
             DE S
Sbjct: 229 FEDEFS 234

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 8/52 (15%)

Query: 987  YRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYF-DDEVVKADKK 1036
            Y L GV+ H G    SGHY S +  D +        KWY F DD+V   DK+
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDED------KWYKFNDDKVSVVDKE 476

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 10/113 (8%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL N+GNTCY+NS +Q L+     R + +    +  ++P   +  H+  KL + L   F 
Sbjct: 110 GLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKEQANVQP--GDELHY--KLISELKRCFE 165

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPDD------QQDTQEFLMILLDRLH 705
            +      SV+P  FL ++ +  P     D+      QQD +E    L   L+
Sbjct: 166 NLQKKSYESVMPVVFLNLLRKCYPQFAEVDNANGIFKQQDAEELFTQLFSSLN 218

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 8/109 (7%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           G +N+GNTCY+N+ +Q LF     R L ++ + K +      +  HH  KL   L   F 
Sbjct: 109 GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLNPQDEMHH--KLILELKHCFE 166

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPD------DQQDTQEFLMILL 701
            +      SV+P   + V+ ++ P     D       QQD +E    L 
Sbjct: 167 SLKQKNYQSVLPIVLINVLRKVYPQFAERDPQAGFYKQQDAEELFTQLF 215

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 63/134 (47%), Gaps = 24/134 (17%)

Query: 932  NKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKN---NTVITYPLILNI---ILKNNDT- 984
            N  +  +K      LP +LV+ L RF + +   N   N  + YPL LN+     +N +  
Sbjct: 341  NTSLDPIKQFTINKLPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQE 400

Query: 985  ---MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDK 1041
               + Y L G+++H G++  GHY  ++         I   +W+ F+D ++   K+   D+
Sbjct: 401  TPDIIYELTGILSHIGSINEGHYVVVLK--------INDGRWFKFNDSMISVIKE---DE 449

Query: 1042 NLKISSSDVYVLFY 1055
             LK      Y+LFY
Sbjct: 450  ALK---QQAYLLFY 460

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 85/213 (39%), Gaps = 70/213 (32%)

Query: 581 SIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFA------AKTFRTLFISSNYKNY 634
           +IP+ ER   ++      GL N+G+TC+++S++Q L            +T F++ + KN 
Sbjct: 127 TIPSQERRDGLF------GLVNMGSTCFMSSILQALIHNPYIVNYSMSQTHFVNCSIKN- 179

Query: 635 LEPLASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVP-------------TGFLKVINQLR 681
                      S  +S +L  +  + Y  G   + P             +     I+ L 
Sbjct: 180 ----------SSLCMSCALDAMIIEFY--GQSKLQPISSSSSSSSSSSSSSPSAFISLLT 227

Query: 682 PDLKIPDD-----QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEY 736
             LKI ++     QQD  EFL   L++LH +                Y  D    S+NE 
Sbjct: 228 CSLKINENFAGYSQQDAHEFLQYFLNQLHQD----------------YKRD---SSHNEQ 268

Query: 737 KHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 769
           ++        N       IFQG++++S+ C  C
Sbjct: 269 EN--------NCPCVAHSIFQGELKSSIVCPEC 293

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 114/263 (43%), Gaps = 56/263 (21%)

Query: 581 SIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYL---EP 637
           SIPT+ +      +  + GL N+G+TCY++S++QCL     F  L +   + NY    +P
Sbjct: 126 SIPTLTQ------AHGLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNYCKIQDP 179

Query: 638 LASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPT-GFLKVIN-QLRPDLKIPD-DQQDTQ 694
           +          +S ++  + ++ Y  G     P  G + ++N   R +  +    QQD  
Sbjct: 180 MKC--------MSCAIDNIISETY--GNKKTTPNEGLVDILNCSWRVNKNLAGYTQQDAH 229

Query: 695 EFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPID- 753
           EFL  +L+++H          NDY    +++ +  +++  ++K   + N     +   + 
Sbjct: 230 EFLQFILNQMH----------NDYKLNEIHDTNKQEMNGTDFKTMVNGNSSKEHLHLCNC 279

Query: 754 ---DIFQGQMENSLQCKRC---GYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLE 807
               IFQG +++ + C  C     TT +           P   + L   G+ST     L 
Sbjct: 280 LPHTIFQGFLKSIISCSECKAQSQTTID-----------PYMDLSLDVKGKST-----LY 323

Query: 808 DCINMFTSDEVLSGENAWDCPRC 830
           +C+  F   E L  +  ++C +C
Sbjct: 324 ECLESFHRTERLH-DFTYNCKKC 345

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 49/122 (40%), Gaps = 30/122 (24%)

Query: 932  NKKMTTVKTINFVTLPKILVIHLSRFYYDLTK---KNNTVITYPLILNI----------- 977
            NK     + ++ + L  I+VI L RF + +T    K N  + +PL LN+           
Sbjct: 346  NKSQDANRQLSILKLAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPTPDT 405

Query: 978  --------ILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE 1029
                      K+   M Y L G+V H GT+  GHY +                WY F+D 
Sbjct: 406  DPTNLNEKTNKSTPDMIYELTGIVTHRGTVNEGHYITY--------TKTADGVWYQFNDS 457

Query: 1030 VV 1031
            VV
Sbjct: 458  VV 459

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 49/115 (42%), Gaps = 13/115 (11%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            GL+N G TCY+NS++Q  +  K FR L        Y  P     P      +NS+S+  
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLV-------YQIPTEGETP------ANSVSLAL 236

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQ 712
            + +     S  P    ++      D      Q D QE   IL+DRL +++   +
Sbjct: 237 QRAFFQLQRSSEPLDTCELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKGTE 291

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 65/135 (48%), Gaps = 23/135 (17%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNI-------ILKNNDT-MK 986
            K + F + P +L + L RF YD       K N    +P  +++       + +++    K
Sbjct: 367  KGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVQEDSPANAK 426

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNL-- 1043
            Y L GV+ HTG + +GHY +++   LE +       WY FDD+ V +  KK   ++N   
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIKPGLEDA-------WYRFDDDKVWRVTKKQVFEQNFGF 479

Query: 1044 -KISSSDVYVLFYER 1057
             K+S  D+  L  E+
Sbjct: 480  DKLSEYDLRSLTKEQ 494

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 87/238 (36%), Gaps = 70/238 (29%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G +N G TCY+NS++Q  F  K FR L        Y  P  ++ P      +NS+ +  
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLV-------YQIPTENDSP------NNSVPLAL 239

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S  P   L++      D      Q D QE   IL+DRL +++         
Sbjct: 240 QRAFYQLQVSDEPLDTLELTRSFGWDSGDAFTQHDVQELNRILMDRLENKMKG------- 292

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDD----IFQGQMENSLQCKRCGYTT 773
                                           +P++D    IF G+M++ ++C    Y +
Sbjct: 293 --------------------------------TPVEDKLNEIFVGRMKSYIKCINVDYES 320

Query: 774 FNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
                F+ L + +      L  L  S E  +++          E+++GEN +     G
Sbjct: 321 SRVEEFWDLQMNVKN----LKDLKSSFENYIEI----------ELMNGENQYAAQDYG 364

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 54/121 (44%), Gaps = 21/121 (17%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNII-----LKNNDTMK--- 986
            K + F + P +L + L RF YD       K N    +P  +++      +   DT     
Sbjct: 370  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPC 429

Query: 987  -YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNLK 1044
             Y+L GV+ H G + +GHY +++    E        +WY FDDE V K  K    D+N  
Sbjct: 430  IYKLHGVLVHAGDISTGHYYAMIKPSTE-------DQWYRFDDEKVWKVTKTQVFDENFG 482

Query: 1045 I 1045
            +
Sbjct: 483  L 483

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 62/121 (51%), Gaps = 7/121 (5%)

Query: 599 GLRNLGNTCYINSMIQCLFAAK--TFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656
           GL NLGN+CY+NS++QC +      +    + + +   +   ++N      KL+N++  +
Sbjct: 327 GLINLGNSCYLNSILQCFYNGGIPNWSVEELGTEFPLSVVYPSNNLKCQLLKLTNAMK-I 385

Query: 657 FNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAN 716
            + +Y NG   + PT F K I     +    + QQD  EFL  ++D L +++ N  +  N
Sbjct: 386 ESDLYPNG---IKPTAFKKCIGGSHNEFS-SNRQQDAMEFLTYMIDVLDNKIFNTANNPN 441

Query: 717 D 717
           D
Sbjct: 442 D 442

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 60/133 (45%), Gaps = 29/133 (21%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNI--ILKNNDTMKYRLFGV 992
            + +    LP IL +HL RF Y   +K+N      I YPL L++      + + KY L GV
Sbjct: 545  RIVGLKQLPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGV 604

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKK--------HGSDKNL 1043
            V H G+    GHY  +   +        +  W  +DDE V++ ++        H  D+  
Sbjct: 605  VIHMGSGPQHGHYVCICKNE--------KFGWLLYDDETVESIREETVLQFTGHPGDQ-- 654

Query: 1044 KISSSDVYVLFYE 1056
                +  YVLFY+
Sbjct: 655  ----TTAYVLFYK 663

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 8/72 (11%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656
           + G  N GNTCY NS++QCL+    FR      N   Y E  A+NR   S    +   + 
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFRC-----NILQYPEKPATNRIRKSDLKGSKARIF 187

Query: 657 FNKMY---LNGG 665
            N+ +   +NGG
Sbjct: 188 TNESFETSVNGG 199

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 58/118 (49%), Gaps = 20/118 (16%)

Query: 939  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYPLILNIILKNNDTMK- 986
            K + F + P +L + L RF YD     L K N+      ++   P + +  L+ N   K 
Sbjct: 380  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKI 439

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNL 1043
            Y+L GV+ HTG + +GHY +L+           + +WY FDD+ V +A KK   D N 
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKPST-------KDEWYRFDDDRVWRATKKQIFDDNF 490

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 46/111 (41%), Gaps = 13/111 (11%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G RN G TCY+NS++Q  +  K FR L        Y  P     P+      +S+++  
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLV-------YQIPTEGENPN------DSVTLAL 249

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 708
            + +     S  P   +++      D      Q D QE   IL+DRL   +
Sbjct: 250 QRAFYQLQVSQFPLDTMELTRSFGWDNAEAFTQHDVQELNRILMDRLETRM 300

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
            Anc_7.390 YBL067C
          Length = 765

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 59/129 (45%), Gaps = 17/129 (13%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILN--IILKNNDTMKYRLFGV 992
            + +    LP  L +HL RF Y   +  N      I YPL L+      ++ + KY L G+
Sbjct: 561  RKVGLKQLPHTLALHLKRFKYSEEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGI 620

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNL--KISSSD 1049
            V H G     GHY SL   D     + G   W  FDDE V+A  +    K +  + S + 
Sbjct: 621  VVHMGGGPQHGHYVSLCKND-----NFG---WLLFDDETVEAVHESTVSKFIGDRDSLTT 672

Query: 1050 VYVLFYERV 1058
             YVLFY+ +
Sbjct: 673  AYVLFYKEI 681

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFI 627
           + G  N GNTCY NS++QCL+    FR L +
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLLL 153

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 58/140 (41%), Gaps = 30/140 (21%)

Query: 932  NKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTV---ITYPLILNI--ILKNNDTMK 986
            N     +K +    LP +LV+ L RF + L   N  +   I +P  LN+       ++ K
Sbjct: 340  NSTQDAIKQLGIHRLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEK 399

Query: 987  -----------YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADK 1035
                       Y L G+V+H GT+  GHY +           I   +W+ F+D VV +  
Sbjct: 400  HTGNGKVPDIIYELIGIVSHRGTVNEGHYIAFCK--------ISGGQWFKFNDSVVTSIA 451

Query: 1036 KHGSDKNLKISSSDVYVLFY 1055
            +       ++     Y+LFY
Sbjct: 452  QG------EVLKEQAYLLFY 465

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 107/245 (43%), Gaps = 56/245 (22%)

Query: 581 SIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLAS 640
           ++P +ER         ++GL N+G+TC+++S++QCL     F    +S  + N  +  + 
Sbjct: 126 TVPIMERRD------GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNKCKVGSP 179

Query: 641 NRPHHSPKLSNSLSMLFNKMY--LN-------GGCSVVPTGFLKVINQLRPDLKIPDD-- 689
           ++       S +L  +  ++Y  LN          +   TGF+ +   L    KI  +  
Sbjct: 180 DKC-----FSCALDKIIQELYGVLNTDQPSPSSSATNRQTGFIYL---LTCAWKINQNLA 231

Query: 690 ---QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIG 746
              QQD  EF   +++++H      Q   +D PN      ++ +V+N   +         
Sbjct: 232 GYSQQDAHEFWQFIINQIH------QSYTHDSPNA----KEIDRVNNKRCE--------- 272

Query: 747 NGISPIDDIFQGQMENSLQCKRC---GYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKR 803
                +  +F+G +E+S+ C  C     TT +   F  LSL I  +  KL +   S  K+
Sbjct: 273 ---CIVHSVFEGSLESSIVCPGCQKNSKTTID--PFMDLSLDIKDKK-KLYECLDSFHKK 326

Query: 804 VKLED 808
            +L+D
Sbjct: 327 EQLKD 331

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 67/137 (48%), Gaps = 22/137 (16%)

Query: 931  KNKKMT-TVKTINFVTLPKILVIHLSRFYYDLT--KKNNTVITYPLILNIILKNNDTM-- 985
            K KK+T  +K+   +  P+ LV+HL +F ++ T   K    ++YP+ L++    ++++  
Sbjct: 575  KCKKVTNALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCHESISS 634

Query: 986  ---KYRLFGVVNHTG-TLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDK 1041
               +Y+L  VV H G +L SGHY +   +            W  +DDE +       S+K
Sbjct: 635  LPVRYQLISVVVHEGRSLSSGHYIAHCKQP--------DGSWATYDDEYINKI----SEK 682

Query: 1042 NLKISSSDVYVLFYERV 1058
             L +   + Y L Y R+
Sbjct: 683  QL-LKEPNAYFLVYTRL 698

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 108/260 (41%), Gaps = 61/260 (23%)

Query: 581 SIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTF-RTLFISSNYKNY--LEP 637
           S P+ +R         ++GL N+G+TCY++ +IQCL     F +  F  ++YK     +P
Sbjct: 126 SFPSYDRKD------GLSGLVNMGSTCYMSCIIQCLVRNPYFLKHSFNQTHYKECKIRDP 179

Query: 638 LASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDD-----QQD 692
           ++         LS +L  +  ++Y       V      +I+ L    KI +D     QQD
Sbjct: 180 VSC--------LSCALDSVVFELYGKTQKKAVDDKNGGLIDILNCTWKINEDLVGYSQQD 231

Query: 693 TQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPI 752
             EF   L++R+H E                      K++NN  +   D + + N I   
Sbjct: 232 AHEFWQFLMNRIHSE---------------------YKLNNNTIEVPKDTHQLCNCI--Y 268

Query: 753 DDIFQGQMENSLQCKRCGYTTFNYSTFYV-LSLAIPTRSMKLSKLGRSTEKRVKLEDCIN 811
             +FQG +E++++C  C   +   +  Y+ LSL +  +                L +C+N
Sbjct: 269 HKVFQGFLESTIECANCRKESKTTTEAYMDLSLDLKDKKT--------------LYECLN 314

Query: 812 MFTSDEVLSGENAWDCPRCG 831
            F   E L  +  + C  CG
Sbjct: 315 SFHMKEELK-DFTFHCSNCG 333

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 23/110 (20%)

Query: 937  TVKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNI----ILKNNDTMK--- 986
             +K +    LP +L++ L RF + L   + K N  I YP  L +       +N+T+    
Sbjct: 338  ALKQLTISKLPPVLLLQLKRFEHKLNGQSSKLNDSIEYPPYLRMNDYCQTSSNETIDSPD 397

Query: 987  -----YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
                 Y L GV+ HTGT+  GHY          S  +  ++W  F+D ++
Sbjct: 398  DSDIIYELIGVICHTGTVNEGHYIC--------SCKLANNQWVKFNDSMI 439

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 59/137 (43%), Gaps = 33/137 (24%)

Query: 938  VKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNIIL----KNNDT------ 984
            +K +    L  +LV  L RF + L   T K N  I YPL LN+       NNDT      
Sbjct: 365  IKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESN 424

Query: 985  ------MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHG 1038
                  M Y L  +++H GT+  GHY  +        V +   +W+ F+D +V A  +  
Sbjct: 425  SENVPDMIYELTSIISHKGTVNEGHYIVV--------VKVNDGQWFKFNDSMVSAITEEE 476

Query: 1039 SDKNLKISSSDVYVLFY 1055
            + K         Y+LFY
Sbjct: 477  ALK------QQAYLLFY 487

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 60/119 (50%), Gaps = 21/119 (17%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLE---PLASNRPHHSPKLSNSLSM 655
           GL N+G+TC+++S++Q L          +   + N  +   PL+          S +L +
Sbjct: 138 GLVNMGSTCFMSSILQTLIHNPYVVNYSMCQTHYNMCQSKNPLSCT--------SCALDL 189

Query: 656 LFNKMYL--NGGCSVVPTGFLKVINQLRPDLKIPDD-----QQDTQEFLMILLDRLHDE 707
           +  + Y   + G +   TGF+ ++N L   L++ ++     QQD  EFL  +L+++H++
Sbjct: 190 IITEFYATESKGNNSSHTGFISLLNSL---LQVNENFAGYSQQDAHEFLQFILNQIHND 245

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 19/127 (14%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL+N+GNTCY+N+ +Q LF   + R L +     NY    AS +     K+   +   F 
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLIL-----NYDPAKASPQDEMHHKIVLEMKRCFE 162

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPD------DQQDTQE--------FLMILLDRL 704
            +      SV+P   L V+ +  P     D       QQD +E        F ++  D+ 
Sbjct: 163 NLENKSYKSVMPLMLLNVLRKCYPQFAERDAQGGFYKQQDAEELFTQLFHTFDIVFGDKF 222

Query: 705 HDELSNQ 711
            D+ + Q
Sbjct: 223 SDDFTVQ 229

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 54/121 (44%), Gaps = 21/121 (17%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILNII---------LKNNDTM 985
            K + F + P +L + L RF YD       K N    +P  +++          L N +  
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEAC 439

Query: 986  KYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNLK 1044
             Y L GV+ H G + +GHY +++   +         +WY FDD+ V +  KK   D+N  
Sbjct: 440  IYNLHGVLVHAGDISTGHYYTMIRPGVS-------DEWYRFDDDKVWRVTKKQAFDENFG 492

Query: 1045 I 1045
            +
Sbjct: 493  L 493

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 88/234 (37%), Gaps = 62/234 (26%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G +N G TCY+NS++Q  F  K FR L        Y  P   + P      +NS+ +  
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLV-------YEIPTDMDSP------NNSVPLAL 249

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717
            + +     S  P   L++      D      Q D QE   IL+DRL + +         
Sbjct: 250 QRAFYQLQVSNEPLDTLELTRSFGWDNGDAFTQHDVQELNRILMDRLENRMK-------- 301

Query: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 777
                                  +  V G     ++++F G+M++ ++C    Y +    
Sbjct: 302 -----------------------ETPVEGK----LNELFVGKMKSYIKCINVDYESSRVE 334

Query: 778 TFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
            F+ L L +  +++K             LE+  + +   E+++GEN +     G
Sbjct: 335 DFWDLQLNV--KNLK------------GLEESFSNYIEIELMNGENQYAAQDYG 374

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 63/133 (47%), Gaps = 23/133 (17%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNI--ILKNNDTMKYRLFGV 992
            + +    LP IL +HL RF Y   +++N      I YPL L++     ++ + KY L GV
Sbjct: 539  RIVGLKQLPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGV 598

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISS---- 1047
            V H G+    GHY  +   +        +  W  +DDE V++ ++   +  LK +     
Sbjct: 599  VIHMGSGPQHGHYVCICKNE--------KFGWLLYDDETVESIRE---ETVLKFTGHPGD 647

Query: 1048 -SDVYVLFYERVY 1059
             +  YVLFY+  +
Sbjct: 648  QTTAYVLFYKETH 660

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N GNTCY NS++QCL+    FR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNISEFR 151

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 75/191 (39%), Gaps = 38/191 (19%)

Query: 643 PHHSPKLSNSLSMLFNKMYLNGGCS--VVPTGFLKVINQLRPDLKIPDDQQDTQEFLMIL 700
           P+    L N L  +F  +  N   +  V PT F+K++ +          QQD  EFL  L
Sbjct: 376 PNEEATLYNGLKDIFESITENLSLTGIVSPTEFVKILKKENVLFNTMM-QQDAHEFLNFL 434

Query: 701 LDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQM 760
           L              ND+       ++ ++  N+  +    K+++    + I D+F+G +
Sbjct: 435 L--------------NDF-------SEYIERRNSGMQFGPKKDIVNANDNFIADLFKGTL 473

Query: 761 ENSLQCKRCGYTTFNYSTFYVLSLAIPT-RSMKLSKLGRSTEKRVKLEDCINMFTSDEVL 819
            N ++C  C   T     F    + +       + K+ RS  +R             E+L
Sbjct: 474 TNRIKCLTCDNITSRDEPFLDFPIEVQGDDETDIQKILRSYHQR-------------EML 520

Query: 820 SGENAWDCPRC 830
           +G N + C +C
Sbjct: 521 NGVNKFYCNKC 531

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
            Anc_7.390 YBL067C
          Length = 715

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 15/100 (15%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNI-ILKNNDTMK-YRLFGV 992
            + +    LP+ L++HL RF Y   + +N      I YPL+L +    N+D  K Y L G+
Sbjct: 513  RIVGLKKLPETLILHLKRFKYSEEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTGI 572

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            V H G     GHY S+   +        +  W  FDDEVV
Sbjct: 573  VLHLGGGPQHGHYVSICKNE--------KYGWLLFDDEVV 604

 Score = 36.2 bits (82), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N GNTCY NS++QCL+     R
Sbjct: 111 VFGYENFGNTCYCNSVLQCLYNIPELR 137

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa] {ON}
            Anc_8.202 YER151C
          Length = 1080

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 68/144 (47%), Gaps = 42/144 (29%)

Query: 946  LPKILVIHLSRF-YYDLTKKNNTVITY----------------------PL--ILNIILK 980
            LP++L+I L RF +     K+N +  Y                      P+  + + ILK
Sbjct: 945  LPQVLLIQLKRFSFVSNIGKDNGMTNYNSYNGRIEKIRKKINYNHELLVPVESVSSAILK 1004

Query: 981  NNDT-MKYRLFGVVNHTGTLI-SGHYTS-LVNKDLEHSVDIGRSKWYYFDD----EVVKA 1033
            NN++  KY+L  VV H G+    GHYT+ + NKDL+        KW+  DD    E+  A
Sbjct: 1005 NNESSRKYKLRAVVYHHGSSPDGGHYTADIYNKDLK--------KWFMIDDVNITELEDA 1056

Query: 1034 DKKHGSDKNLKISSSDVYVLFYER 1057
            D  +G D  L   ++  Y+L YE+
Sbjct: 1057 DVVNGGDNGLDTRTA--YILMYEK 1078

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 54/126 (42%), Gaps = 12/126 (9%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL+N+GNTCY+N+ +Q LF A   + L +  +        A++  H+  K+   L   F 
Sbjct: 110 GLQNMGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHY--KIVLELKRTFE 167

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPD------DQQDTQEFLMILLDRL----HDEL 708
            +      SV+P   L  + +  P     D       QQD +E    L   L     D+ 
Sbjct: 168 TLKKRSFKSVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFHTLTVVFGDKF 227

Query: 709 SNQQHV 714
           +NQ  +
Sbjct: 228 ANQFQI 233

 Score = 32.7 bits (73), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 976  NIILKNNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            N+    N +  Y L GV+ H G    SGHY + +  + +       +KWY F+D+ V
Sbjct: 415  NLAAGENPSSVYDLIGVITHQGANSESGHYQAFIRDESDE------NKWYKFNDDKV 465

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
            (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 62/127 (48%), Gaps = 27/127 (21%)

Query: 946  LPKILVIHLSRFYYDLTKKNNT------VITYPLILNI--ILKNNDTMKYRLFGVVNHTG 997
            LPKIL +HL RF Y  +++NN        ITYP  L++      + + KY L G++ H G
Sbjct: 549  LPKILSLHLKRFKY--SEENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLG 606

Query: 998  TLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA--DK---KHGSDKNLKISSSDVY 1051
                 GHY ++   +        +  W  +DDE V+A  +K   +H  D N     +  Y
Sbjct: 607  AGPQHGHYVAMCKTE--------KFGWLLYDDETVEAVLEKDVLRHVGDSN---DLATAY 655

Query: 1052 VLFYERV 1058
            +LFY+ +
Sbjct: 656  ILFYKTI 662

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%)

Query: 594 SLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFI 627
           S  + G  N GNTCY NS++QCL+     R   I
Sbjct: 123 STKVFGFENFGNTCYCNSVLQCLYNFSELRDNLI 156

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 52/140 (37%), Gaps = 39/140 (27%)

Query: 691 QDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGIS 750
           QD  EFL  LL+ L + +        D  NL        K+   E    F KN       
Sbjct: 434 QDAHEFLNFLLNELSEYI--------DRSNL--------KIEETEKTENFIKN------- 470

Query: 751 PIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCI 810
               IFQG + N ++C  C   T     F  L + + +R+               ++  +
Sbjct: 471 ----IFQGTLTNKIRCLTCDNVTSRDEPFLDLPIEVKSRN------------ETDIKKAL 514

Query: 811 NMFTSDEVLSGENAWDCPRC 830
           + +   E+L+G N + C  C
Sbjct: 515 SNYHQREMLNGSNKFYCDGC 534

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 34/133 (25%)

Query: 938  VKTINFVTLPKILVIHLSRFYYDLTKKN---NTVITYPLILNII-------LKNNDTMKY 987
            +K +    LP +LV+ L RF + +   N   N  ITYP  LN+         ++   M Y
Sbjct: 334  IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 988  RLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISS 1047
             L  V++  G++  GHYT +          +   +W+ F+D ++           + I+ 
Sbjct: 394  ELVAVISQEGSVNQGHYTCMCK--------VPGGQWFRFNDTMI-----------VSITE 434

Query: 1048 SDV-----YVLFY 1055
             DV     Y+LFY
Sbjct: 435  EDVLRQQAYLLFY 447

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 57/140 (40%), Gaps = 30/140 (21%)

Query: 932  NKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTV---ITYPLILN------------ 976
            N     +K +    LP +LV+ L RF + L   N  +   I +P  LN            
Sbjct: 340  NSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEK 399

Query: 977  -IILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADK 1035
             I  K    + Y L G+V+H GT+  GHY +           I   +W+ F+D +V +  
Sbjct: 400  HIGNKKVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVSSIS 451

Query: 1036 KHGSDKNLKISSSDVYVLFY 1055
            +       ++     Y+LFY
Sbjct: 452  QE------EVLKEQAYLLFY 465

 Score = 35.4 bits (80), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 59/266 (22%), Positives = 107/266 (40%), Gaps = 70/266 (26%)

Query: 582 IPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASN 641
           +P +ER         ++GL N+G+TC+++S++QCL     F    +S ++ N  +  + +
Sbjct: 127 VPIMERRD------GLSGLINMGSTCFMSSILQCLIHNPYFIKHSMSQSHFNKCKVRSPD 180

Query: 642 RPHHSPKLSNSLSMLFNKMY--LN-------GGCSVVPTGFLKVINQLRPDLKIPDD--- 689
                   S +L  + +++Y  LN          +    GF+ +   L    KI  +   
Sbjct: 181 NC-----FSCALDKIVHELYGVLNTDQPPSSSSATNRQAGFIYL---LTCAWKINQNLAG 232

Query: 690 --QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGN 747
             QQD  EF   +++++H                      VL + + +     DK  I +
Sbjct: 233 YSQQDAHEFWQFIINQIHQNY-------------------VLSLPSTKES---DKENIKH 270

Query: 748 GISPIDDIFQGQMENSLQCKRC---GYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRV 804
               +  +F+G +E+S+ C  C     TT +   F  LSL I  +               
Sbjct: 271 CDCIVHTVFEGSLESSIVCPSCQNNSKTTID--PFMDLSLDIKDKK-------------- 314

Query: 805 KLEDCINMFTSDEVLSGENAWDCPRC 830
           KL +C++ F   E+L   N + C  C
Sbjct: 315 KLYECLDSFHKKELLKDFN-YHCGEC 339

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 19/105 (18%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTK----KNNTVITYPLILN--------IILKNNDTMK 986
            K + F + P +L + L RF YD       K N    +P  ++        I   N D+  
Sbjct: 383  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADSYI 442

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            Y L GV+ HTG + +GHY +++   +E        +WY FDD+ V
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKPSIE-------DQWYRFDDDKV 480

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 47/111 (42%), Gaps = 13/111 (11%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
            G +N G TCY+NS++Q  F  K FR L        Y  P     P+      NS+ +  
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLV-------YQIPTDKESPN------NSVPLAL 252

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 708
            + +     S  P   L++      D      Q D QE   IL+DRL +++
Sbjct: 253 QRAFFQLQKSNEPLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLENKM 303

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
            complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 55/125 (44%), Gaps = 23/125 (18%)

Query: 946  LPKILVIHLSRFYYDLTKKNNT----VITYPLILNIILKNNDTMK--YRLFGVVNHTGTL 999
            LPK L IHL RF Y      N      I YP+ L +    ++++   Y L G+V H G  
Sbjct: 527  LPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGLVVHIGIG 586

Query: 1000 IS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHG-----SDKNLKISSSDVYVL 1053
               GHY S+       + D G   W  FDDE V+   +        D N   S+   YVL
Sbjct: 587  PQHGHYISVC-----KTSDYG---WLLFDDETVECISEDTVLSFVGDSN---SAGTAYVL 635

Query: 1054 FYERV 1058
            FY+ +
Sbjct: 636  FYKEI 640

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 27/44 (61%), Gaps = 4/44 (9%)

Query: 583 PTIERNPNVYVSLSIT---GLRNLGNTCYINSMIQCLFAAKTFR 623
           PT E N N+ + + I    GL N GNTCY NS++QCL+    FR
Sbjct: 114 PTNEEN-NLDIDIDIHKVYGLENFGNTCYCNSILQCLYNMNEFR 156

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 62/163 (38%), Gaps = 36/163 (22%)

Query: 668 VVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNAD 727
           + P GF++++ +    L   D  QD  EFL  LL+ + D L       N           
Sbjct: 386 ISPGGFMEIVKKENI-LFATDMHQDAHEFLNFLLNDVSDYLDKANTEKNP---------- 434

Query: 728 VLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIP 787
                        D    GN  + ++DIF+G + N ++C  C   T  Y +F    + + 
Sbjct: 435 -------------DNTRSGNETNFVNDIFKGTITNQIRCLTCDTVTSRYESFLDFPIEV- 480

Query: 788 TRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
                   +G  T   + ++  +  +   E+L G N + C  C
Sbjct: 481 --------IGDET---IDIQKMMISYHQKEMLQGSNKFYCGTC 512

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 85/204 (41%), Gaps = 53/204 (25%)

Query: 591 VYVSLSITGLRNLGNTCYINSMIQCLF---AAKTFRTLFISSNYKNYLEPLASNRPHHSP 647
           V+ +L   GL N G TCY N+ +Q +    A + +    +   YKN ++P +        
Sbjct: 435 VFANLRPKGLINHGVTCYTNAAVQAMVHIPAVQHYLFDILRGKYKN-IDPNS-------- 485

Query: 648 KLSNSLSMLFNKMYLN---GGCSVV----PTGFLKVINQLRPDLKIPDDQQDTQEFLMIL 700
            +S +L+    +M+L+   G   V+    P   ++ ++ +   +  P +Q+D+ E+ M L
Sbjct: 486 -VSYTLAETTRRMWLSNKKGNKKVIAYYNPNELIERLDDINWSMN-PYNQEDSHEYFMSL 543

Query: 701 LDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQM 760
           + +L +   N   +  +    ++Y                             DIF G +
Sbjct: 544 MSKLQE---NSVPIGRNMTESIIY-----------------------------DIFGGLL 571

Query: 761 ENSLQCKRCGYTTFNYSTFYVLSL 784
           E ++ CK CG  +     FY LSL
Sbjct: 572 EQTVTCKSCGGVSKTEQEFYDLSL 595

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 16/118 (13%)

Query: 922  NDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYD--LTKKNNTVITYPLILNII- 978
            ND     +  NK    +K    +  P+ LV+HL +F ++   + K    ++YP+ L+I  
Sbjct: 689  NDKGYVCEKCNKTTNAIKRSTILRAPETLVVHLKKFRFNGSTSSKMKQAVSYPMYLDITE 748

Query: 979  ----LKNNDTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
                 K     KY+L  VV H G +L SGHY +   +            W  +DDE++
Sbjct: 749  YCESSKKVLPAKYQLLSVVVHEGRSLSSGHYIAHCRQ--------PDGTWATYDDELI 798

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 20/118 (16%)

Query: 939  KTINFVTLPKILVIHLSRFYYD-----LTKKNN------TVITYP-LILNIILKNNDTMK 986
            K + F + P +L + L RF YD     L K N+      T+   P L  +++ KN     
Sbjct: 379  KGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCV 438

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNL 1043
            Y L GV+ H+G +  GHY +++  D+         +W+ FDD+ V +  K+   D+N 
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKPDV-------GDQWFRFDDDKVWRVTKEQAFDENF 489

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 47/114 (41%), Gaps = 13/114 (11%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL+N G TCY+NS++Q  F  K FR +        Y  P  +  P+ S  L+   S    
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV-------YKIPSENESPNDSVLLALQRSFYL- 254

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQ 712
              L      + T  L++      D      Q D QE   IL+DRL   +   +
Sbjct: 255 ---LQKSNETLDT--LELTRSFGWDTGDAFTQHDVQELNRILMDRLETRMKGTE 303

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 58/142 (40%), Gaps = 32/142 (22%)

Query: 932  NKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTV---ITYPLILNII---------- 978
            N     +K +    LP +LV+ L RF + L   N  +   I +P  LN+           
Sbjct: 340  NSTQDAIKQLGIHRLPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESES 399

Query: 979  ---LKNNDT--MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
               + N     + Y L G+V+H GT+  GHY +           I   +W+ F+D +V +
Sbjct: 400  ENHIGNGKVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVSS 451

Query: 1034 DKKHGSDKNLKISSSDVYVLFY 1055
              +       ++     Y+LFY
Sbjct: 452  ISQE------EVLKEQAYLLFY 467

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 108/269 (40%), Gaps = 76/269 (28%)

Query: 582 IPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASN 641
           +P +ER         ++GL N+G+TC+++S++QCL     F         ++ +  + SN
Sbjct: 127 VPAMERRD------GLSGLINMGSTCFMSSILQCLIHNPYF--------IRHSMRQIHSN 172

Query: 642 RPH-HSPK--LSNSLSMLFNKMY--LN-------GGCSVVPTGFLKVINQLRPDLKIPD- 688
           +    SP    S +L  + +++Y  LN          +    GF   I+ L    KI   
Sbjct: 173 KCKVRSPDKCFSCALDKIVHELYGVLNTDQPSSSSSATNRQGGF---IHLLTCAWKINQS 229

Query: 689 ----DQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNV 744
                QQD  EF   L++ +H     Q +V      L L N   +  +NN+         
Sbjct: 230 LAGYSQQDAHEFWQFLINEIH-----QSYV------LSLPNPKEVDRANNKRCDCI---- 274

Query: 745 IGNGISPIDDIFQGQMENSLQCKRC---GYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTE 801
                  +  +F+G +E+S+ C  C     TT +   F  LSL I  +            
Sbjct: 275 -------VHTVFEGSLESSIVCPGCQNNSKTTID--PFMDLSLDIKDKQ----------- 314

Query: 802 KRVKLEDCINMFTSDEVLSGENAWDCPRC 830
              KL +C++ F   E+L   N + C  C
Sbjct: 315 ---KLYECLDSFHKKELLKDFN-YHCGEC 339

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 86/233 (36%), Gaps = 62/233 (26%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           G +N G TCY+NS++Q  F  K FR +        Y  P  +  P+      +S+S+   
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMV-------YKIPSDNESPN------DSVSLALQ 249

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDY 718
           + +     S  P   L++      D      Q D QE   IL+DRL   +   +      
Sbjct: 250 RSFYLLEKSKEPLDTLELTRSFGWDTGEAFTQHDVQELNRILMDRLETRMKGTE------ 303

Query: 719 PNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYST 778
                                    V G     ++D+F G+M++ ++C    Y +F    
Sbjct: 304 -------------------------VEGT----LNDLFVGKMKSYIRCVNVDYESFRVED 334

Query: 779 FYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
           F+ + L +      L  +  S E  V++          E++ GEN +     G
Sbjct: 335 FWDIQLNVKN----LKDVKESFENYVEV----------EMMDGENQYAAQDYG 373

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 56/118 (47%), Gaps = 20/118 (16%)

Query: 939  KTINFVTLPKILVIHLSRFYYD-----LTKKNN-----TVITYPLILNIILKNN--DTMK 986
            K + F + P +L + L RF YD     L K N+       I     L+  +K+N  +T  
Sbjct: 379  KGVVFESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPYLDPDVKDNYPNTCI 438

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNL 1043
            Y L  V+ H+G + +GHY +++  ++         +W+ FDD+ V K  K    D+N 
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKPNV-------TDQWFRFDDDKVWKVTKTQAFDENF 489

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 43/109 (39%), Gaps = 15/109 (13%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GLRN+GNTCY N+ +Q L+  K  R   ++ N  N         P    +L   L   FN
Sbjct: 107 GLRNMGNTCYFNASLQALYRIKPLREKVLAYNEPN---------PDLHGQLVIQLRNCFN 157

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPD------DQQDTQEFLMILL 701
                      P   L V+ ++ P     D       QQD +E    LL
Sbjct: 158 AFAQRKEKEFTPIILLTVLRKIYPQFAEKDPSTGFYKQQDAEELFTQLL 206

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 987  YRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            Y L GVV H G    SGHY + V  D +       +KWY ++D+ V
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADE------NKWYKYNDDKV 454

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 9/112 (8%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           G+ NLGNTCY+N+ +Q LF     R   +  + K  ++       +H+ +L   L + F 
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIKEGVDT--YHA-QLVRELKVTFQ 159

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPD------DQQDTQEFLMILLDRL 704
           K+    G ++ P   L+++ ++ P     D       QQD +E    L   L
Sbjct: 160 KLKDRKGENITPLLLLEILRRVFPQFSETDPQGGFYKQQDAEELFTQLFHTL 211

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 8/52 (15%)

Query: 987  YRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH 1037
            Y L GV+ H G    SGHY + +  D +        KWY FDD+ V A +K 
Sbjct: 415  YDLIGVITHQGANSESGHYQAFIRDDADE-------KWYRFDDDKVTAIEKE 459

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 74/186 (39%), Gaps = 46/186 (24%)

Query: 598 TGLRNLGNTCYINSMIQCLFA--AKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
            GL NLGN+CY+NS++Q LFA     +  + + +  K++  P+    P ++ K    L  
Sbjct: 319 CGLINLGNSCYLNSILQALFAQDVSQWADVLMDTIGKDF--PVDVVYPSNNVKC--QLIK 374

Query: 656 LFNKMYLNGGC---SVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQ 712
           L N M +N       + P  F   I Q   +    + QQD  EFL   ++ L  +L    
Sbjct: 375 LLNAMKINPSRYPEGIKPRSFKNCIGQNNKEF-TSNKQQDALEFLSYFVNELDKKL---- 429

Query: 713 HVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYT 772
                                      F K +   G     D+ +  ME+ LQC RC + 
Sbjct: 430 ---------------------------FKKELTNPG-----DLMRCYMEDRLQCLRCKHV 457

Query: 773 TFNYST 778
            ++Y  
Sbjct: 458 KYSYQA 463

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 14/74 (18%)

Query: 987  YRLFGVVNHTGTLI-SGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGSDKNLK 1044
            Y+L GVV H GT + SGHY + + K +++       +W  ++DE +V  D      KN  
Sbjct: 707  YKLTGVVCHKGTSVHSGHYVAFIKKIVDNV-----ERWVLYNDEKIVLGDDTAEIKKN-- 759

Query: 1045 ISSSDVYVLFYERV 1058
                  Y+ FY RV
Sbjct: 760  -----GYIYFYSRV 768

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 50/115 (43%), Gaps = 15/115 (13%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYK---NYLEPLASNRPHHSPKLSNSLSM 655
           G +N+GNTCY+NS +Q LF     + + +  NYK   N + P   +  HH  K+   L  
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMIL--NYKTEGNNISP--EDELHH--KIVIELKK 163

Query: 656 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDD------QQDTQEFLMILLDRL 704
            F  +      +V+P   L V+ +  P     D       QQD +E    L   L
Sbjct: 164 CFETLDGKKFKAVMPVVLLSVLRKCYPQFAERDSQSGFYKQQDAEELFTQLFQTL 218

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 10/87 (11%)

Query: 934  KMTTVKTINFVTLPKILVIHLSRFYYDLT--KKNNTVITYP--LILN-IILKNND----- 983
            K T VK    V  P++L++HLSR  ++     KN   +T+P  L++N  +L+NN      
Sbjct: 375  KSTIVKRTVSVDSPRVLILHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVR 434

Query: 984  TMKYRLFGVVNHTGTLISGHYTSLVNK 1010
             ++Y+L  ++ H GT   GHY    +K
Sbjct: 435  AVRYKLCAMIKHIGTHSQGHYACFRHK 461

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 60/136 (44%), Gaps = 29/136 (21%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNI--ILKNNDTMKYRLFGV 992
            + +    +P IL +HL RF Y   + +N      I YPL L++      + + +Y L GV
Sbjct: 550  RIVGLKQVPYILSLHLKRFKYSEEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSGV 609

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKK--------HGSDKNL 1043
            V H G+    GHY  +   +        +  W  +DDE V++  +        H  D+  
Sbjct: 610  VIHMGSGPQHGHYVCICKNE--------KFGWLLYDDETVESVSEETVLKFTGHSGDQ-- 659

Query: 1044 KISSSDVYVLFYERVY 1059
                +  YVLFY+ ++
Sbjct: 660  ----TTAYVLFYKEIH 671

 Score = 39.7 bits (91), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPL-ASNRPHHSPKLSNSLSM 655
           + G  N GNTCY NS++QCL+    FR      N   Y E +  SNR   S    + + +
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFRC-----NVLRYPERIPVSNRIRKSNLTGSKVRV 189

Query: 656 LFNKMY---LNGGCS 667
             N+ +    NGG S
Sbjct: 190 FTNESFEVSTNGGSS 204

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 21/106 (19%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTK---KNNTVITYPLILNI-----ILKNNDT-----M 985
            K +    L  +L+    RF + L+    K N VI +PL LN+     + + +D+     +
Sbjct: 345  KQLAVAKLSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMKDYCDVEQRDDSNSKPDL 404

Query: 986  KYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
             Y L G++ HTGT+  GHYT++          I   +W  F+D +V
Sbjct: 405  IYELIGIICHTGTVNEGHYTAICK--------IPEGQWIKFNDSMV 442

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 102/239 (42%), Gaps = 48/239 (20%)

Query: 596 SITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
            ++GL N+G+TCY++ +IQCL     F    ++   +++ +   ++ P  +  +S +L  
Sbjct: 135 GLSGLVNMGSTCYVSCIIQCLVRNPYFLKYSLN---QSHFKICKTHDP--TTCISCALDS 189

Query: 656 LFNKMYLNGGCS-----VVPTGFLKVINQLRPDLKIPDD-----QQDTQEFLMILLDRLH 705
           +    Y   G S     V  T    +I+ L    KI  +     QQD  EF   LL+RLH
Sbjct: 190 IVTDFY---GISDLDDDVKKTNNDGLIDLLTCSWKINQNLAGYSQQDAHEFWQFLLNRLH 246

Query: 706 DELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQ 765
            E  +     +  P         LK  N+E         + N I     +FQG +++S+ 
Sbjct: 247 SEYKSNIGPTDTAP---------LKEGNHE---------LCNCI--YHKVFQGFLKSSIV 286

Query: 766 CKRC---GYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLED----CINMFTSDE 817
           C  C     TT     F  LSL I  ++  L +   S  K+ +L D    C N  TS +
Sbjct: 287 CPECNSDAKTTI--EPFMDLSLDIKGKNT-LYECLNSFHKKEQLHDFDYHCKNCNTSQD 342

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 11/128 (8%)

Query: 585 IERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFR---TLFISSNYKNYLEPLASN 641
           ++ NP+  V     GL N+GN+CY+NS++QCLF  +T+     + +   +   +   ++N
Sbjct: 310 VKLNPSKEVG---CGLINMGNSCYLNSVLQCLFQDETWTGKLQMAVGEEFPTDVVFPSNN 366

Query: 642 RPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILL 701
                 KL  ++  L  ++Y  G   + P  F K  +    +      QQD  EFL  ++
Sbjct: 367 LRCQLIKLYRAMK-LEPELYPQG---IKPQSFKKCFSAGHEEFA-SQRQQDAMEFLTYMI 421

Query: 702 DRLHDELS 709
           D L  +LS
Sbjct: 422 DNLDKKLS 429

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 56/133 (42%), Gaps = 25/133 (18%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFGV 992
            + +    LPK L +HL RF Y   +  N      + YPL L++    N  +  +Y L G+
Sbjct: 952  RIVGLKQLPKTLSLHLKRFKYSEEQNCNIKLFNKVNYPLYLDVSSSFNPNINKRYELNGI 1011

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH------GSDKNLKI 1045
            V H G     GHY ++   D        +  W   DDE V+   +       G  K+L  
Sbjct: 1012 VVHMGGGPQHGHYVAICKND--------KFGWLLMDDETVETISEETVLRCKGDSKDL-- 1061

Query: 1046 SSSDVYVLFYERV 1058
              +  YVLFY+  
Sbjct: 1062 --TTAYVLFYKEC 1072

 Score = 38.9 bits (89), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 17/26 (65%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRT 624
           G  N GNTCY NS++QCL+     RT
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRT 542

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 62/148 (41%), Gaps = 22/148 (14%)

Query: 691 QDTQEFLMILLDRLHD-------ELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKN 743
           QD  EFL  LL+ L D       E + ++ +AN+ PN   +N   L  S+       + N
Sbjct: 813 QDAHEFLNFLLNELSDYMIKCINEENLKKTIANN-PNTDTHN--TLTQSHTSNNQQEEDN 869

Query: 744 VIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKR 803
            +      I D+F+G + N  +C  C   T     F    L  P       ++   TE  
Sbjct: 870 NLPRMSDFISDLFRGTLINKTRCLTCDNVTSREEPF----LDFPI------EVKDDTETN 919

Query: 804 VKLEDCINMFTSDEVLSGENAWDCPRCG 831
           ++ E  +  +   E+L+G N + C  CG
Sbjct: 920 IQTE--LKSYHQREMLNGSNKFYCDECG 945

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
            YPL072W
          Length = 471

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 67/159 (42%), Gaps = 37/159 (23%)

Query: 934  KMTTVKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITYPLILNIILKN-----NDTMK 986
            K   ++       P IL +HLSR  ++     +N   + YP  L ++ ++      + + 
Sbjct: 315  KTAIIRRTAISNAPSILSLHLSRSMFNGASFTRNPCRVEYPETLIVLQRDVENGTAERIT 374

Query: 987  YRLFGVVNHTGTLISGHYTSLVNKD-----LEHSVDIGRS-------------------- 1021
            YRL  ++ HTGT  SGHY    +K      +   V + RS                    
Sbjct: 375  YRLRSMIKHTGTHYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKSV 434

Query: 1022 -KW-YYFDDEVVKADKKHGSDKNLKISSSDVYVLFYERV 1058
             +W Y+F  + V  +   G  K L+  S  VY+LFYERV
Sbjct: 435  RRWPYWFISDAVVRESNAG--KMLR-ESKYVYMLFYERV 470

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 61/137 (44%), Gaps = 22/137 (16%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPK--------L 649
            GL NLGN+CY+NS++QCL          ++    N+ + L +   H  PK        L
Sbjct: 342 CGLINLGNSCYLNSVMQCL----------LNGGVPNWSDKLGNIIGHDFPKDVIYPTGNL 391

Query: 650 SNSLSMLFNKMYLNG---GCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHD 706
              +  L N   LN       + P  F + + +   + K  ++QQD+ EFL  + + L  
Sbjct: 392 RCQMIKLLNAFKLNPEDYEEGIRPRSFKECVGKHNAEFKT-NNQQDSMEFLTFVTEELEK 450

Query: 707 ELSNQQHVANDYPNLLL 723
            L  +   A+  PN LL
Sbjct: 451 GLFPKIQDASINPNNLL 467

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 981  NNDTMKYRLFGVVNHTGTLI-SGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            N D   Y+L  V+ H GT + SGHY + + K +++       KW  ++DE +
Sbjct: 741  NLDNKPYKLTAVICHKGTSVHSGHYVAFIRKLIDN-----ERKWVLYNDEKI 787

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 63/153 (41%), Gaps = 28/153 (18%)

Query: 580 YSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLA 639
           Y+I  +    N   S+   G+ N GN C+++S++Q L   K F ++    +Y+     +A
Sbjct: 315 YTIENVPNAGNAIDSIVPRGIVNTGNICFMSSVLQVLLYCKPFISILNVISYRT----VA 370

Query: 640 SNRPHHSPKLSNSLSML--FNKMYLNGGCSVVP---------TGFLKVINQLRPD----- 683
                 SP L   L +   F+K         VP          G       ++PD     
Sbjct: 371 KIGSSVSPSLDACLELYRRFDKQTCENEKKPVPKSKLANGNNVGITPAAEPIKPDDFYKT 430

Query: 684 -LKIP-------DDQQDTQEFLMILLDRLHDEL 708
             K+P         Q+D +EFL  LLD+LH+E 
Sbjct: 431 LSKLPKFRDLRWGHQEDAEEFLTHLLDQLHEEF 463

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 65/166 (39%), Gaps = 45/166 (27%)

Query: 924  SNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILK--- 980
            S++  D + KK T +       LP++L+I L RF +      + ++ Y      + K   
Sbjct: 621  SSSGNDVEAKKQTFIDK-----LPQVLLIQLKRFSFINNTDKDKIVNYNAYSGRVEKIRK 675

Query: 981  -----------------------NNDTMKYRLFGVVNHTGTLIS-GHYTSLVNKDLEHSV 1016
                                   ++   KY+L GVV H G   S GHYT+    D+ H  
Sbjct: 676  KIHYNHELTIPKETISSVHSNFYDDAGTKYKLVGVVYHHGVSPSGGHYTA----DVYHQ- 730

Query: 1017 DIGRSKWYYFDD----EVVKADKKHGSDKNLKISSSDVYVLFYERV 1058
                 KW+  DD    E+ K +   G +      S   Y+L Y+++
Sbjct: 731  --EMDKWFRIDDVNIAELNKEEVLKGGEDGF--DSRTAYILMYQKI 772

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 51/127 (40%), Gaps = 15/127 (11%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNI--ILKNNDTMKYRLFGV 992
            + +    LPK L +HL RF Y   K  N      I YP  L +     +  + +Y L   
Sbjct: 505  RLVGLKRLPKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLSKRYELASA 564

Query: 993  VNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISSSDVY 1051
            V H G     GHY SL   +       G   W  FDDE V+A  +         +S   Y
Sbjct: 565  VIHLGDGPQYGHYISLCKTET-----FG---WLLFDDETVEAVDEQTVLSFTGENSDTAY 616

Query: 1052 VLFYERV 1058
            VLFY  V
Sbjct: 617  VLFYNEV 623

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (62%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFIS 628
           I G  N GNTCY NS++QC F    FRT  +S
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFRTSMLS 157

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 12/79 (15%)

Query: 752 IDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCIN 811
           + DIFQG + N ++C  C   T     F  L  AI  +           ++ + ++  + 
Sbjct: 431 VQDIFQGSLTNQIRCYTCDSITSTEEPF--LDFAIEVKE----------DENLNIQRHLE 478

Query: 812 MFTSDEVLSGENAWDCPRC 830
            F   E+L+G + + C RC
Sbjct: 479 SFHQRELLNGSDKFYCDRC 497

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
           bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/236 (20%), Positives = 85/236 (36%), Gaps = 62/236 (26%)

Query: 596 SITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
              G +N G TCY+NS++Q     K FR L        Y  P     P      +NS+++
Sbjct: 195 GFVGFKNQGATCYLNSLLQSYHFTKLFRKLV-------YQIPTEDENP------TNSVAL 241

Query: 656 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 715
              + +     S  P    ++      D      Q D QE   IL+DRL           
Sbjct: 242 ALQRAFYLLQTSKEPLDTTELTKSFGWDTGDAFTQHDVQELNRILMDRLEHR-------- 293

Query: 716 NDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFN 775
                        +K ++ E K              I+++F G+M++ ++C    Y +  
Sbjct: 294 -------------MKGTSVEGK--------------INELFVGKMKSCIKCINVDYESSR 326

Query: 776 YSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
              F+ + L +  + MK             L++    +   E+++GEN +     G
Sbjct: 327 VEDFWDIQLNV--KDMK------------NLQESFEQYIEVELMNGENQYAAQDHG 368

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 18/124 (14%)

Query: 931  KNKKMTTVKTINFVTLPKILVIHLSRFYYD-----LTKKNNTV-----ITYPLILNIILK 980
            ++  +   + + F + P +L + L RF YD     L K N+       I     L+    
Sbjct: 365  QDHGLQDAQKVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAP 424

Query: 981  NNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKADKKHGS 1039
             +    Y L GV+ H+G + +GHY +++  D           WY FDD+ V+KA  K   
Sbjct: 425  KDTPADYILHGVLVHSGDISTGHYYAMIQPD-------AHGSWYRFDDDRVIKATDKQVF 477

Query: 1040 DKNL 1043
            ++N 
Sbjct: 478  EENF 481

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 56/112 (50%), Gaps = 29/112 (25%)

Query: 933  KKMTTVKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNI--------ILKN 981
            +++TT K      LP +L++ L RF + +   + K N  I++PL LN+         L  
Sbjct: 350  RQLTTAK------LPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKPVDCLHP 403

Query: 982  NDTMKYRLFGVVNHTGTLISGHYTSL--VNKDLEHSVDIGRSKWYYFDDEVV 1031
               M Y+L  +++H GT+  GHYT++  +N D+          W  F+D +V
Sbjct: 404  VPNMMYKLSAIISHHGTVHQGHYTTICRINGDI----------WAKFNDSMV 445

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 96/245 (39%), Gaps = 71/245 (28%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLF---------ISSNYKNYLEPLASNRPHHS-- 646
           TGL N  N C++NS +Q L   ++  T           +       LE LA   P H+  
Sbjct: 75  TGLLNARNDCFLNSSLQALVPIESLTTYLNQFVEALHSVDEGQVFELERLA---PLHANL 131

Query: 647 PKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHD 706
            KL + L  L  K       ++V T    + + LR   K+  DQ D  EF  ILL+ LH 
Sbjct: 132 IKLLHELQSLIVKPQTVSAKNIVKT----LEDTLRR--KMSSDQNDAHEFTQILLETLHS 185

Query: 707 ELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 766
           E                     +K+ +N          I  G  P    F+G   N L C
Sbjct: 186 E--------------------YIKLQSN----------IEIGSFP----FEGVSSNYLMC 211

Query: 767 KRCG-YTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAW 825
            +C  Y+   +S F +L +A+P         G  +E   KL D I + + DE++ G   +
Sbjct: 212 LQCNKYSQTIHSPFLMLEVAVP---------GNYSE---KLTDLI-LHSQDEIIEG---Y 255

Query: 826 DCPRC 830
            C  C
Sbjct: 256 SCLYC 260

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 10/91 (10%)

Query: 924  SNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYD---LTKKNNTV-------ITYPL 973
            S N     N K   +K    +  P  L++HLSR  ++   +T+    V       +   +
Sbjct: 314  SKNGCVTANFKSNIIKKNAVIKEPASLIVHLSRSIFNGATITRSACRVEYEQSLNLQRQV 373

Query: 974  ILNIILKNNDTMKYRLFGVVNHTGTLISGHY 1004
            ++N   +  + +KY L  VV HTG+ + GHY
Sbjct: 374  MINDAFERTEPIKYELKSVVKHTGSHVQGHY 404

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
           (UBP10) - predicted to encode a ubiquitin-processing
           protease [contig 103] PARTIAL
          Length = 511

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/255 (21%), Positives = 96/255 (37%), Gaps = 70/255 (27%)

Query: 599 GLRNLGNTCYINSMIQCLF---AAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
           GL N G TCY N+ +Q L    A + +    +   YK+ + P +         ++  L+ 
Sbjct: 125 GLLNHGVTCYTNAAVQALVHIPAIQHYLFDVLRGEYKSTIAPQS---------VTQVLAE 175

Query: 656 LFNKMYLNGGCS---VVPT---GFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 709
              +M+ N       + P    G L  IN +  + +    Q+D+ E+ M L+ RL ++  
Sbjct: 176 TTKRMWSNESSKNQFINPKKLIGRLDDINCMMSEWQ----QEDSHEYFMSLISRLQEDSV 231

Query: 710 NQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 769
            + H   +    +LY                             DIF G +   + CK C
Sbjct: 232 PRGHKLTES---ILY-----------------------------DIFGGLLRQEVTCKSC 259

Query: 770 GYTTFNYSTFYVLSLAIPTRSMKLSKLGRST----------EKRVKLEDCINMFTSDEVL 819
           G  +      Y LSL +  +  K S  G S           ++R  +E  I  F + E++
Sbjct: 260 GEVSKTEQPIYDLSLHL--KGKKNSSQGESAKNSSEYEEEPQRRFSIEKSIRDFFNPELI 317

Query: 820 SGENA----WDCPRC 830
             + A    + C +C
Sbjct: 318 KADKATKEGYVCEKC 332

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
            YBL067C
          Length = 714

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 58/129 (44%), Gaps = 17/129 (13%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNNT----VITYPLILNIILKNNDTM--KYRLFG- 991
            + +    LP  L +HL RF Y   K  NT     I YPLIL++    ND++  KY L   
Sbjct: 497  RIVGLKKLPHTLALHLKRFKYLEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELISI 556

Query: 992  VVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLK--ISSSD 1049
            VV+  G    GHY S+   D        +  W  FDDE V++  +    K +      + 
Sbjct: 557  VVHLGGGPHHGHYVSICKSD--------KFGWLLFDDETVESINEETVLKFVGDPEDQTT 608

Query: 1050 VYVLFYERV 1058
             YVLFY  +
Sbjct: 609  AYVLFYREI 617

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 18/27 (66%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           I G  N GNTCY NS++QCLF    FR
Sbjct: 121 IFGYENFGNTCYCNSILQCLFFLDDFR 147

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 57/141 (40%), Gaps = 46/141 (32%)

Query: 690 QQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGI 749
           QQD  EFL  LL+ L+D                      L++SN       +KN I    
Sbjct: 395 QQDAHEFLNFLLNELND---------------------FLQLSN-------EKNFIL--- 423

Query: 750 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDC 809
               D FQG + N ++C  C   T N   F    + +           ++ ++ + ++D 
Sbjct: 424 ----DQFQGTLTNQIKCLTCDTLTSNNEPFLDFPIEV-----------KNDDEDLNIQDI 468

Query: 810 INMFTSDEVLSGENAWDCPRC 830
           +N +   E+L+G N + C +C
Sbjct: 469 LNKYHQREILNGTNKFYCNQC 489

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 48/112 (42%), Gaps = 9/112 (8%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL+N+GNTCY+N+ +Q L+     R   ++ + K+   P A +  H    L   L   F 
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNFP-ADDESHFL--LVQELKRCFQ 161

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPDD------QQDTQEFLMILLDRL 704
           ++      SV P   L V+ +  P     D       QQD +E    L   L
Sbjct: 162 QLKDKPQESVTPILLLSVLRRCYPQFAERDSQSGFYKQQDAEELFTQLFHSL 213

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 982  NDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH 1037
            N +  Y L GV+ H G    SGHY + +  +++ +      KWY F+D+ V   +K 
Sbjct: 418  NPSCVYDLIGVITHQGANSESGHYQAFIRDEMDEN------KWYKFNDDKVSVIEKE 468

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 44/112 (39%), Gaps = 11/112 (9%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           GL+NLGNTCY+NS +Q L+  +  R   +     N+  P  +       +L   L   F 
Sbjct: 107 GLKNLGNTCYMNSTLQALYQIRPLREEIL-----NFQPPKENRSGEQHIQLVAELKRCFQ 161

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPDD------QQDTQEFLMILLDRL 704
           ++      S  P   L  + +  P     D       QQD +E    +   L
Sbjct: 162 QLRDRPQESTTPILLLATLRKCYPQFAERDQESGFYKQQDAEELFTQIFHSL 213

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 982  NDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH 1037
            N +  Y L GV+ H G    SGHY S +  + + +      KWY F+D+ V   +K 
Sbjct: 421  NPSCVYNLIGVITHQGANSESGHYQSFIRDEADEN------KWYRFNDDKVSVIEKE 471

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 10/128 (7%)

Query: 598 TGLRNLGNTCYINSMIQCLF--AAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
            GL NLGN+CY+NS++Q LF    K +    +    ++ + P ++N      KL N+L +
Sbjct: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFP-STNLKCQLIKLRNALKI 376

Query: 656 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVA 715
              K Y +G   V P    K I +   +      QQD  EFL   +D+L  ++ ++   +
Sbjct: 377 HPEK-YQHG---VKPASVKKCIGEDNEEFS-SGRQQDAMEFLTYFIDKLDRKVFSKASSS 431

Query: 716 NDYPNLLL 723
           N  PN L+
Sbjct: 432 N--PNDLM 437

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 61/127 (48%), Gaps = 9/127 (7%)

Query: 598 TGLRNLGNTCYINSMIQCLF-AAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656
            GL NLGN+CY+N+++Q LF    +  +L    ++   +  ++SN      KL N+L   
Sbjct: 309 CGLLNLGNSCYMNAVLQVLFNGGVSSWSLDELGDFPTDVVYVSSNLKCQLIKLRNALRT- 367

Query: 657 FNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAN 716
             +MY NG   V P+ F   +     +      QQD  EF   L+D L  +L N+     
Sbjct: 368 NPEMYPNG---VKPSTFKDCVGGTHEEFS-SGRQQDALEFFSYLIDLLDKKLFNRSEF-- 421

Query: 717 DYPNLLL 723
            +PN L+
Sbjct: 422 -HPNDLM 427

 Score = 36.2 bits (82), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 7/50 (14%)

Query: 987  YRLFGVVNHTGTLI-SGHYTSLVNKDLEHSVDIGRSKWYYFDDE-VVKAD 1034
            +RL  V+ H G+ + SGHY + + KD+E+      +KW  ++DE +V AD
Sbjct: 698  FRLSAVICHKGSSVHSGHYVAFIKKDVEN-----ETKWVLYNDEKMVVAD 742

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 46/112 (41%), Gaps = 10/112 (8%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           G +N+GNTCY+N+ +Q L+  +  R + +  N  +   P+         ++      L +
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMILDYNQNSTTTPVDETHKKIVVEMKRCFENLKS 169

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPD------DQQDTQEFLMILLDRL 704
           K Y     SV+P   L  + +  P     D       QQD +E    L   +
Sbjct: 170 KSYK----SVMPMVLLTALRKCYPQFAERDPQSGFYKQQDAEELFTQLCQSM 217

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 987  YRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVV 1031
            Y L GV+ H G    SGHY S +  D++        KWY F+D+ V
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDED------KWYNFNDDKV 464

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLS 650
           TGL N+GNTCY+NS++Q  F+  + R   +  +Y+N ++   +N+ + S ++ 
Sbjct: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL--DYRNTVQHFLNNQEYASRRIG 783

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 85/194 (43%), Gaps = 22/194 (11%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
           TGL N    CY NS +Q L +   F T++++     +   L   +     K +      F
Sbjct: 66  TGLVNTSTECYANSSVQVLASLSNF-TIYLNKVISIFELELKIEKVEKDAKEA------F 118

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDD---QQDTQEFLMILLDRLHDELSNQQHV 714
           +  YL     V+P  +   + QL  DL+   D   ++    F+ IL   +H  ++  Q  
Sbjct: 119 D-TYL---YKVIPVHY--ALCQLLADLQELIDRPRERSVSNFIRILEASIHKRITGGQQD 172

Query: 715 ANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTF 774
           AN+   ++L   +VL+      K + ++  +   +      F+G++ + L C  CG T+ 
Sbjct: 173 ANELTQIVL---EVLQNELESLKKYVNRMELSIEVPRFP--FEGKLASYLSCLNCGQTSI 227

Query: 775 -NYSTFYVLSLAIP 787
            N STF +L +  P
Sbjct: 228 PNISTFNILPIQTP 241

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 11/84 (13%)

Query: 932  NKKMTTVKTINFVTLPKILVIHLSRFYYD--LTKKNNTVITYPLILNIILKNNDT----- 984
            N K T +K  + +  PKIL+IHLSR  Y+  +  +N+  + +   ++I  +  D      
Sbjct: 329  NIKSTIIKKNSIIETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSIERQTTDEKNENL 388

Query: 985  ----MKYRLFGVVNHTGTLISGHY 1004
                + Y+L  ++ HTGT  SGHY
Sbjct: 389  KIELVDYQLQSIIKHTGTHNSGHY 412

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 46/112 (41%), Gaps = 6/112 (5%)

Query: 596 SITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
           S  G +N+GNTCY+N+ +Q L+     R + ++ N    +   ++       ++   +  
Sbjct: 107 SPVGFKNMGNTCYLNATLQALYRVDDVRDMILNYNPSEGVSSSSAQDEETHKQIVIEMKR 166

Query: 656 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDD------QQDTQEFLMILL 701
            F  ++     SV+P   L  + +  P     D       QQD +E    L 
Sbjct: 167 CFENLHNKSFKSVLPIVLLNTLRKCYPQFAERDQQGGFYKQQDAEELFTQLF 218

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 976  NIILKNNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1034
            N+    N +  Y L GV+ H G    SGHY + +  +L+ +      KWY F+D+ V A 
Sbjct: 420  NLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVTAV 473

Query: 1035 KKH 1037
            +K 
Sbjct: 474  EKE 476

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 59/116 (50%), Gaps = 7/116 (6%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKT--FRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
            GL NLGN+CY+NS++Q LF A    +    I + +   +   ++N      KL N++ +
Sbjct: 322 CGLINLGNSCYMNSVLQLLFNAGVPDWSLEQIGTEFPLDVVYPSNNILCQLIKLRNAMKI 381

Query: 656 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQ 711
              + Y NG   + PT F + I Q   +      QQD+ EF   L+++L  ++ N+
Sbjct: 382 EPER-YPNG---IKPTSFKRCIAQAHEEFS-SSRQQDSMEFFTFLIEQLDKKVLNK 432

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
            Ashbya gossypii AEL242W
          Length = 696

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 934  KMTTVKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITYP--LILNIILKNND------ 983
            K   +K    V+ PK+L++HLSR  +D     KN+  + +P  LILN      D      
Sbjct: 391  KSRILKRTVVVSSPKVLLLHLSRSVFDGVTYTKNSCNVLFPEDLILNEQEIKEDRCIAVH 450

Query: 984  TMKYRLFGVVNHTGTLISGHY 1004
             ++Y+L  ++ HTGT   GHY
Sbjct: 451  CVRYKLQAMIKHTGTHFQGHY 471

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 47/109 (43%), Gaps = 9/109 (8%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           G+ N+GNTCY+N+ +Q L+     R   ++ + K      A     +  +L   +   F 
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKK---ATAEGMDLYHVQLIREIQATFR 117

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPD------DQQDTQEFLMILL 701
           K+    G ++ P   L+++ ++ P     D       QQD +E    L 
Sbjct: 118 KLRDKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELFTQLF 166

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 7/58 (12%)

Query: 981  NNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKH 1037
             N +  Y L GV+ H G    SGHY + +  + +        KWY F+D+ V A +K 
Sbjct: 371  ENPSCVYDLIGVITHQGANSESGHYQAFMRDEFDDD------KWYKFNDDKVTAIEKE 422

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186W UBP10 Ubiquitin-specific protease that
           deubiquitinates ubiquitin-protein moieties may regulate
           silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 739

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 53/251 (21%), Positives = 97/251 (38%), Gaps = 60/251 (23%)

Query: 595 LSITGLRNLGNTCYINSMIQCLFAAKTFRT-LF--ISSNYKNYLEPLASNRPHHSPKLSN 651
           L   GL N G TCY N+ +Q +    + +  LF  +  ++K  + P +         ++ 
Sbjct: 359 LKPKGLLNHGVTCYTNAAVQAMLHIPSIQHYLFDVLRGDHKTTISPQS---------VTQ 409

Query: 652 SLSMLFNKMYL---NGGCSVVPT---GFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLH 705
            L+    +M+    N    + P    G L  IN +  + +    Q+D+ E+ M L+ RL 
Sbjct: 410 VLAETSKRMWSPEPNKNTYINPKKLIGRLDDINCMMSEWQ----QEDSHEYFMSLMSRLQ 465

Query: 706 DELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQ 765
           ++   + H   +                                S I DIF G +   + 
Sbjct: 466 EDSVPRGHKLTE--------------------------------SIIYDIFGGLLHQKVT 493

Query: 766 CKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTE----KRVKLEDCINMFTSDEVLS- 820
           CK CG  +     FY LSL +  +      +  + E    +R  +E  I+ F + E++  
Sbjct: 494 CKSCGGVSKTEQPFYDLSLHLKGKKKSDETVPENQEDVPQRRYSIEKSISDFFNPELIKV 553

Query: 821 -GENAWDCPRC 830
             ++ + C +C
Sbjct: 554 DKKDGYVCEKC 564

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
            YER151C (REAL)
          Length = 909

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 75/170 (44%), Gaps = 48/170 (28%)

Query: 924  SNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF-YYDLTKKNNTVITY----------- 971
            S++  D + KK T +       LP++L+I L RF + +   K+N +  Y           
Sbjct: 754  SSSGNDVEAKKQTFIDK-----LPQVLLIQLKRFSFINNVNKDNAMTNYNAYNGRIEKIR 808

Query: 972  -------PLIL------NIILKNN----DTMKYRLFGVVNHTG-TLISGHYTSLVNKDLE 1013
                    LI+      +I LKN+    D  +Y+L GV+ H G +   GHYT+    D+ 
Sbjct: 809  KKIKYDHELIIPEESMSSITLKNHTSGVDDRRYKLTGVIYHHGVSSDGGHYTA----DVY 864

Query: 1014 HSVDIGRSKWYYFDD----EVVKADKKHGSDKNLKISSSDVYVLFYERVY 1059
            H      +KWY  DD    E+   D   G ++     S   Y+L Y++VY
Sbjct: 865  HK---EHNKWYRIDDVNITELEDDDVLKGGEE--ASDSRTAYILMYQKVY 909

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 44/109 (40%), Gaps = 8/109 (7%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           G +N+GNTCY+N+ +Q L+     R   ++ +     +    N  H   KL   L   F 
Sbjct: 108 GFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINNDKNGENETH--IKLVTELKRCFE 165

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPD------DQQDTQEFLMILL 701
            +      SV+P   L  + +  P     D       QQD +E L  L 
Sbjct: 166 GLKNKSFKSVMPVVLLNALRKTYPQFAERDPQSGFYKQQDAEELLTQLF 214

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 62/163 (38%), Gaps = 39/163 (23%)

Query: 668 VVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNAD 727
           V P+ F+ ++ Q    L      QD  EFL  LL+ L D L     +  D          
Sbjct: 379 VSPSNFVNILKQ-ENILFSSSMHQDAHEFLNYLLNELSDTLKRDMELDTD---------- 427

Query: 728 VLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIP 787
                  E K  F           I+D+F+G + NS +C  C   T     F    + I 
Sbjct: 428 -----KLESKPTF-----------IEDLFKGSLCNSTKCFTCDTITARDEPFLDFPIEI- 470

Query: 788 TRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
                        ++ +K++D +N +   E+L+G N + C +C
Sbjct: 471 -----------QEDEEIKIQDILNNYKHRELLTGANKFYCDKC 502

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 580 YSIP-TIERN-PNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRT 624
           Y+IP TI  + P    S  + G  N GNTCY NS++QCL+    FRT
Sbjct: 95  YTIPNTITADLPFGSGSTKVFGYENFGNTCYCNSVLQCLYNLTEFRT 141

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 47/102 (46%), Gaps = 15/102 (14%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNNTV----ITYPLILNIILKNNDTM--KYRLFG- 991
            +T+   +LPK L IHL RF Y   +  N      I YPL L +    +  +   Y L G 
Sbjct: 510  RTVGLKSLPKTLAIHLKRFKYSEARNCNAKLFNRIHYPLDLRVCSSFDSAVCKDYELNGI 569

Query: 992  VVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKA 1033
            V++  G    GHY ++   DL      G   W  FDDE V++
Sbjct: 570  VIHMGGGPHHGHYVAICKNDL-----FG---WLLFDDETVES 603

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
            UBP16Deubiquitinating enzyme anchored to the outer
            mitochondrial membrane, probably not important for
            general mitochondrial functioning, but may perform a more
            specialized function at mitochondria
          Length = 499

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 41/84 (48%), Gaps = 11/84 (13%)

Query: 932  NKKMTTVKTINFVTLPKILVIHLSRFYYD-LTKKNN----------TVITYPLILNIILK 980
            N K   +K    V LP IL++HLSR  ++ +T   N          T+  Y L  +  + 
Sbjct: 325  NIKGKVIKKDVVVQLPDILIVHLSRSTFNGITYSRNPCNVKFGERITLSEYTLAESGTIT 384

Query: 981  NNDTMKYRLFGVVNHTGTLISGHY 1004
             N  +KY L  VV HTG+  SGHY
Sbjct: 385  ENRQVKYNLKSVVKHTGSHSSGHY 408

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 81/218 (37%), Gaps = 57/218 (26%)

Query: 599 GLRNLGNTCYINSMIQCLFAA-------KTFRTLFIS-----SNYKNYLEPLASNRPHHS 646
           GL N GN C+I S +Q L          K  RT+ +      SN      P   N   HS
Sbjct: 54  GLINRGNDCFITSSLQGLAGIPRFVEYLKRIRTVLLELETKLSNNAKGDNPTVDNTTRHS 113

Query: 647 --PKLSNSLSMLFNKM---------YLNGGCSVVPTGFLKVINQLRPDLK--IPDDQQDT 693
                SNSL+ L   +           +   S+ P     VIN L    K  I   Q D 
Sbjct: 114 RLENSSNSLAPLHESLTSLILDLISVKDRKTSISPK---IVINTLESIFKSKISSKQNDA 170

Query: 694 QEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPID 753
            EF +ILL  L +E S           L+ Y+  +  ++  ++                 
Sbjct: 171 HEFTLILLQTLQEERS----------KLIDYSKQICNLNIPKFP---------------- 204

Query: 754 DIFQGQMENSLQCKRC-GYTTFNYSTFYVLSLAIPTRS 790
             F+G+    L C +C G +  +Y   ++  L++P ++
Sbjct: 205 --FEGETSKFLVCLKCKGLSEPSYKQTFIRELSVPQQT 240

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 47/115 (40%), Gaps = 19/115 (16%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLAS------NRPHHSPKLSNS 652
           G +N+GNTCY+N+ +Q L+     R + +     +Y  P  S      +  HH  K+   
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMIL-----DYKPPAQSSTYNPEDEMHH--KIVLE 164

Query: 653 LSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPD------DQQDTQEFLMILL 701
           +   F  +      SV+P   L V+ +  P     D       QQD +E    L 
Sbjct: 165 IKRCFENLEKKNFKSVMPMMLLTVLRKCYPQFAERDPRGGFYKQQDAEELFTQLF 219

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
            (REAL)
          Length = 503

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 40/84 (47%), Gaps = 11/84 (13%)

Query: 932  NKKMTTVKTINFVTLPKILVIHLSRFYYD-LTKKNN----------TVITYPLILNIILK 980
            N K   +K    V LPK+LVIHLSR  ++ +T   N           +  Y  I N+ L 
Sbjct: 333  NVKGKVIKRDIAVKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLT 392

Query: 981  NNDTMKYRLFGVVNHTGTLISGHY 1004
             N  + Y L  VV HTG+   GHY
Sbjct: 393  ENRQIVYNLKSVVKHTGSHSRGHY 416

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 54/141 (38%), Gaps = 42/141 (29%)

Query: 691 QDTQEFLMILLDRLHDELSNQ-QHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGI 749
           QD  EFL  L++ L D L  Q Q + +  P   ++                         
Sbjct: 431 QDAHEFLNFLMNALSDSLQLQLQRLPDKSPENFIHT------------------------ 466

Query: 750 SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDC 809
                +FQG M NS++C  C   T N   F+    AIP           S ++ + ++D 
Sbjct: 467 -----LFQGTMNNSIKCLTCDNITSNEEPFF--DFAIPV----------SEDEELNVQDI 509

Query: 810 INMFTSDEVLSGENAWDCPRC 830
           +  F   E+L+G N + C  C
Sbjct: 510 LRDFHQREMLNGANKFYCDSC 530

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 6/42 (14%)

Query: 582 IPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFR 623
           +P  +  P V+      GL N GNTCY NS++QCL+  K  R
Sbjct: 89  LPFGDGTPKVF------GLENYGNTCYCNSVLQCLYNLKELR 124

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 61/140 (43%), Gaps = 23/140 (16%)

Query: 929  DFKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDT 984
            D  N      +T+    LP++L +HL RF Y    ++N     VI YPL L +    +  
Sbjct: 528  DSCNGLQEAERTVGIKELPELLPLHLKRFKYSEKHQSNIKLFNVIHYPLNLRVCSTFDHA 587

Query: 985  M--KYRLFGVVNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDK 1041
            +   Y L G+V H G     GHY ++   +L          W  +DDE V++    G D 
Sbjct: 588  VCKDYELNGIVIHMGGGPQHGHYVAICKHEL--------FGWLLYDDETVES---VGEDA 636

Query: 1042 NLKISS-----SDVYVLFYE 1056
             L+        +  YVLFY+
Sbjct: 637  VLRFIGDVNDMTTAYVLFYK 656

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 106/271 (39%), Gaps = 55/271 (20%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTF---------------RTLFISSNYKNYLEPL--- 638
           + GL N GNTC++NS++Q L +++                   L  S  +K  L+ L   
Sbjct: 65  VAGLVNDGNTCFMNSVLQSLASSRELAHFLDDIIEESEPNKNELNFSVAFKTLLDKLNAK 124

Query: 639 -ASNRPHHSP-KLSNSLSMLFNKMYLNG-GCSVVPTGFLKVINQLRPDLKIPDDQQDTQE 695
              NR ++ P  L  ++    NK  L G         F ++I+QL  DLK  D   D ++
Sbjct: 125 YGRNRKYYRPNALLKTMESGPNKNILLGYDQEDAQEFFQQIISQLEKDLKKEDTDGDFKK 184

Query: 696 FLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEY--KHWFDKN-VIGNG---- 748
              +   +   E      + +D P   L N + L+     Y      + N  +G G    
Sbjct: 185 EESV---QPSSEDDKTPILESDLPADALLNQENLEKVGTVYIPTEQVEPNFALGKGEHES 241

Query: 749 -------ISPIDDIFQGQMENSLQCKRCGYT-TFNYSTFYVLSLAIPTRSMKLSKLGRST 800
                  ++P+D    G +   + C  CG      YS    LSL +P  ++  +      
Sbjct: 242 FYTPYKLLTPLD----GIIAERIGCLNCGENGGIRYSVSSGLSLNLPNENIGAT------ 291

Query: 801 EKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
              +KL + ++ +   E++ G    DC RC 
Sbjct: 292 ---LKLSELLDKWVEPEIIEG---VDCNRCA 316

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 82/209 (39%), Gaps = 52/209 (24%)

Query: 598 TGLRNLGNTCYINSMIQCLF--AAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
            GL NLGN+CY+NS++Q L       +   F+ S +     PL    P ++  L      
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGIPNWSLDFLGSEF-----PLDVVYPGNN--LKCQWIK 375

Query: 656 LFNKM------YLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELS 709
           LFN M      Y NG   + PT F K I Q   +    + QQD  EFL            
Sbjct: 376 LFNAMRCEPEFYPNG---IKPTTFKKCIGQNHEEFS-SNRQQDAMEFLT----------- 420

Query: 710 NQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRC 769
                                + +   + +F  ++  +G S ++D+ +  ME+ LQC +C
Sbjct: 421 --------------------FLLDLLDRKFF--SIGSSGASNVNDLVRFIMEDRLQCNKC 458

Query: 770 GYTTFNYSTFYVLSLAIPTRSMKLSKLGR 798
           G   ++Y     + + +   S     L R
Sbjct: 459 GKVKYSYEPAEAIQIPLEENSETQDLLER 487

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASN 641
           TG+ N+GNTCY+NS++Q  FA    R   +   Y+  +  L+SN
Sbjct: 722 TGINNIGNTCYLNSLLQFYFAISPLREYIVQ--YQKTIADLSSN 763

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186w UBP10
          Length = 771

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 70/197 (35%), Gaps = 40/197 (20%)

Query: 591 VYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLS 650
            Y  L   GL N G TCY N+ +Q L      +          Y   ++SN   H     
Sbjct: 378 TYSKLKPKGLLNHGVTCYTNAAVQALLHIPAMQHYLNDILAGKYSSTISSNSVSHVL-AE 436

Query: 651 NSLSMLFNKMYLNGGCSVVPTGF---LKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDE 707
            S  M  N    +G   + P      L  IN +  + +    Q+D+ E+ M ++ RL ++
Sbjct: 437 TSRRMWHNDGKKSGNSYINPKKLIARLDDINCMMSEWQ----QEDSHEYFMSIMSRLQED 492

Query: 708 LSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCK 767
              + H   +                                S I DIF G ++ ++ CK
Sbjct: 493 SVPKGHKMTE--------------------------------SIIYDIFGGSLKQTVTCK 520

Query: 768 RCGYTTFNYSTFYVLSL 784
            CG  +     FY LSL
Sbjct: 521 SCGEVSTTEQPFYDLSL 537

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 55/139 (39%), Gaps = 23/139 (16%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNS----- 652
            G+ N+GNTCY+NS++Q  F  K  R   +  NY +    L     +HS +         
Sbjct: 698 AGINNVGNTCYLNSLLQFFFTIKPLRDFIL--NYDDDSAKLLDASEYHSRRRIGGREVSK 755

Query: 653 ------------LSMLFNKMYLNGGCSVVPTGFLKVINQLRP---DLKIPDDQQDTQEFL 697
                       L  LFN M       V PT  L V     P   +++  DD    +E +
Sbjct: 756 QEELRSVQFVYHLRDLFNDMIHTNSRCVTPTKEL-VYLAFAPSNVEVEFGDDTVAQKELI 814

Query: 698 MILLDRLHDELSNQQHVAN 716
            +  D + D     +H+A+
Sbjct: 815 DLTTDVVEDPTDTTRHLAS 833

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
            similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 10/81 (12%)

Query: 934  KMTTVKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITYPLILNI---ILKNN-----D 983
            K T VK    V  P++L+IHLSR  ++ T   +N   + +  IL +   +++N+     +
Sbjct: 457  KSTIVKKNVVVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDEILQLQEQVIQNDRCVGIN 516

Query: 984  TMKYRLFGVVNHTGTLISGHY 1004
            ++ Y L  +V H G+   GHY
Sbjct: 517  SVNYELKAIVKHAGSHSQGHY 537

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar to
            uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
            ubiquitin-specific proteinase
          Length = 816

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 67/166 (40%), Gaps = 44/166 (26%)

Query: 924  SNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF-----------------YYDLTKKNN 966
            S++  D + KK T +       LP+IL+I L RF                 Y    +K  
Sbjct: 664  SSSGNDVEAKKQTFIDK-----LPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIR 718

Query: 967  TVITYPLILNI--------ILKNNDTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEHSVD 1017
              I+Y   L I         L+NN +  Y L GV+ H G +   GHYT+    D+ H   
Sbjct: 719  KKISYGHTLEIPDETLASSALRNNSSKTYELSGVIYHHGMSPDGGHYTA----DVFHKQ- 773

Query: 1018 IGRSKWYYFDD----EVVKADKKHGSDKNLKISSSDVYVLFYERVY 1059
                 WY  DD    ++   D   G + N+   S   Y+L Y+ V+
Sbjct: 774  --TKTWYRIDDVNITKLEDDDVLKGGEDNM--DSRTAYILMYQNVH 815

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar to
            gnl|GLV|KLLA0E23463g Kluyveromyces lactis KLLA0E23463g
            and some similarites with YPL072W uniprot|Q02863
            Saccharomyces cerevisiae YPL072W UBP16 Putative
            ubiquitin-specific protease
          Length = 767

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 934  KMTTVKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITYP----LILNIILKNN----D 983
            K T VK    V  P++L+IHLSR  ++     +N+  + +     L   II KN     +
Sbjct: 440  KSTIVKKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVN 499

Query: 984  TMKYRLFGVVNHTGTLISGHY 1004
             +KYRL   V H GT  +GHY
Sbjct: 500  NVKYRLRATVRHQGTHSAGHY 520

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 43/109 (39%), Gaps = 6/109 (5%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           G +N+GNTCY+N+ +Q L+     R + ++ N    +    +       ++   +   F 
Sbjct: 110 GFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEIHKQIVIEMKRCFE 169

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPDD------QQDTQEFLMILL 701
            +      SV+P   L  + +  P     D       QQD +E    L 
Sbjct: 170 NLQNKSFKSVLPIVLLNTLRKCYPQFAERDSQGGFYKQQDAEELFTQLF 218

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 976  NIILKNNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1034
            N+    N +  Y L GV+ H G    SGHY + +  +L+ +      KWY F+D+ V   
Sbjct: 419  NLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVSVV 472

Query: 1035 KKH 1037
            +K 
Sbjct: 473  EKE 475

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
            UBP3Ubiquitin-specific protease involved in transport and
            osmotic response; interacts with Bre5p to co-regulate
            anterograde and retrograde transport between the ER and
            Golgi; involved in transcription elongation in response
            to osmostress through phosphorylation at Ser695 by Hog1p;
            inhibitor of gene silencing; cleaves ubiquitin fusions
            but not polyubiquitin; also has mRNA binding activity
          Length = 912

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 73/168 (43%), Gaps = 48/168 (28%)

Query: 924  SNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF-YYDLTKKNNTVITY----------- 971
            S++  D + KK T +       LP++L+I   RF + +   K+N +  Y           
Sbjct: 757  SSSGNDVEAKKQTFIDK-----LPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIR 811

Query: 972  -------PLIL------NIILKNN----DTMKYRLFGVVNHTG-TLISGHYTSLVNKDLE 1013
                    LI+      +I LKNN    D  +Y+L GV+ H G +   GHYT+    D+ 
Sbjct: 812  KKIKYGHELIIPEESMSSITLKNNTSGIDDRRYKLTGVIYHHGVSSDGGHYTA----DVY 867

Query: 1014 HSVDIGRSKWYYFDD----EVVKADKKHGSDKNLKISSSDVYVLFYER 1057
            HS     +KWY  DD    E+   D   G ++     S   Y+L Y++
Sbjct: 868  HSE---HNKWYRIDDVNITELEDDDVLKGGEE--ASDSRTAYILMYQK 910

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 754

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 58/132 (43%), Gaps = 23/132 (17%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNN----TVITYPLILNIILKNNDTM--KYRLFG- 991
            + +    LP IL +HL RF Y  T+  N      I YPL L +    + ++  +Y L G 
Sbjct: 551  RIVGLKQLPHILALHLKRFKYSETQNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTGI 610

Query: 992  VVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISS---- 1047
            VV+  G    GHY SL   +        +  W  FDDE V++  +      +K       
Sbjct: 611  VVHMGGGPHHGHYVSLCKNE--------KFGWLLFDDETVESVDESSV---MKFCGDLHD 659

Query: 1048 -SDVYVLFYERV 1058
             +  YVLFY+ +
Sbjct: 660  LTTAYVLFYKEI 671

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR 623
           + G  N GNTCY NS++QCL+    FR
Sbjct: 145 VFGYENFGNTCYCNSVLQCLYNLTEFR 171

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 39.7 bits (91), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASN 641
           TGL N+GNTCY+NS++Q  FA    R   I  NY   ++ + +N
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEII--NYTKTVDDIENN 788

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 39.3 bits (90), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFR 623
           TG+ N+GNTCY+NS++Q  F+   FR
Sbjct: 758 TGINNIGNTCYLNSLLQYYFSITLFR 783

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
            YPL072W
          Length = 734

 Score = 39.3 bits (90), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 934  KMTTVKTINFVTLPKILVIHLSRFYYDLT--KKNNTVITYPLILNI---ILKNNDT---- 984
            K T VK    V  PK LV+HLSR  +D    ++N+  + +  IL     ++++N      
Sbjct: 420  KSTIVKKTVVVESPKTLVMHLSRSMFDGISYQRNSCGVAFDEILESREQVIRHNKCVGIN 479

Query: 985  -MKYRLFGVVNHTGTLISGHY 1004
             + Y+L  +V H+G+   GHY
Sbjct: 480  PISYKLKAIVAHSGSHSQGHY 500

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 57/121 (47%), Gaps = 6/121 (4%)

Query: 598 TGLRNLGNTCYINSMIQCLF-AAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656
            GL NLGN+CY+NS++Q LF  A    +L +  ++   +   ++N      KL N++   
Sbjct: 313 CGLNNLGNSCYMNSVLQVLFNGAVPDWSLEVLGDFPRDVVYPSTNLKCQLIKLRNAIKRN 372

Query: 657 FNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAN 716
            +  Y  G   + P+ F + I +   +      QQD  EF    +D L  +L ++    N
Sbjct: 373 PSD-YTTG---IKPSTFKRCIGESHEEFS-SGRQQDAMEFFTYFIDELDKKLFSRGSNPN 427

Query: 717 D 717
           D
Sbjct: 428 D 428

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 39.3 bits (90), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSN 630
            GL N+GNTCY+NS++Q  FA    R   I+ N
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLREYLINFN 794

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
            weakly similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072w UBP16
          Length = 483

 Score = 38.5 bits (88), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 71/167 (42%), Gaps = 38/167 (22%)

Query: 930  FKN--KKMTTVKTINFVTLPKILVIHLSRFYYD-LTKKNN--------TVITYPLILNII 978
            FKN   + + +K   FV  P I VIHLSR  Y+ +T   N        T+  +  +    
Sbjct: 316  FKNNVARRSILKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACST 375

Query: 979  LKNNDT--MKYRLFGVVNHTGTLISGHYTSL----------VNKDLEHS-VDIGRSKWYY 1025
              N  T  ++YRL  +V HTG+  SGHY  L          V+ D+ ++   IG  K   
Sbjct: 376  SSNEFTKRVRYRLKSIVIHTGSHYSGHYQVLRRKPIIMKSKVSGDIVNTGTTIGEKKPTV 435

Query: 1026 FDDEVVKADKKHG------SDKNLK---IS-----SSDVYVLFYERV 1058
             D    +            SD N+K   IS        VY+LFYER+
Sbjct: 436  MDSNFRRMKSTTIYPFWLISDTNVKEKRISDIVNEQKSVYMLFYERI 482

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 770

 Score = 38.5 bits (88), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 8/112 (7%)

Query: 599 GLRNLGNTCYINSMIQCLF--AAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSML 656
           GL NLGN+CY+NS++Q L     + +    + S   + + P  +N      K+ N++++ 
Sbjct: 317 GLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYP-RTNLHCQLIKIRNAMTLQ 375

Query: 657 FNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 708
            ++ Y  G   + PT F KVI     +      QQD+ EF   L D+L  E+
Sbjct: 376 QSR-YPEG---IKPTTFKKVIGGSHEEFS-SGRQQDSLEFFSYLSDKLDREI 422

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 68/160 (42%), Gaps = 44/160 (27%)

Query: 929  DFKNKKMTTVKTINFVTLPKILVIHLSRF-YYDLTKKNNTVITYPLILNIILK------- 980
            D + KK T +       LP++L+I L RF + + T K+N+++ Y      I K       
Sbjct: 681  DVEAKKQTFIDR-----LPQVLLIQLKRFQFINNTDKDNSMVNYNAYNGRIEKIRKKINY 735

Query: 981  -----------------NNDTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEHSVDIGRSK 1022
                              ++  +Y L GV+ H G +   GHYT+    D+ H       K
Sbjct: 736  EHELIIPIESISSANAYKDENRRYHLTGVIYHHGVSSDGGHYTA----DVYHRES---DK 788

Query: 1023 WYYFDD----EVVKADKKHGSDKNLKISSSDVYVLFYERV 1058
            WY  DD    E+ K D   G +++    S   Y+L Y+++
Sbjct: 789  WYRIDDVSIIELEKEDVLKGGEESG--DSRTAYILMYQKI 826

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 41/109 (37%), Gaps = 6/109 (5%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           G +N+GNTCY+N+ +Q L+     R + ++ N                 ++   +   F 
Sbjct: 110 GFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASNSGVQDEETHKQIIIEMKRCFE 169

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPD------DQQDTQEFLMILL 701
            +      SV+P   L  + +  P     D       QQD +E    L 
Sbjct: 170 NLQNKSFKSVLPIVLLNTLRKCYPQFAERDAQGGFYKQQDAEELFTQLF 218

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 976  NIILKNNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1034
            N+    N +  Y L GV+ H G    SGHY + +  +L+ +      KWY F+D+ V   
Sbjct: 419  NLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVSVV 472

Query: 1035 KKH 1037
            +K 
Sbjct: 473  EKE 475

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 87/205 (42%), Gaps = 34/205 (16%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
           TGL N GN C+INS +Q L  ++ F                     H+   +   L  L 
Sbjct: 69  TGLINKGNDCFINSSLQGLAGSQRFN--------------------HYLNSVLRCLKFLN 108

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIP---DDQQDTQEFLMILLDRLHDELSNQQHV 714
                 G    +P    +V+ +   DL+ P   +  + + + ++ +      ++S +Q+ 
Sbjct: 109 ENPKQEGNRYALP--LHQVMAEFIYDLQAPTFLNTVESSDKIIVTMESIFKQKMSRRQND 166

Query: 715 ANDYPNLLLYNADVLKVSNNEYKHWFD-KNVIGNGISPIDDIFQGQMENSLQCKRCGYTT 773
           A ++  LL      L+V +NEY+      N I N +      F+G+  + L C +CG  +
Sbjct: 167 AQEFTQLL------LEVLHNEYQELIRLMNFITNNLDIPTYPFEGKYCHELTCLKCGRNS 220

Query: 774 -FNYSTFYVLSLAIPTR-SMKLSKL 796
                 F +L+L +P + S+ L +L
Sbjct: 221 EVKMFDFDILTLNLPAQPSISLDEL 245

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 10/84 (11%)

Query: 931  KNKKMTTVKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITY--------PLILNIILK 980
            +N K T VK   FV +P IL+IHL+R  ++     +N   I Y         L+++ +  
Sbjct: 317  RNIKSTIVKKTVFVEVPDILLIHLTRSMFNGMSYTRNACKIAYDEKLLLEHQLVMDGVSV 376

Query: 981  NNDTMKYRLFGVVNHTGTLISGHY 1004
              + ++Y L   + H+G+   GHY
Sbjct: 377  MRNNIQYTLSSAIKHSGSHSMGHY 400

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 42/108 (38%), Gaps = 6/108 (5%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFN 658
           G +N+GNTCY+N+ +Q L+     R + ++ N    +            ++   +   F 
Sbjct: 110 GFKNMGNTCYLNATLQALYRVNDLREMILNYNPSQGVSNNGVQDEETHKQIVIEMKRCFE 169

Query: 659 KMYLNGGCSVVPTGFLKVINQLRPDLKIPD------DQQDTQEFLMIL 700
            +      SV+P   L  + +  P     D       QQD +E    L
Sbjct: 170 NLQNKSFKSVLPIVLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQL 217

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 976  NIILKNNDTMKYRLFGVVNHTGT-LISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKAD 1034
            N+    N +  Y L GV+ H G    SGHY + +  +L+ +      KWY F+D+ V   
Sbjct: 419  NLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVSVV 472

Query: 1035 KKH 1037
            +K 
Sbjct: 473  EKE 475

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
            YER151C
          Length = 795

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 72/165 (43%), Gaps = 46/165 (27%)

Query: 924  SNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYY-DLTKKNNTVITY----------- 971
            S++  D + KK T +       LP++L+I L RF + + T K+N++I Y           
Sbjct: 645  SSSGNDVEAKKQTFIDK-----LPQVLLIQLKRFQFINNTDKDNSMINYNAYNGRIEKIR 699

Query: 972  -------PLILNI-------ILKNNDTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEHSV 1016
                    L++ I        L++ D  +Y L GV+ H G +   GHYT+    D+ H  
Sbjct: 700  KKINYEHELMIPIESISSTNALRDED-RQYSLSGVIYHHGLSSDGGHYTA----DVYHKE 754

Query: 1017 DIGRSKWYYFDD----EVVKADKKHGSDKNLKISSSDVYVLFYER 1057
                 KWY  DD    EV K     G +    + S   Y+L Y++
Sbjct: 755  ---TDKWYRIDDINITEVQKDSVLKGGEDG--VDSRTAYILMYQK 794

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
            (REAL)
          Length = 501

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 944  VTLPKILVIHLSRFYYD-LTKKNN----------TVITYPLILNIILKNNDTMKYRLFGV 992
            V LP ILV+HLSR  ++ +T   N           +  Y L  N  +  N  +KY L  V
Sbjct: 337  VQLPDILVVHLSRSTFNGITYCRNPCNVEFGERVKLPEYTLAENRAITENRQVKYNLKSV 396

Query: 993  VNHTGTLISGHY 1004
            V HTG+   GHY
Sbjct: 397  VKHTGSHSRGHY 408

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 69/166 (41%), Gaps = 46/166 (27%)

Query: 924  SNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF-YYDLTKKNNTVITY----------- 971
            S++  D + KK T +       LP +L+IHL RF + + T K+N++  Y           
Sbjct: 869  SSSGADVEAKKQTFIDK-----LPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIR 923

Query: 972  -------------PLILNIILKNNDTMKYRLFGVVNHTG-TLISGHYTSLVNKDLEH-SV 1016
                           I N      +   Y L GVV H G +   GHYT+    D+ H  V
Sbjct: 924  KKISYNHELVIPAETITNGKQLAPENRTYELTGVVYHHGLSSDGGHYTA----DIYHKEV 979

Query: 1017 DIGRSKWYYFDD----EVVKADKKHGSDKNLKISSSDVYVLFYERV 1058
            D    KWY  DD    E+ K D   G + +    S   Y+L Y+++
Sbjct: 980  D----KWYRIDDVTVTELEKDDVLKGGENS--TDSRTAYILMYQKL 1019

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFI 627
            GL N+GNTCY+NS++Q  F+ K  R   +
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFIL 791

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFI 627
           TGL N+GNTCY+NS++Q  F     R   +
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQFIV 732

>KLLA0E14125g Chr5 (1250334..1251767) [1434 bp, 477 aa] {ON} similar
            to uniprot|P43589 Saccharomyces cerevisiae YFR005C SAD1
            Conserved zinc-finger domain protein involved in pre-mRNA
            splicing required for assembly of U4 snRNA into the U4/U6
            particle
          Length = 477

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 67/160 (41%), Gaps = 21/160 (13%)

Query: 906  GSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRF---YYDLT 962
            G+   S S T         N   ++  K   ++KT   +  PK L++H +RF   +  + 
Sbjct: 332  GNSANSVSQTKLETLLQKFNGETEYHTKD--SIKTYRILKHPKFLILHFNRFDKGFTSIK 389

Query: 963  KKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTL---ISGHYTSLVNKDLEHSVDIG 1019
             +N T++ +   L         + Y+L   + H   +   IS     L ++   H  D  
Sbjct: 390  DRNKTLVEFSEKLEF-----SGVHYKLLVNITHDCVIQMKISDTEDLLASRWKVHLADTL 444

Query: 1020 RSKWYYFDD-EVVKADKKHGSDKNLKISSSDVYVLFYERV 1058
            R +WY FDD EV K +K+        +   + Y+  ++RV
Sbjct: 445  RDQWYEFDDIEVNKVEKEF-------LFLKECYIQIWQRV 477

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYL 635
           TGL N+GNTCY+NS++Q  F+    R   +  NY+  L
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRDYVL--NYQKML 736

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYL 635
           TG+ N+GNTCY+NS++Q  F+    R+  +  NY+  L
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYIL--NYQKTL 771

>KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some
            similarities with uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 774

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 74/168 (44%), Gaps = 49/168 (29%)

Query: 924  SNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYY-------DLTKKN----------- 965
            S++  D + KK T +       LP+ L+I   RF +       DL+  N           
Sbjct: 620  SSSGNDVEAKKHTCIDK-----LPQALLIQFKRFSFVSQSSKNDLSNYNSFNGRIEKIRK 674

Query: 966  ----NTVITYP---LILNIILKNN--DTMKYRLFGVVNHTGTLIS-GHYTSLV-NKDLEH 1014
                N  +T P   +  N++  +N  ++ KY L GV+ H G   S GHYT  V +KDL+ 
Sbjct: 675  MVKYNHELTIPKESISPNLVSTSNSEESFKYYLSGVIYHHGVSPSGGHYTCDVYDKDLD- 733

Query: 1015 SVDIGRSKWYYFDDEVVKADKKHGSDKNLKI--SSSD---VYVLFYER 1057
                   KWY  DD  V  D+    +  L+   S+SD    Y+L YE+
Sbjct: 734  -------KWYRIDD--VNVDEIKNKEDILRSGDSASDSRTAYILLYEK 772

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 57/135 (42%), Gaps = 31/135 (22%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLF-----ISSNYKNYLEPLAS------------- 640
           G+ N G+ C+I+S++Q L   ++F  L       + +  N + PL +             
Sbjct: 338 GIYNKGSICFISSVLQLLIHCRSFVNLLNVIHTTTVSRTNSVSPLLNACMDVFKRFDRET 397

Query: 641 -----NRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLK--IPDDQQDT 693
                N    + K  +  S L   +      S+ P  F K I+ L P  K      Q+D 
Sbjct: 398 IVNELNETRENSKTKSKSSNLNENI-----ISIDPEPFYKSISTL-PKFKDLTWGRQEDA 451

Query: 694 QEFLMILLDRLHDEL 708
           +EFL  +LD+LH+E 
Sbjct: 452 EEFLTHMLDQLHEEF 466

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 38/91 (41%), Gaps = 20/91 (21%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEP------------------LAS 640
           GL N+GNTCY+NS++Q  FA    R    S  Y++  E                   + +
Sbjct: 726 GLNNIGNTCYLNSLLQYYFAIAPLRNYICS--YQSTTESFEATDTDAKINRRIGGRQVCA 783

Query: 641 NRPHHSPKLSNSLSMLFNKMYLNGGCSVVPT 671
           +    S + +  L  LFN M  +    V PT
Sbjct: 784 SEVERSIQFTYQLRDLFNGMIFSNSRCVSPT 814

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 72/163 (44%), Gaps = 42/163 (25%)

Query: 924  SNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYY--DLTKKNNTV------------- 968
            ++N  D + KK T +       LP++L+I L RF +  +  K +N               
Sbjct: 766  TSNGTDVEAKKQTFIDK-----LPRVLLIQLKRFAFVTNSNKDSNMSNYNAYSGRIEKIR 820

Query: 969  --------ITYPL--ILNIILKNNDTMKYRLFGVVNHTGTLI-SGHYTSLVNKDLEHSVD 1017
                    +T P+  + +  L+++   +Y+L GV+ H G+    GHYT+    D+ H   
Sbjct: 821  KKIIYGHDLTIPIESVSSTSLRDDANREYKLTGVIYHHGSSPDGGHYTA----DVFHQ-- 874

Query: 1018 IGRSKWYYFDD---EVVKADKKHGSDKNLKISSSDVYVLFYER 1057
               +KWY  DD     +K D    +D N  + +   Y+L YE+
Sbjct: 875  -QTNKWYRIDDVNISELKNDHVLDADDN-DMGTRTAYILIYEK 915

>KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly
           similar to uniprot|P38237 YBR058C Saccharomyces
           cerevisiae UBP14 Ubiquitin-specific protease that
           specifically disassembles unanchored ubiquitin chains
          Length = 762

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFR-TLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
           GL+NLGN+CY+NS++Q L      R +L    ++   +  ++SN      K+ N+L    
Sbjct: 310 GLQNLGNSCYLNSVLQVLLNGDLSRWSLEGLGDFPGDVLYVSSNLRCQLIKMRNALKNEP 369

Query: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRL 704
            K Y +G   V PT F   I     +      QQD  EF    +D L
Sbjct: 370 EK-YPHG---VKPTTFKHCIGGTHEEFS-SGRQQDALEFFSYFVDLL 411

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 4/38 (10%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFR----TLFISSN 630
           + GL N GNTC++NS++QCL ++K       T+ + SN
Sbjct: 83  VGGLVNDGNTCFMNSVLQCLASSKELHKFMDTIILDSN 120

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 5/52 (9%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKL 649
           TGL N+GNTCY+NS++Q  F+    R   +      Y E +   R H   +L
Sbjct: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVLE-----YQETMEHFRHHTGNEL 778

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFR 623
           TGL N+GNTCY+NS++Q  F     R
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 36/88 (40%), Gaps = 18/88 (20%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYL----------------EPLASNR 642
           GL N+GNTCY+NS++Q  F+    R   +  NYK  +                  ++ N 
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYIL--NYKGSISNYEIDETSNKRRIGGREVSENE 768

Query: 643 PHHSPKLSNSLSMLFNKMYLNGGCSVVP 670
              S +    L  LFN M  +    + P
Sbjct: 769 VERSIQFMYQLRDLFNDMIYSKSRCITP 796

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin-specific
            protease
          Length = 782

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 10/87 (11%)

Query: 934  KMTTVKTINFVTLPKILVIHLSRFYYDLT--KKNNTVITY--PLILN-IILKNNDTM--- 985
            K T VK    V  P +L++HLSR  +D    +KN   +++   L++N  +++NN  +   
Sbjct: 435  KSTIVKKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFEEELVVNRQVIENNKCVGIR 494

Query: 986  --KYRLFGVVNHTGTLISGHYTSLVNK 1010
               Y+L  ++ H G+  +GHY    +K
Sbjct: 495  KDSYKLRSMLRHQGSHSTGHYECFRHK 521

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 58/147 (39%), Gaps = 46/147 (31%)

Query: 946  LPKILVIHLSRF-----------------YYDLTKKNNTVITYPLILNI----------- 977
            LP++L+I L RF                 Y    +K    I Y   L I           
Sbjct: 654  LPRVLLIQLKRFEFVNNSSERRELINYNAYNGRIEKIRKWIRYDQELTIPKEALSSVNAK 713

Query: 978  -ILKNNDTMKYRLFGVVNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDD----EVV 1031
              L   DT  YRL GVV H G   S GHYT+    D+ H     + KWY  DD    E+ 
Sbjct: 714  FYLSGKDTT-YRLTGVVYHHGLSPSGGHYTA----DVLHQT---QDKWYRIDDNNVTEIR 765

Query: 1032 KADK-KHGSDKNLKISSSDVYVLFYER 1057
            + D  K G + +    S   Y+L Y+R
Sbjct: 766  QEDVFKRGDEAS---DSKTAYILIYQR 789

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFR 623
           TGL N+GNTCY+NS++Q  F     R
Sbjct: 696 TGLNNIGNTCYLNSLLQYYFTISPLR 721

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFR 623
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa] {ON}
            YPL072W (UBP16) - putative deubiquitinating enzyme
            [contig 24] FULL
          Length = 749

 Score = 36.6 bits (83), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 10/86 (11%)

Query: 929  DFKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITYPLILNII---LKNND 983
            D    K T VK       P IL++HLSR  ++     +N+  +T+   L+     ++NN 
Sbjct: 429  DTSTLKSTIVKKTVVTESPDILILHLSRSVFNGMNYTRNSCYVTFEEELHTQEQEIENNR 488

Query: 984  T-----MKYRLFGVVNHTGTLISGHY 1004
                  +KY+L  +V H GT   GHY
Sbjct: 489  CVGVKPIKYKLKAMVKHEGTHSQGHY 514

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFR--TLFISSNYKNY 634
           TG+ N+GNTCY+NS++Q  F+    R   L  S  Y+++
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDF 790

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 758

 Score = 36.2 bits (82), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPK 648
           + GL N GNTC++NS++Q L ++KT      +   + Y E   S   H + K
Sbjct: 98  VGGLVNDGNTCFMNSVLQSLASSKTLLQFLDNEVIQAYKEAEESEDEHVAEK 149

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFR 623
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa]
           {ON} Anc_2.307 YDL122W
          Length = 770

 Score = 36.2 bits (82), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 101/279 (36%), Gaps = 63/279 (22%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSP--------- 647
           + GL N GNTC++NS++Q L ++K        S  K + E     +    P         
Sbjct: 90  VGGLVNDGNTCFMNSVLQSLASSKELNAFLDDSIIKKFQEQEEKIQNEEDPNEKEEEEEK 149

Query: 648 ----KLSNSLSMLFNKM---YLNGGCSVVPTGFLKVI-NQLRPDLKIPDDQQDTQEFLMI 699
               + S +   L +K+   Y            LK + N    ++ +  DQ+D QEF   
Sbjct: 150 DVDVRFSVAFKELLDKLNSKYYRDKPYFRTNKLLKTMSNAPNKNMLLGYDQEDAQEFFQN 209

Query: 700 LLDRLH-----------------------DELSNQQHVAND----YPNLLLYNADVLKVS 732
           +L  L                        D +  Q ++ +      P   +    VL   
Sbjct: 210 ILSELEKNVKSLDPKKFDNTPIPENELPDDAIIGQANLGDVGTVFLPTEQIEPNSVLNND 269

Query: 733 NNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMK 792
            N+ K +    +    I+P+D I   ++   LQC   G     YS F  LSL +P     
Sbjct: 270 ENDTKFYTPFKL----ITPLDGISAERI-GCLQCGENG--GIRYSVFSGLSLNLP----- 317

Query: 793 LSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831
               G +    +KL   +  +   E++ G    +C RCG
Sbjct: 318 ----GENIGSTLKLTGLLKEWIKPEIIEG---VECYRCG 349

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFR 623
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 735 TGINNIGNTCYLNSLLQYYFSIAPLR 760

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 36.2 bits (82), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFIS 628
           TG+ N+GNTCY+NS++Q  F     R   ++
Sbjct: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
           Anc_8.202 YER151C
          Length = 854

 Score = 36.2 bits (82), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 59/138 (42%), Gaps = 34/138 (24%)

Query: 599 GLRNLGNTCYINSMIQCLFAAKTF-RTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657
           G+ N  N C+++S++Q L +   F   L + S   N ++P       +  KL ++   L+
Sbjct: 420 GIINSANICFMSSVLQVLLSCAPFINILNVVSINSNIMKPGV-----NQTKLLDACIKLY 474

Query: 658 NKM-------------------------YLNGGCSVVPTGFLKVINQLRP--DLKIPDDQ 690
           ++                          Y     ++ P  F KV++ +    DLK    Q
Sbjct: 475 SRFDKESFEAEKEKEKDNESSSKKQSSQYNAKATAISPEEFYKVLSTISKFKDLKW-GHQ 533

Query: 691 QDTQEFLMILLDRLHDEL 708
           +D +EFL  LLD+LH+E 
Sbjct: 534 EDAEEFLTHLLDQLHEEF 551

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 36.2 bits (82), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPL 638
            GL N+GNTCY+NS++Q  F     R     ++Y+  LE +
Sbjct: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYV--ADYQKTLEAV 764

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 66/155 (42%), Gaps = 39/155 (25%)

Query: 599 GLRNLGNTCYINSMIQCLF----------------AAKTFRTLFISSNY---------KN 633
           G+ N GN C+++S++Q L                 +AK   T F+  +          K 
Sbjct: 348 GIVNTGNICFMSSILQVLLFCEPFVNLMNLISVKTSAKMGSTGFLLLDACLELYRKFDKQ 407

Query: 634 YLEPLASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRP--DLKIPDDQQ 691
             E   ++R      +S++L+            ++ P  F K +++L    DL+    Q+
Sbjct: 408 AFEREKASRSSSGVNISSALA-----------DAIKPDDFYKTLSKLPKFKDLRW-GHQE 455

Query: 692 DTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNA 726
           D +EFL  LLD+LH+E  N     +D   + L N+
Sbjct: 456 DAEEFLTHLLDQLHEEFVNSIDSLSDSEVISLINS 490

 Score = 32.3 bits (72), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 16/78 (20%)

Query: 987  YRLFGVVNHTGTLIS-GHYTSLVNKDLEHSVDIGRSKWYYFDD---EVVKADK--KHGSD 1040
            Y+L GVV H G   S GHYT  V ++         +KWY  DD   + ++ D+  K G +
Sbjct: 714  YKLIGVVYHHGVSPSGGHYTCDVYQET-------LNKWYRIDDTNVQEIEKDEVLKGGEE 766

Query: 1041 KNLKISSSDVYVLFYERV 1058
             N    S   Y+L Y+++
Sbjct: 767  GN---DSRTAYILIYQKL 781

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 35.4 bits (80), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 61/148 (41%), Gaps = 46/148 (31%)

Query: 946  LPKILVIHLSRF-----------------YYDLTKKNNTVITYPLILNI----------- 977
            LP++L+I L RF                 Y    +K    I Y   L I           
Sbjct: 698  LPQVLLIQLKRFEFVNNNSERRELVNYNAYNGRIEKICKWIKYDHDLTIPKEALSSINAK 757

Query: 978  -ILKNNDTMKYRLFGVVNHTGTLIS-GHYTS-LVNKDLEHSVDIGRSKWYYFDD----EV 1030
             +  +NDT  Y+L GVV H G   S GHYT+ ++++D E        KWY  DD    E+
Sbjct: 758  FLFSDNDT-SYKLTGVVYHHGLSSSGGHYTADVLHQDEE--------KWYRIDDTTVTEI 808

Query: 1031 VKADKKHGSDKNLKISSSDVYVLFYERV 1058
             K +   G ++     S   Y+L Y+R 
Sbjct: 809  NKEEVVTGGEEGSH--SRTAYILIYQRA 834

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin- specific
            protease
          Length = 752

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 934  KMTTVKTINFVTLPKILVIHLSRFYYDLTK--KNNTVITYPLILNI---ILKNNDT---- 984
            K   VK       P+IL++HLSR  ++ T   +N+  + +   L+     ++NN      
Sbjct: 432  KSRIVKKTVVTESPEILILHLSRSVFNGTNYTRNSCYVNFDEELHTQEQTIENNRCVGVK 491

Query: 985  -MKYRLFGVVNHTGTLISGHY 1004
             +KY+L  +V H GT   GHY
Sbjct: 492  PIKYKLKSMVKHQGTHSQGHY 512

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
           (REAL)
          Length = 790

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLE 636
           I GL N GNTC++NS++Q L ++K       ++  K Y E
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSKELMEFLDNNVIKTYEE 139

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 7/100 (7%)

Query: 598 TGLRNLGNTCYINSMIQCLF--AAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSM 655
            GL NLGN+CY+NS+IQ L       +   F+ S +   +    +N      KL N++  
Sbjct: 323 CGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVYPDNNLKCQWIKLLNAMK- 381

Query: 656 LFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQE 695
              ++Y NG   + PT F K I Q   +    + QQD  E
Sbjct: 382 CEPELYPNG---IKPTTFKKCIGQNHQEFS-SNRQQDAME 417

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1269

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 598 TGLRNLGNTCYINSMIQCLFAAKTFR 623
            G+ N+GNTCY+NS++Q  F+    R
Sbjct: 713 AGINNIGNTCYLNSLLQYYFSIAPLR 738

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
           (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 20/26 (76%)

Query: 597 ITGLRNLGNTCYINSMIQCLFAAKTF 622
           + GL N GNTC++NS++Q L ++KT 
Sbjct: 88  VAGLVNDGNTCFMNSVLQSLASSKTL 113

>KAFR0B01550 Chr2 complement(292584..295484) [2901 bp, 966 aa] {ON}
           Anc_5.46 YMR288W
          Length = 966

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 3/97 (3%)

Query: 587 RNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNR-PHH 645
           R+ +V + L ++ L   G   Y+N +IQC+F   T   + I     N L  LA N  P+ 
Sbjct: 326 RHTSVKIVLQLSVLLGSGVLPYLNGLIQCIFDGLTDEHIPIRILTANTLASLAQNSYPYG 385

Query: 646 SPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRP 682
                 +L  L+  ++ + G   V   FLK +  + P
Sbjct: 386 LEAFDFALKPLWKGLHTHRG--KVLAAFLKCLGSIIP 420

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 52/107 (48%), Gaps = 23/107 (21%)

Query: 938  VKTINFVTLPKILVIHLSRFYYDL---TKKNNTVITYPLILNI--ILKNND------TMK 986
            ++ ++   LP +L++ L RF + +   + K N  I + + LN+    K  D       + 
Sbjct: 352  IRQLSMAKLPPVLMLQLKRFEHLINGTSVKINDYIFFSVDLNMKDYCKPMDDQHPVPNLT 411

Query: 987  YRLFGVVNHTGTLISGHYTSL--VNKDLEHSVDIGRSKWYYFDDEVV 1031
            ++L  ++ H GT+  GHYT++  +N D+          W  F+D +V
Sbjct: 412  FKLSAIIPHQGTVDKGHYTTICRINGDV----------WAKFNDSMV 448

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 51/117 (43%), Gaps = 14/117 (11%)

Query: 715 ANDYPNLLLYN-ADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTT 773
           A+++ N LL   +D L   + +     D    G+ I+ ++ +FQG + N  +C  C  TT
Sbjct: 405 AHEFLNFLLNEVSDYLGAHSEQIAQGLDVKNPGD-INFVNRLFQGTLTNRTKCLTCDNTT 463

Query: 774 FNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRC 830
           +    F   ++ +   S         T+ +  L D    F   E+L+G N + C  C
Sbjct: 464 YRNEPFLDFAIEVQQDS--------ETDIQTTLAD----FHQKELLNGANKFYCDVC 508

 Score = 33.1 bits (74), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 55/129 (42%), Gaps = 17/129 (13%)

Query: 939  KTINFVTLPKILVIHLSRFYYDLTKKNNTV----ITYPLILNIILKNNDTM--KYRLFG- 991
            + +    LP  L +H+ RF Y   +  N      I YPL L +    + ++  +Y L G 
Sbjct: 516  RVVGLKQLPFYLALHMKRFKYSERQNCNVKLFNRIHYPLHLKVCSTFDSSVCKQYELVGL 575

Query: 992  VVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLKISS--SD 1049
            VV+  G    GHY S+   +        R  W  FDDE V+   +    K +  S   + 
Sbjct: 576  VVHMGGGPHHGHYVSICKNE--------RFGWLLFDDETVETVNESTVLKFVGNSDDLTT 627

Query: 1050 VYVLFYERV 1058
             Y+LFY+  
Sbjct: 628  AYLLFYKET 636

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 116,243,072
Number of extensions: 5476763
Number of successful extensions: 20770
Number of sequences better than 10.0: 315
Number of HSP's gapped: 20851
Number of HSP's successfully gapped: 584
Length of query: 1060
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 940
Effective length of database: 39,721,479
Effective search space: 37338190260
Effective search space used: 37338190260
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)