Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_8.532.530ON44644617580.0
YHR004C (NEM1)2.530ON44644614520.0
Skud_8.492.530ON44744813600.0
Suva_8.582.530ON45245213260.0
NCAS0F009302.530ON4224478251e-106
NDAI0H014202.530ON4483398141e-104
KAFR0A018302.530ON4424558001e-102
SAKL0A09416g2.530ON3853457851e-100
TPHA0G035002.530ON3923437774e-99
KNAG0C058502.530ON4434627711e-97
Kwal_26.80012.530ON4133527575e-96
TDEL0A030502.530ON3553367441e-94
CAGL0K02959g2.530ON4643407495e-94
KLTH0D06776g2.530ON4093577376e-93
TBLA0I014602.530ON3933626773e-84
ZYRO0B01958g2.530ON3363366402e-79
Ecym_72572.530ON3523366222e-76
AGL070W2.530ON3433366185e-76
Kpol_348.82.530ON4223656202e-75
KLLA0E18613g2.530ON3743464916e-57
TBLA0C060905.202ON484951562e-10
Suva_10.995.202ON3851711533e-10
YLR019W (PSR2)5.202ON3971681499e-10
NDAI0D018605.202ON5141731501e-09
Smik_12.535.202ON4141801491e-09
Skud_12.875.202ON3921681462e-09
Smik_12.825.202ON3921711453e-09
YLL010C (PSR1)5.202ON4271851427e-09
SAKL0G12870g5.202ON3991731428e-09
KNAG0M017405.202ON4811731392e-08
CAGL0D03234g5.202ON4101731373e-08
TBLA0H019905.202ON6881891383e-08
Skud_12.575.202ON4151681364e-08
TPHA0E030705.202ON494951365e-08
Kpol_2002.1005.202ON4771591365e-08
NDAI0I021705.202ON3911731355e-08
ZYRO0B10428g5.202ON4821681348e-08
KAFR0J009905.202ON4831731348e-08
Ecym_71045.202ON4921021349e-08
CAGL0D05610g5.202ON4471601321e-07
KLLA0F15620g5.202ON4141731321e-07
KLTH0B03388g5.202ON4091681312e-07
TDEL0E042705.202ON4531731312e-07
Suva_10.655.202ON4151681302e-07
Kpol_478.165.202ON350951292e-07
Kwal_33.151405.202ON4101571293e-07
NCAS0D027405.202ON3981571284e-07
AAL158W5.202ON4781001276e-07
NCAS0A068005.202ON4731731241e-06
TPHA0N006705.202ON4521681178e-06
YPL063W (TIM50)8.527ON4761081053e-04
TDEL0B031908.527ON4771081044e-04
ZYRO0F09130g8.527ON48966990.001
SAKL0H10296g8.527ON478117980.002
Smik_16.1728.527ON477108980.002
Suva_16.2498.527ON480108960.003
NDAI0E029108.527ON441108950.004
TBLA0A005408.527ON485108950.004
Kwal_27.119908.527ON474108930.007
CAGL0H05159g8.527ON48566930.009
KLLA0E23101g8.527ON48076930.009
NCAS0C022108.527ON491108920.009
KLTH0E12254g8.527ON47666910.014
Skud_16.2188.527ON480108890.021
Kpol_457.58.527ON489117890.027
Ecym_11778.527ON49066840.096
TPHA0I020008.527ON478108820.16
KNAG0A020608.527ON45073770.65
KAFR0E010208.527ON44876760.76
ADR045W8.527ON476107704.8
Ecym_30306.25ON74742705.4
SAKL0E06820g2.319ON90583696.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_8.53
         (446 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   681   0.0  
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   563   0.0  
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   528   0.0  
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   515   0.0  
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   322   e-106
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    318   e-104
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   312   e-102
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   306   e-100
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   303   4e-99
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   301   1e-97
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   296   5e-96
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   291   1e-94
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   293   5e-94
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   288   6e-93
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   265   3e-84
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   251   2e-79
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   244   2e-76
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   242   5e-76
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   243   2e-75
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   193   6e-57
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    65   2e-10
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    64   3e-10
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    62   9e-10
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     62   1e-09
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    62   1e-09
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    61   2e-09
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    60   3e-09
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    59   7e-09
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    59   8e-09
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    58   2e-08
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    57   3e-08
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    58   3e-08
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    57   4e-08
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    57   5e-08
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    57   5e-08
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     57   5e-08
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    56   8e-08
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    56   8e-08
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    56   9e-08
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    55   1e-07
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    55   1e-07
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    55   2e-07
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    55   2e-07
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    55   2e-07
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    54   2e-07
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    54   3e-07
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    54   4e-07
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    54   6e-07
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    52   1e-06
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    50   8e-06
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    45   3e-04
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    45   4e-04
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    43   0.001
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    42   0.002
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    42   0.002
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    42   0.003
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    41   0.004
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    41   0.004
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    40   0.007
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    40   0.009
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    40   0.009
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     40   0.009
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    40   0.014
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    39   0.021
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    39   0.027
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    37   0.096
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    36   0.16 
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    34   0.65 
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    34   0.76 
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    32   4.8  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...    32   5.4  
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    31   6.8  

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/446 (78%), Positives = 350/446 (78%)

Query: 1   MNALKYFSNHLITTKKPRKNHVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDHS 60
           MNALKYFSNHLITTKKPRKNHVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDHS
Sbjct: 1   MNALKYFSNHLITTKKPRKNHVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDHS 60

Query: 61  SDHLKDFNQNEERKLFISAKPKSLRSILKEKIGSIXXXXXXXXXXXXVIKPLMSLWYVFT 120
           SDHLKDFNQNEERKLFISAKPKSLRSILKEKIGSI            VIKPLMSLWYVFT
Sbjct: 61  SDHLKDFNQNEERKLFISAKPKSLRSILKEKIGSILWALLLFLPYYLVIKPLMSLWYVFT 120

Query: 121 FPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCNLNTISETVEDDLN 180
           FPLSVIERRVKHTDKRNKE                    KINSKNCNLNTISETVEDDLN
Sbjct: 121 FPLSVIERRVKHTDKRNKESSDNENGSPTSSSSAGDSSEKINSKNCNLNTISETVEDDLN 180

Query: 181 ASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPKKL 240
           ASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPKKL
Sbjct: 181 ASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPKKL 240

Query: 241 IPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKRP 300
           IPKSVLNTQKKKKLVIDLDETLI             QGHLVEVKFGISGIRTLYFIHKRP
Sbjct: 241 IPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIRTLYFIHKRP 300

Query: 301 YCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYIK 360
           YCDLFLTKVSKWYELIIFTASMKEYADPVIDWLE              DCVLRDGVGYIK
Sbjct: 301 YCDLFLTKVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRYYRSDCVLRDGVGYIK 360

Query: 361 DLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXX 420
           DLSII                       PVSYAMNVDNAIQVEGWIS             
Sbjct: 361 DLSIIKNSEENEKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPF 420

Query: 421 XEAMRYSTDVRNILALKHGEKAFNIN 446
            EAMRYSTDVRNILALKHGEKAFNIN
Sbjct: 421 LEAMRYSTDVRNILALKHGEKAFNIN 446

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/446 (67%), Positives = 322/446 (72%)

Query: 1   MNALKYFSNHLITTKKPRKNHVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDHS 60
           MNALKYFSNHLITTKK +K +VEVT NQD+L  S E SN Y +H EN+C  EV+Q +DHS
Sbjct: 1   MNALKYFSNHLITTKKQKKINVEVTKNQDLLGPSKEVSNKYTSHSENDCVSEVDQQYDHS 60

Query: 61  SDHLKDFNQNEERKLFISAKPKSLRSILKEKIGSIXXXXXXXXXXXXVIKPLMSLWYVFT 120
           S HLK+ +QN+ERK  +  KPK+LRSIL EKI SI            +IKPLMSLW+VFT
Sbjct: 61  SSHLKESDQNQERKNSVPKKPKALRSILIEKIASILWALLLFLPYYLIIKPLMSLWFVFT 120

Query: 121 FPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCNLNTISETVEDDLN 180
           FPLSVIERRVKHTDKRN+                     K N KNCNLNTI E VEDDLN
Sbjct: 121 FPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPKNCNLNTIPEAVEDDLN 180

Query: 181 ASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPKKL 240
           ASDEIILQRDNVKGSLLRAQSVK R RSYSKSE+SL+NHSS+NTVFGTKRMGRFLFPKKL
Sbjct: 181 ASDEIILQRDNVKGSLLRAQSVKSRPRSYSKSELSLSNHSSSNTVFGTKRMGRFLFPKKL 240

Query: 241 IPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKRP 300
           IPKSVLNTQKKKKLVIDLDETLI             QGHLVEVKFG+SGIRTLYFIHKRP
Sbjct: 241 IPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYFIHKRP 300

Query: 301 YCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYIK 360
           YCDLFLTKVSKWY+LIIFTASMKEYADPVIDWLE              DCVLRDGVGYIK
Sbjct: 301 YCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYIK 360

Query: 361 DLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXX 420
           DLSI+                       PVSYAMNVDNAIQVEGWIS             
Sbjct: 361 DLSIVKDSEENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPF 420

Query: 421 XEAMRYSTDVRNILALKHGEKAFNIN 446
            EAMRYSTDVRNILALKHGEKAFNIN
Sbjct: 421 LEAMRYSTDVRNILALKHGEKAFNIN 446

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/448 (64%), Positives = 317/448 (70%), Gaps = 3/448 (0%)

Query: 1   MNALKYFSNHLITTKKPRKN-HVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDH 59
           MNALKYFSNHLITTKKP+K  +VE+T +QD+++ SNE S T A H EN+  I  N   +H
Sbjct: 1   MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTENDI-IGGNHQHNH 59

Query: 60  SSDHLKDFNQNEERKLFISAKPKSLRSILKEKIGSIXXXXXXXXXXXXVIKPLMSLWYVF 119
           S+D+L+   QNE+    +  KPK+LRSIL+ KI SI            +IKPLMSLW+VF
Sbjct: 60  STDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVF 119

Query: 120 TFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCNLNTISETVEDDL 179
           TFPLSVIERRVKHTDKR+KE                    K  SKN NLNTI ETV+DDL
Sbjct: 120 TFPLSVIERRVKHTDKRHKEPGNSGNVSSTSSGNGNDSNEKAGSKNGNLNTIPETVDDDL 179

Query: 180 NASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPKK 239
           NASDEIILQRDNVKGSLL+AQSVK RSRSYSKS+VSLTNHS+TNTVFGTKRMGRFLFPKK
Sbjct: 180 NASDEIILQRDNVKGSLLKAQSVKSRSRSYSKSDVSLTNHSNTNTVFGTKRMGRFLFPKK 239

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKR 299
           LIPKS+LNTQKKKKLVIDLDETLI             QGHLVEVKFGISGI TLYFIHKR
Sbjct: 240 LIPKSILNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIPTLYFIHKR 299

Query: 300 PYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYI 359
           PYCD FLTKVS+WY+LIIFTASMKEYADPVIDWLE              DCVLRDGVGYI
Sbjct: 300 PYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYI 359

Query: 360 KDLSIIXXXXXXXXXXXXXXXXXX-XXXXXPVSYAMNVDNAIQVEGWISXXXXXXXXXXX 418
           KDLSII                        PVSYAMNVDNAIQVEGWIS           
Sbjct: 360 KDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLL 419

Query: 419 XXXEAMRYSTDVRNILALKHGEKAFNIN 446
              EAMRYSTDVRNILALKHGEKAFNIN
Sbjct: 420 PFLEAMRYSTDVRNILALKHGEKAFNIN 447

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  515 bits (1326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/452 (61%), Positives = 308/452 (68%), Gaps = 6/452 (1%)

Query: 1   MNALKYFSNHLITTKKPRKN-HVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDH 59
           MNALKYFSNHLITT KP+K  +VEVT +QD L  SNE  +T A++ E + T++ N   + 
Sbjct: 1   MNALKYFSNHLITTNKPKKTINVEVTKSQDSLSASNETFDTGASNTEKDPTVKENHQHNS 60

Query: 60  SSDHLKDFNQNEERKLFISAKPKSLRSILKEKIGSIXXXXXXXXXXXXVIKPLMSLWYVF 119
           S++   +  Q+EE    +S K K+L SILKEKI SI            +IKPLMSLW+VF
Sbjct: 61  STEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSLWFVF 120

Query: 120 TFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCNLNTISETVEDDL 179
           TFPL+VIERRVKHTDKR+KE                    K ++KN NLNTI E VEDDL
Sbjct: 121 TFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIVEDDL 180

Query: 180 NASDEIILQRDNVKGSLLRA----QSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFL 235
           NASDEIILQRDNVKGSLL+A     S K +SR YSKSE SLTNHS+ NTVFGTKRMGRFL
Sbjct: 181 NASDEIILQRDNVKGSLLQAADGVHSAKSKSRRYSKSEASLTNHSTANTVFGTKRMGRFL 240

Query: 236 FPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYF 295
           FPKKLIPKS+LNTQKKKKLVIDLDETLI             QGHLVEVKFGISGI TLYF
Sbjct: 241 FPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVEVKFGISGISTLYF 300

Query: 296 IHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDG 355
           IHKRPYCDLFLTK SKWY+LIIFTASMKEYADPVIDWLE              DCVLRDG
Sbjct: 301 IHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFSKRYYRSDCVLRDG 360

Query: 356 VGYIKDLSIIXXXXXXXXXXXXXXXXXX-XXXXXPVSYAMNVDNAIQVEGWISXXXXXXX 414
           VGYIKDLSI+                        PVSYAMNVDNAIQVEGWIS       
Sbjct: 361 VGYIKDLSILKSSEENGKGSSLSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDL 420

Query: 415 XXXXXXXEAMRYSTDVRNILALKHGEKAFNIN 446
                  EAMRYSTDVRNILALKHGEKAFN+N
Sbjct: 421 LNLLPFLEAMRYSTDVRNILALKHGEKAFNMN 452

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  322 bits (825), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/447 (42%), Positives = 246/447 (55%), Gaps = 32/447 (7%)

Query: 1   MNALKYFSNHLITTKKPRKNHVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDHS 60
           MNAL Y S+HL +       H        I+    E +N     I+++     N   D+S
Sbjct: 1   MNALSYISSHLASPI-----HYLKKKEPTIVPVEQEPTNN-NEKIKSHSKATTNNDEDYS 54

Query: 61  SDHLKDFNQNE-ERKLFISAKPKSLRSILKEKIGSIXXXXXXXXXXXXVIKPLMSLWYVF 119
           +      + N  E+ + +    ++LR         +            ++KPL+ LW++ 
Sbjct: 55  TPMADSSSSNTIEKSIAVYGSDRALR------FSVLFWTFVLFFPKFLIVKPLLFLWFIV 108

Query: 120 TFPLSVIERRVKH-TDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCNLNTISETVEDD 178
           TFPL ++ER +KH T  +NK                     ++ + +  L  I ET EDD
Sbjct: 109 TFPLYLLERGMKHRTLLKNK-----------LDENSQKNAERVPTTSPELTVIDETTEDD 157

Query: 179 LNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPK 238
           L   DEI LQRD +KGSLL+A S K  S S +   +S     S NT F +KRMG+FLFPK
Sbjct: 158 LAGGDEIYLQRDTIKGSLLKATSAKQLSSSKTVKSIS-----SNNTSFSSKRMGKFLFPK 212

Query: 239 KLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHK 298
           KLIP+S++ T ++KKLV+DLDETLI             QGH+VEVKF +SG+ TLY++HK
Sbjct: 213 KLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHK 272

Query: 299 RPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGY 358
           RPYCD FL+KVSKWY+LIIFTASMKEYADPVIDWLE              DC+LRDGVGY
Sbjct: 273 RPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGY 332

Query: 359 IKDLSIIXXXXXXXXXXXXXXXXXXXXXX--XPVSYAMNVDNAIQVEGWISXXXXXXXXX 416
           IKDLS+I                         P+SYAMNV+NAIQVEGWIS         
Sbjct: 333 IKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDNALLN 392

Query: 417 XXXXXEAMRYSTDVRNILALKHGEKAF 443
                EA+R++TDVRN+LALK+GEKAF
Sbjct: 393 LLPLLEALRFTTDVRNVLALKNGEKAF 419

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  318 bits (814), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 169/339 (49%), Positives = 206/339 (60%), Gaps = 8/339 (2%)

Query: 108 VIKPLMSLWYVFTFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCN 167
           +IKP++ LWY+ TFPLS+IER  K+   R +                      +  +   
Sbjct: 117 IIKPILFLWYILTFPLSLIERGTKY---RMRPFSQSKDSSPEKDETLVHNNSFLPEEPSK 173

Query: 168 LNTISETVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFG 227
           L+ I+E  EDDL + D I LQRDNVKGSLL+A SV  R  S S+S  ++    S NT F 
Sbjct: 174 LDAINELTEDDLVSGDGIYLQRDNVKGSLLKASSV--RQPSLSRSMKTMV---SNNTSFS 228

Query: 228 TKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI 287
           +KRMG+FLFPKKLIPKS+  T+++KKLV+DLDETLI             QGH+VEVKF  
Sbjct: 229 SKRMGKFLFPKKLIPKSITQTERRKKLVLDLDETLIHSISRGTTHTNVSQGHIVEVKFSS 288

Query: 288 SGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXX 347
           SG+  LY++HKRPYCD FL+KV KWY+LIIFTASMKEYADPVIDWLE             
Sbjct: 289 SGVSMLYYVHKRPYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWLEASFQGTFTERYYR 348

Query: 348 XDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
            DC+ RDGVGYIKDL+II                       P+SYAMN DNAIQVEGWIS
Sbjct: 349 TDCIRRDGVGYIKDLTIIKDDSNVSVPQTSTLSEVIILDNSPISYAMNADNAIQVEGWIS 408

Query: 408 XXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFNIN 446
                         EA+RY+TDVR+ILALK+GE+AF  N
Sbjct: 409 DPTDTALLNLLPLLEALRYTTDVRSILALKNGERAFYAN 447

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  312 bits (800), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 192/455 (42%), Positives = 252/455 (55%), Gaps = 28/455 (6%)

Query: 1   MNALKYFSNHL-ITTKKPRKNHVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDH 59
           MNAL Y +NH+ +   K R N+    N         +D ++ +   +   T E N   + 
Sbjct: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRE-NASPEK 59

Query: 60  SSDHLKD-FNQNEERKLFISAK-PKSLRSIL----KEKIGSIXXXXXXXXXXXXVIKPLM 113
               +KD  NQN E  + I  + P+   +IL    K  + S+             + PL+
Sbjct: 60  GLSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLI 119

Query: 114 SLWYVFTFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCNLNTISE 173
            +W++ T PL+++ER +K  D++ K                       +S+   L +ISE
Sbjct: 120 YVWFILTLPLTLVERGIKLRDRKKKAELRGNFGE--------------SSELSPLRSISE 165

Query: 174 TVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNT-VFGTKRMG 232
             E+DL+ SDE  LQRD +KGSLLRA S K       KS +   +H + NT +FGTK+MG
Sbjct: 166 VGEEDLSTSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIK-QDHEAMNTNIFGTKKMG 224

Query: 233 RFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRT 292
           RFLFPKKLIP+S+L  ++KK LV+DLDETLI             QGHLVEVKF I+GI T
Sbjct: 225 RFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGIST 284

Query: 293 LYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVL 352
           LY++HKRP+CDLFL+KVSKWY ++IFTASMKEYADPVIDWLE              +C+L
Sbjct: 285 LYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLL 344

Query: 353 RDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXX----XPVSYAMNVDNAIQVEGWISX 408
           RDGVGYIKDLS++                           PVSYA+NVDNAIQVEGWIS 
Sbjct: 345 RDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISD 404

Query: 409 XXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 443
                        EA+RY+TDVRN+LALK+GEK F
Sbjct: 405 PTDTDLLNLLPILEALRYTTDVRNVLALKNGEKMF 439

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  306 bits (785), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 168/345 (48%), Positives = 207/345 (60%), Gaps = 39/345 (11%)

Query: 108 VIKPLMSLWYVFTFPLSVIERR-VKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNC 166
           +IKP++  WY+ TFPL++IE       D+RN E                        K  
Sbjct: 73  IIKPVLFFWYIITFPLNLIEHSPADDEDERNGEEGNSTGD---------------EEKTP 117

Query: 167 NLNTISETVEDDLNASDEIILQRDNVKGSL------LRAQSVKLRSRSYSKSEVSLTNHS 220
           ++N I E  E+DL A DEIILQ D VKGSL       + +++K  +RS  +S        
Sbjct: 118 SINIIVEEDEEDL-AGDEIILQTDAVKGSLSTISESQQVKTIKASTRSSIRS-------G 169

Query: 221 STNTVFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHL 280
           ST T  G++RMGRFLFPKKLIP+SVLN +KKK LV+DLDETLI             QGH+
Sbjct: 170 STGTALGSRRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGHM 229

Query: 281 VEVKFGISGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXX 340
           VEVKF +SGI +LYF+HKRPYCDLFL+KV+KWY L++FTASMKEYADPVIDWLE      
Sbjct: 230 VEVKFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGS 289

Query: 341 XXXXXXXXDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAI 400
                   DC+LRDGVGYIKDLS+I                       P+SYAMNVDNAI
Sbjct: 290 FSQRLYRQDCILRDGVGYIKDLSLI---------SKKSLNEIIIVDNSPISYAMNVDNAI 340

Query: 401 QVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFNI 445
           QVEGWIS              EA+R++TD+RN+L+LK GE+AFNI
Sbjct: 341 QVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLSLKSGEQAFNI 385

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  303 bits (777), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 165/343 (48%), Positives = 204/343 (59%), Gaps = 7/343 (2%)

Query: 110 KPLMSLWYVFTFPLSVIERRVKHTDK-RNKEXXXXXXXXXXXXXXXXXXXXKINSKNCNL 168
           KPL+  WY+ TFPL++ E+   +  + R+ +                    K   +   L
Sbjct: 51  KPLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQL 110

Query: 169 NTISETVEDDLNASDEIILQRDNVKGSLLRAQSV-KLRSRSYSKSEVSLTNHSSTNTVFG 227
             +   +EDD+    E+ILQRD VKGSLL A ++ K+   + S    S     S++  FG
Sbjct: 111 QNLDSVLEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFG 169

Query: 228 TKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI 287
           TK+MGRFLFPKKLIP+S+L++ +KKKLV+DLDETLI             Q HLVEVKF I
Sbjct: 170 TKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSNSNSNNAQAHLVEVKFQI 229

Query: 288 SGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXX 347
           SGI TLY++HKRPYCDLFL+ VSKWY+LIIFTASMKEYADPVIDWLE             
Sbjct: 230 SGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYR 289

Query: 348 XDCVLRDGVGYIKDLSIIXXX----XXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVE 403
             C+LRDGVGYIKDLSII                           PVSYAMNVDNAIQVE
Sbjct: 290 NHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVE 349

Query: 404 GWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFNIN 446
           GWIS              E++RY+TDVRNIL+LK+GE+AF+IN
Sbjct: 350 GWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFDIN 392

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  301 bits (771), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 189/462 (40%), Positives = 254/462 (54%), Gaps = 35/462 (7%)

Query: 1   MNALKYFSNHLITTKKPRKN--HVEVTNNQDILD--TSNEDSNTYATHIENNCTIEVNQH 56
           MN + Y + HLI   +PR    H EV + +  +D      +++     ++    +E  ++
Sbjct: 1   MNTISYITQHLIYPLRPRAKSLHNEVKSGEGKVDDGVGVTENDVADGKLKTTANVEKQEN 60

Query: 57  FDHSSDHLKDFNQNEERKLFISAKPKSL--------RSILKEKIGSIXXXXXXXXXXXXV 108
                + L     + E+    ++KP  +         +IL +K+ ++            +
Sbjct: 61  STLKEELLDRQGSDAEK----ASKPIIVINDGDILNENILHQKVWNVLVFVIFFLPTYLI 116

Query: 109 IKPLMSLWYVFTFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCNL 168
            KPL+ LW++ T PL+++ER +K    RN+                      + S    L
Sbjct: 117 YKPLLLLWFLVTLPLALVERGIKL---RNRPKMKTEKVSEL-----------VLSDPSKL 162

Query: 169 NTISETVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSS----TNT 224
            +I+E VE+DL A DE  LQRD VKGSLL+A + K  +   SK   +   H +     +T
Sbjct: 163 GSINEEVEEDLAAGDEFYLQRDIVKGSLLKATTNKHHTPLKSKKNSAQNQHGNETHPNST 222

Query: 225 VFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVK 284
           VFGTK+MGRFLFPKKLIPKS+LN +KKK LV+DLDETLI             QGH+VEVK
Sbjct: 223 VFGTKKMGRFLFPKKLIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPNSSQGHIVEVK 282

Query: 285 FGISGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXX 344
           F ISG+ TLY++ KRPYCDLFLTKVSKWY+++IFTASMKEYADPVIDWLE          
Sbjct: 283 FSISGVSTLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFSRR 342

Query: 345 XXXXDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEG 404
               DC+LRDGVGYIKDL ++                       PVSYA+NVDNAIQVEG
Sbjct: 343 LYRNDCILRDGVGYIKDLKMV-TRGSNLGTSPDRLEDVIIVDNSPVSYALNVDNAIQVEG 401

Query: 405 WISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFNIN 446
           WI+              EA+  +TDVRNIL+LK+GEKAFNI+
Sbjct: 402 WINDPTDTDLLNLIPLLEALENTTDVRNILSLKNGEKAFNID 443

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  296 bits (757), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 166/352 (47%), Positives = 195/352 (55%), Gaps = 26/352 (7%)

Query: 108 VIKPLMSLWYVFTFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCN 167
           V+KP++ +W+V TFPLS+IER          E                     + SK   
Sbjct: 71  VVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVGSK-PR 129

Query: 168 LNTISETVEDDLNASDEIILQRDNVKGSLL---------------RAQSVKLRSRSYSKS 212
           +NTI E  EDD    DEI LQ D VKGSL                R Q  K   +S   +
Sbjct: 130 INTIQE--EDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGSRQSPKAA 187

Query: 213 EVSLTNHSSTNTVFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXX 272
            V     SS  T  G++RMGRFLFPKKLIP+SVLN +K + LV+DLDETLI         
Sbjct: 188 SVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHSMSRGTSS 247

Query: 273 XXXXQGHLVEVKFGISGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDW 332
               QGH+VEVKF ISGI TLY +HKRPYCDLFLT ++ WYEL++FTASMKEYADPVIDW
Sbjct: 248 SNSSQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDW 307

Query: 333 LEXXXXXXXXXXXXXXDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSY 392
           LE              DC+LRDGVGYIKDLS +                       PVSY
Sbjct: 308 LESSFPGKFSRRLYRQDCILRDGVGYIKDLSAV--------APNTLLSDIFIIDNSPVSY 359

Query: 393 AMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFN 444
           AM+VDNAIQVEGWIS              EA+R++TDVRNILALK GE AF+
Sbjct: 360 AMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEHAFS 411

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  291 bits (744), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 156/336 (46%), Positives = 195/336 (58%), Gaps = 40/336 (11%)

Query: 108 VIKPLMSLWYVFTFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCN 167
           +IKP   +W++ + PL +IE  +K   +R                               
Sbjct: 58  IIKPTQLIWWIISLPLLLIEYGLKSRLQRKST----------------------KRSTGT 95

Query: 168 LNTISETVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFG 227
           L +ISE  EDDL   DEI LQRD VKGSL  A           K   S +   S+  + G
Sbjct: 96  LQSISELEEDDLAGGDEIFLQRDAVKGSLAPA-----------KYRRSRSGSRSSTVMLG 144

Query: 228 TKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI 287
           TKRMGRFLFPKKLIP+SVL+ +K+K+LV+DLDETLI             QGH+VE++F I
Sbjct: 145 TKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAI 204

Query: 288 SGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXX 347
           SG+ TLY++HKRP+CDLFL+KVSKWY+L++FTASM+EYADPVIDWLE             
Sbjct: 205 SGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYR 264

Query: 348 XDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
            +C+LRDGVGYIKDLSI+                       P+SYAMNVDNAIQVEGWIS
Sbjct: 265 NNCILRDGVGYIKDLSIV-------CGPTVTLGEVILVDNSPISYAMNVDNAIQVEGWIS 317

Query: 408 XXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 443
                         EA+RY+TDVR+ILALK+ E+AF
Sbjct: 318 DPSDTDLLTLLPFLEALRYTTDVRDILALKNSEQAF 353

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  293 bits (749), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 198/340 (58%), Gaps = 13/340 (3%)

Query: 108 VIKPLMSLWYVFTFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCN 167
           +IKP + +W++ TFPLS+IE  V+   K  +                     K NS +  
Sbjct: 137 LIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATN----------KDNSPSKR 186

Query: 168 LNTISETVEDDLNASDEIILQRDNVKGSLLRA-QSVKLRSRSYSKSEVSLTNHSSTNTVF 226
           LN I E +EDDL + + + LQ+D +KGSLL   +     S    + + + +  S T+ + 
Sbjct: 187 LNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPSHTSNIL 246

Query: 227 GTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFG 286
           GTK MGRF FPKKLIP+S+L ++KKK LVIDLDETLI             Q H++EV+F 
Sbjct: 247 GTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFA 306

Query: 287 ISGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXX 346
           ISG+ TLY++HKRPYCDLFL+KV KWY LIIFTASMKEYADPVIDWLE            
Sbjct: 307 ISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMY 366

Query: 347 XXDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWI 406
              C+ RDGVGYIKDL  I                       PVSYAM+VDNAIQVEGWI
Sbjct: 367 RNHCIARDGVGYIKDLGNI--KDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWI 424

Query: 407 SXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFNIN 446
           S              EA+RY+TDVRN+LALK+ EKAF ++
Sbjct: 425 SDPTDTELLNLLPFLEALRYTTDVRNVLALKNSEKAFQLS 464

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  288 bits (737), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 165/357 (46%), Positives = 203/357 (56%), Gaps = 37/357 (10%)

Query: 108 VIKPLMSLWYVFTFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCN 167
           V+KP++ +W+V TFPLS+IER        + E                     I+ KN +
Sbjct: 66  VVKPVLFVWFVITFPLSLIER------ASSSENQGMGFDNAEGDSKSEASAGTISPKNSS 119

Query: 168 -LNTISETVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSK-------------SE 213
            ++TI+E  EDDL A +E+ILQ D VKGSL      K R +   +             S 
Sbjct: 120 RISTITEE-EDDL-AGEEMILQADTVKGSLTVTSGAKERPQDKGRRQPLQPQQQQPKTSR 177

Query: 214 VSLTNHSS-------TNTVFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXX 266
            SL   S          T  G++RMGRFLFPKKLIP+SVLN +K++ LV+DLDETLI   
Sbjct: 178 QSLKTSSVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHSM 237

Query: 267 XXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYA 326
                     QGH+VEVKF  SGI TLY +HKRPYCDLFLTK++KWYEL++FTASMKEYA
Sbjct: 238 SRGTSSSNSSQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYA 297

Query: 327 DPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXX 386
           DPVIDWLE              DC+LRDGVGYIKDLS++                     
Sbjct: 298 DPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVV--------VPNASLSDIFIID 349

Query: 387 XXPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 443
             PVSYAM+VDNAIQVEGWIS              EA+R++TD+RN+LALK GE AF
Sbjct: 350 NSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLALKSGEHAF 406

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  265 bits (677), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 154/362 (42%), Positives = 201/362 (55%), Gaps = 55/362 (15%)

Query: 108 VIKPLMSLWYVFTFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCN 167
           +IKPL+ LWY+FTFPL +IE+   HT+++ K+                     I+ K   
Sbjct: 58  LIKPLIFLWYIFTFPLLLIEQ---HTNRKYKDTPPL-----------------IDPK--- 94

Query: 168 LNTISETVEDDLNASDEIILQRDNVKGSLLR------AQSVKLRSRSYSKSEVSLTN--- 218
           + + S T  DDLN++DEIILQ D++KGSLL       A +      + S S + +     
Sbjct: 95  IASSSATDLDDLNSNDEIILQTDSIKGSLLEKKNTSAAATPSATPPATSPSPLVIKQKKI 154

Query: 219 -----HSSTNTVFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXX 273
                +S T+   G+K MGRFLFPKKLIP S+L T K+KKL++DLDETLI          
Sbjct: 155 QNKSVYSLTSNFIGSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNISSS 214

Query: 274 XXXQGHLVEVKFGIS------------GIRTLYFIHKRPYCDLFLTKVSKWYELIIFTAS 321
                HL+EVKF                + +LY+++KRPYCD FL  VS WY+LIIFTAS
Sbjct: 215 TISNYHLIEVKFPTPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTAS 274

Query: 322 MKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXX 381
           MKEYADPVIDWLE               C+LRDG+GYIKDLS++                
Sbjct: 275 MKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVL------NTDNQSTLNE 328

Query: 382 XXXXXXXPVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEK 441
                  P+S+AMNVDNAIQV+GWIS              E++R++TDVRNILALK+GE+
Sbjct: 329 LILIDNSPISFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNILALKNGER 388

Query: 442 AF 443
           AF
Sbjct: 389 AF 390

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  251 bits (640), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 145/336 (43%), Positives = 177/336 (52%), Gaps = 60/336 (17%)

Query: 109 IKPLMSLWYVFTFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCNL 168
           +KP   +W+V T PL +IE  +K                            K+ S +   
Sbjct: 61  LKPFHLIWFVITSPLILIEYGLK-------------------------SKQKVESTSRKG 95

Query: 169 NTISETVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFGT 228
             I +   DD  A DE+ LQRD VKG L                             FGT
Sbjct: 96  EIIRKKEVDDDLAEDEMFLQRDTVKGGL-------------------------RGKAFGT 130

Query: 229 KRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS 288
           K+MGRFLFPKKL+P+S+L  ++KK+LV+DLDETLI             QGH+VEV+F  S
Sbjct: 131 KKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPS 190

Query: 289 GIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXX 348
            I TLY++HKRP+CDLFL+KVSKWY+LIIFTASMKEYADPVIDWLE              
Sbjct: 191 SISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRH 250

Query: 349 DCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWISX 408
           +CV+R+GVGYIKDLS++                       P SYA N DNAIQVEGWIS 
Sbjct: 251 NCVVREGVGYIKDLSVV----------TEVLDEVVLIDNSPTSYARNEDNAIQVEGWISD 300

Query: 409 XXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFN 444
                        EA+RY TDVR+IL LK+GEKA  
Sbjct: 301 PSDTDLLNLLPLLEALRYVTDVRSILGLKNGEKALG 336

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  244 bits (622), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 135/336 (40%), Positives = 180/336 (53%), Gaps = 52/336 (15%)

Query: 108 VIKPLMSLWYVFTFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCN 167
           +IKP+  +W+V TFPL++IE    HT  ++                      ++   N  
Sbjct: 68  IIKPIWLIWFVLTFPLNLIE----HTSSKDGSVEEE----------------EVIPTNSQ 107

Query: 168 LNTISETVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFG 227
            +   E +EDD    + ++L  D++K S                                
Sbjct: 108 GSGGGEVIEDDDLVGESMVLHEDSIKSSRPSTSRSSYT---------------------- 145

Query: 228 TKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI 287
           + R+G+FLFPKKLIP+S+L T +KK LV+DLDETLI             QGH+VEV F +
Sbjct: 146 STRLGKFLFPKKLIPQSILQTDRKKVLVLDLDETLIHSMSRSTSSSNTSQGHMVEVTFSV 205

Query: 288 SGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXX 347
           SG+ +LY++HKRPYCDLFL++V KWY+L+IFTASM+EYADPVIDWLE             
Sbjct: 206 SGVSSLYYVHKRPYCDLFLSRVCKWYDLVIFTASMREYADPVIDWLESGISARFTKRKYR 265

Query: 348 XDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
            DC+LRDG+GY+KDL++I                       PVSYAMNVDNAIQVEGWIS
Sbjct: 266 SDCILRDGIGYVKDLTMI----------SKNLQDTIIVDNSPVSYAMNVDNAIQVEGWIS 315

Query: 408 XXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 443
                         E +R++TD RNIL+LK+GE AF
Sbjct: 316 DPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  242 bits (618), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 144/336 (42%), Positives = 188/336 (55%), Gaps = 55/336 (16%)

Query: 108 VIKPLMSLWYVFTFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCN 167
           V+KP++ +W+V TFPLS+IE+        +KE                        +   
Sbjct: 62  VVKPVVLVWFVLTFPLSLIEQ------TSSKEADGAP-----------------GPEAAE 98

Query: 168 LNTISETVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFG 227
              ++E VEDD  A + ++LQ D+VK                       +  S++ + + 
Sbjct: 99  EEQLAEAVEDDDLAGESMVLQEDSVK----------------------SSRPSTSRSSYT 136

Query: 228 TKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI 287
           + R+G+FLFPKKLIP+S+L T +KK LV+DLDETLI             QGH+VEV F  
Sbjct: 137 STRLGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHSMSRSTSSVSNSQGHMVEVTFAA 196

Query: 288 SGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXX 347
           SG+ TLY++HKRPYCDLFL++VSKWY+L+IFTASMKEYADPVIDWLE             
Sbjct: 197 SGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYR 256

Query: 348 XDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
            DC+LRDGVGY+KDLSII                       P+SYAMNVDNAIQVEGWIS
Sbjct: 257 SDCLLRDGVGYVKDLSII----------SKNLQDIIIVDNSPISYAMNVDNAIQVEGWIS 306

Query: 408 XXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAF 443
                         E +R++TD RNIL+LK+GE+AF
Sbjct: 307 DPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  243 bits (620), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 199/365 (54%), Gaps = 59/365 (16%)

Query: 1   MNALKYFSNHLITTKKPRKNHVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDHS 60
           MNAL Y S++LIT   P +     + +Q      +ED  TY   + + C     Q     
Sbjct: 1   MNALSYISSNLIT---PIEEEELPSGSQ------SEDVQTYTNDVSDTCVSSQTQIISKV 51

Query: 61  SDHLKDFNQNEERKLFISAKPKSLRSILKEKIGSIXXXXXXXXXXXXVIKPLMSLWYVFT 120
            D L + NQ     L +   PK L                       ++KP+  LW++ T
Sbjct: 52  EDVLNEDNQRSTLVLVLLFFPKYL-----------------------LVKPIFFLWFLIT 88

Query: 121 FPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCNLNTISETVEDDLN 180
           FP+++ E++ K   K +                         SK+ NLN +   VE+DL+
Sbjct: 89  FPITLFEQKNKKLPKSSANLDTM-------------------SKSKNLNIL---VEEDLS 126

Query: 181 ASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPKKL 240
              EIILQRD + GSLL++++ +  S     ++ S     S++    +K++GRFLFPKKL
Sbjct: 127 GGGEIILQRDTLNGSLLKSRANQQHSHQSRHAKSS-----SSSVGLISKKIGRFLFPKKL 181

Query: 241 IPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKRP 300
           IP+S+L++ +KKKLV+DLDETLI             Q HLVEVKF ISGI TLY++HKRP
Sbjct: 182 IPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRP 241

Query: 301 YCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYIK 360
           YCDLFL+KV +WY+LIIFTASMKEYADPVIDWLE              DC+LRDGVGYIK
Sbjct: 242 YCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIK 301

Query: 361 DLSII 365
           DLSI+
Sbjct: 302 DLSIV 306

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%)

Query: 389 PVSYAMNVDNAIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFNIN 446
           PVSYAMNVDNAIQV+GWIS              E++R +TDVRNIL+LK+GE+AFN+N
Sbjct: 364 PVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFNVN 421

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  193 bits (491), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 169/346 (48%), Gaps = 63/346 (18%)

Query: 108 VIKPLMSLWYVFTFPLSVIERRVKHTDKRNKEXXXXXXXXXXXXXXXXXXXXKINSKNCN 167
           +IKP++++WYV TFPL+++E   +     NK                     + +S+   
Sbjct: 82  LIKPIITIWYVITFPLNLMETNTQG----NK--------------GLIQVGSETDSRTEK 123

Query: 168 LNTISETVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFG 227
           L+     VE+DL+ +DEII+ +D +K   +                              
Sbjct: 124 LS--KYVVEEDLSPTDEIIINQDKMKPRPI------------------------------ 151

Query: 228 TKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQG--------- 278
           T+ +G+F FPKKL+P+S+L +  +K LV+DLDETLI                        
Sbjct: 152 TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMI 211

Query: 279 HLVEVKFGISGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXX 338
           HLVEV+F  + I TLY + KRPYCD+FL + S+WY++ IFTASMKEYADPVIDWL+    
Sbjct: 212 HLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCS 271

Query: 339 XXXXXXXXXXDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDN 398
                     DC LR GVGY+KD+  +                       P+SYAM++DN
Sbjct: 272 VQFHYRWYREDCTLRPGVGYVKDIGTV----ATQIETSRDLSQMIIIDNSPISYAMHLDN 327

Query: 399 AIQVEGWISXXXXXXXXXXXXXXEAMRYSTDVRNILALKHGEKAFN 444
           AIQV GWI+              +AMR+ TD R ILALK G  + +
Sbjct: 328 AIQVHGWINDPSDSELLHLLPLLKAMRHVTDSRCILALKSGRASIS 373

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 53/95 (55%), Gaps = 5/95 (5%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKR 299
           L+P      + KK L++DLDETL+                ++ ++     I  +Y I KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINN----PDFILPIEIEDGQIHNVYVI-KR 355

Query: 300 PYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLE 334
           P  D FL +V KWYE++IFTAS+  YA+P++D L+
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLD 390

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 75/171 (43%), Gaps = 25/171 (14%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS---GIRTLYFI 296
           L+P  +L  Q+KK L++DLDETL+               H  +    +     +  +Y I
Sbjct: 204 LLPPKLLPFQQKKCLILDLDETLVHSSFKYL--------HTADFVLPVEIDDQVHNVYVI 255

Query: 297 HKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGV 356
            KRP  D FL +VS+ YE+++FTAS+  YA+P++D L+               C   +G 
Sbjct: 256 -KRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTIHHRLFREA--CYNYEG- 311

Query: 357 GYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
            YIK+LS I                       P SY  +  +A+ +  W S
Sbjct: 312 NYIKNLSQI----------GRPLSETIILDNSPASYIFHPQHAVPISSWFS 352

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 74/168 (44%), Gaps = 19/168 (11%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKR 299
           L+P  +   Q+KK L++DLDETL+                 VE+      +  +Y I KR
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMHSADFVLP--VEID---DQVHNVYVI-KR 269

Query: 300 PYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYI 359
           P  D FL +VS+ YE+++FTAS+  YA+P++D L+               C   +G  YI
Sbjct: 270 PGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTIHHRLFREA--CYNYEG-NYI 326

Query: 360 KDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           K+LS I                       P SY  +  +A+ +  W S
Sbjct: 327 KNLSQI----------GRPLSETIILDNSPASYIFHPQHAVPISSWFS 364

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 72/173 (41%), Gaps = 28/173 (16%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS-----GIRTLY 294
           L PK  +  + KK LV+DLDETL+               +L    F +       I  +Y
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFK----------YLPNADFNLPVNIDDQIHNVY 381

Query: 295 FIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRD 354
            I KRP  D FL KV K +E++IFTAS+  Y DP++D L+               C   +
Sbjct: 382 VI-KRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLFREA-CYNYE 439

Query: 355 GVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           G  YIK+LS +                       P SY  +  +AI +  W S
Sbjct: 440 G-NYIKNLSQM----------GRPLSEIIILDNSPASYIFHPQHAIPISSWFS 481

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 78/180 (43%), Gaps = 21/180 (11%)

Query: 230 RMGRFLFP--KKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI 287
           + G++  P  K L+P    NT+ KK L++DLDETL+                 VE+   +
Sbjct: 221 QQGQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQV 278

Query: 288 SGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXX 347
             +    ++ KRP  + FL +V K +E+++FTAS+  Y DP++D L+             
Sbjct: 279 HNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDADKVIHHRLFREA 334

Query: 348 XDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
             C   +G  YIK+LS I                       P SY  +  +AI +  W S
Sbjct: 335 --CYNYEG-NYIKNLSQI----------GRPLSDIIILDNSPASYIFHPQHAIPISSWFS 381

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 74/168 (44%), Gaps = 19/168 (11%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKR 299
           L+P  +   Q+KK L++DLDETL+                 VE+   +  +    ++ KR
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 300 PYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYI 359
           P  D FL +VS+ YE+++FTAS+  YA+P++D L+               C   +G  YI
Sbjct: 265 PGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTIHHRLFREA--CYNYEG-NYI 321

Query: 360 KDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           K+LS I                       P SY  +  +A+ +  W S
Sbjct: 322 KNLSQI----------GRPLSETIILDNSPASYIFHPQHAVPISSWFS 359

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 74/171 (43%), Gaps = 25/171 (14%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS---GIRTLYFI 296
           L+P  +   Q+KK L++DLDETL+               H  +    +     +  +Y I
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFKYM--------HTADFVLPVEIDDQVHNVYVI 262

Query: 297 HKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGV 356
            KRP  D FL++V + YE+++FTAS+  YA+P++D L+               C   +G 
Sbjct: 263 -KRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTIHHRLFREA--CYNYEG- 318

Query: 357 GYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
            YIK+LS I                       P SY  +  +A+ +  W S
Sbjct: 319 NYIKNLSQI----------GRPLSETIILDNSPASYIFHPQHAVPISSWFS 359

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 79/185 (42%), Gaps = 31/185 (16%)

Query: 230 RMGRFLFP--KKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI 287
           + G++  P    L+P    +T+ KK L++DLDETL+               +L    F +
Sbjct: 234 QQGQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFK----------YLRSADFVL 283

Query: 288 S-----GIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXX 342
           S      +  +Y I KRP  + FL +V K +E+++FTAS+  Y DP++D L+        
Sbjct: 284 SVEIDDQVHNVYVI-KRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKVIHHR 342

Query: 343 XXXXXXDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQV 402
                  C   +G  YIK+LS I                       P SY  +  +AI +
Sbjct: 343 LFREA--CYNYEG-NYIKNLSQI----------GRPLSDIIILDNSPASYIFHPQHAIPI 389

Query: 403 EGWIS 407
             W S
Sbjct: 390 SSWFS 394

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 72/173 (41%), Gaps = 29/173 (16%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS-----GIRTLY 294
           L+P      + KK LV+DLDETL+               +L    F I       +  +Y
Sbjct: 218 LLPPKDPVFEGKKCLVLDLDETLVHSSFK----------YLRTADFVIPVEIDDQVHNVY 267

Query: 295 FIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRD 354
            I KRP  D FL +V K YE+++FTAS+  Y DP++D L+               C   D
Sbjct: 268 VI-KRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDS--CYNYD 324

Query: 355 GVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           G  YIK+LS I                       P SY ++  +AI +  W S
Sbjct: 325 G-NYIKNLSQI----------GRPLSDLIILDNSPASYILHPQHAIPISSWFS 366

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 70/173 (40%), Gaps = 29/173 (16%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS-----GIRTLY 294
           L+P        +K LV+DLDETL+               +L    F +       I  +Y
Sbjct: 300 LLPPPSKAVSHRKCLVLDLDETLVHSSFK----------YLKSADFVLPVDIDDQIHNVY 349

Query: 295 FIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRD 354
            I KRP  D FL +V K YE+++FTAS+  Y DP++D L+               C   +
Sbjct: 350 VI-KRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKSIHHRLFREA--CYNYE 406

Query: 355 GVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           G  YIK+LS I                       P SY  +  +AI +  W S
Sbjct: 407 G-NYIKNLSQI----------GRPLSNIIILDNSPASYIFHPQHAIPISSWFS 448

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 71/173 (41%), Gaps = 29/173 (16%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS-----GIRTLY 294
           L+P      + KK LV+DLDETL+               +L    F +       +  +Y
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFK----------YLRTADFVLPVNIDDQVHNVY 278

Query: 295 FIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRD 354
            I KRP  D FL +V + YE+++FTAS+  Y DP++D L+               C   +
Sbjct: 279 VI-KRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKSIHHRLFREA--CYNYE 335

Query: 355 GVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           G  YIK+LS I                       P SY  +  +AI V  W S
Sbjct: 336 G-NYIKNLSQI----------GRPLSEIIILDNSPASYIFHPQHAIPVSSWFS 377

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 77/189 (40%), Gaps = 30/189 (15%)

Query: 224 TVFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEV 283
           TV   ++     F   L P++ +    KK L++DLDETL+               +L   
Sbjct: 492 TVLQPQQYHAMGFNTLLPPQNQI-FSGKKCLILDLDETLVHSSFK----------YLTSA 540

Query: 284 KFGIS-----GIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXX 338
            F I       I  +Y I KRP  D FL  VSK +E+++FTAS+  Y DP++D L+    
Sbjct: 541 DFVIPVDIDEQIHNVYVI-KRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLDKHRC 599

Query: 339 XXXXXXXXXXDCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDN 398
                      C   +G  YIK+LS I                       P SY  +  +
Sbjct: 600 IHHRLFREA--CYDYEG-NYIKNLSQI----------GRPLSELIILDNSPASYIFHPQH 646

Query: 399 AIQVEGWIS 407
           AI +  W S
Sbjct: 647 AIPISSWFS 655

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 72/168 (42%), Gaps = 19/168 (11%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKR 299
           L+P    +T+ KK L++DLDETL+                 VE+   +  +    ++ KR
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 300 PYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYI 359
           P  + FL +V K +E+++FTAS+  Y DP++D L+               C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTNKVIHHRLFREA--CYNYEG-NYI 344

Query: 360 KDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           K+LS I                       P SY  +  +AI +  W S
Sbjct: 345 KNLSQI----------GRPLSDIIILDNSPASYIFHPQHAIPISSWFS 382

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 6/95 (6%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKR 299
           L PK +    +KK L++DLDETL+                   +   I       ++ KR
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYVDSADFV------IPVTIDNQTHHVYVIKR 365

Query: 300 PYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLE 334
           P  D FL +VS+ YE+++FTAS+  Y DP+++ L+
Sbjct: 366 PGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILD 400

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 65/159 (40%), Gaps = 19/159 (11%)

Query: 249 QKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKRPYCDLFLTK 308
           + KK LV+DLDETL+                   +   I       ++ KRP  D FL +
Sbjct: 305 KNKKCLVLDLDETLVHSSFKYIDTADFV------LPVTIDDQTHQVYVIKRPGVDEFLKR 358

Query: 309 VSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYIKDLSIIXXX 368
           V K +E+++FTAS+  Y DP++D L+               C + DG  Y+K+LS I   
Sbjct: 359 VGKIFEVVVFTASVSRYGDPLLDILDSSKSIHHRLFRES--CYIYDG-NYVKNLSQI--- 412

Query: 369 XXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
                               P SY  +  +AI +  W S
Sbjct: 413 -------GRPLSDIIILDNSPASYIFHPQHAIPISSWFS 444

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 71/173 (41%), Gaps = 25/173 (14%)

Query: 238 KKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS---GIRTLY 294
           + L+P        KK LV+DLDETL+               H  +    +     I  +Y
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVY 259

Query: 295 FIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRD 354
            I KRP  D FL +V++ YE+++FTAS+  Y DP++D L+               C   +
Sbjct: 260 VI-KRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSIHHRLFREA--CYNYE 316

Query: 355 GVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           G  Y+K+L+ I                       P SY  +  +AI +  W S
Sbjct: 317 G-NYVKNLAQI----------GRPLSEIVILDNSPASYMFHPQHAIPISSWFS 358

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 68/168 (40%), Gaps = 19/168 (11%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKR 299
           L+P    +   KK LV+DLDETL+             +G    +   I       ++ KR
Sbjct: 301 LLPPQSKHLSGKKCLVLDLDETLVHSSFKYL------KGADFVLPVDIDDQIHNVYVMKR 354

Query: 300 PYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYI 359
           P  D FL KV   +E++IFTAS+  Y DP++D L+               C   +G  YI
Sbjct: 355 PGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKHKSVHHRLFREA--CYNYEG-NYI 411

Query: 360 KDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           K+LS I                       P SY  +  +AI +  W S
Sbjct: 412 KNLSQI----------GRPLSEIIILDNSPASYIFHPQHAIPISSWFS 449

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 72/173 (41%), Gaps = 29/173 (16%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS-----GIRTLY 294
           L+P    +  +KK LV+DLDETL+               +L    F +       I  +Y
Sbjct: 302 LLPPPEKSLSRKKCLVLDLDETLVHSSFK----------YLKSADFVLPVDIDDQIHNVY 351

Query: 295 FIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRD 354
            I KRP  D FL +V + +E+++FTAS+  Y DP++D L+               C   +
Sbjct: 352 VI-KRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKGKSIHHRLFREA--CYNYE 408

Query: 355 GVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           G  YIK+LS +                       P SY  +  +AI +  W S
Sbjct: 409 G-NYIKNLSQL----------GRPLSDIIILDNSPASYIFHPQHAIPISSWFS 450

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (51%), Gaps = 16/102 (15%)

Query: 238 KKLIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI-----SGIRT 292
           + L+P       ++K LV+DLDETL+               +L    F I     + +  
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFK----------YLHTADFVIPVEIDNQVHN 358

Query: 293 LYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLE 334
           +Y I KRP  D FL +V + YE+++FTAS+  Y DP++D L+
Sbjct: 359 VYVI-KRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 66/160 (41%), Gaps = 25/160 (15%)

Query: 251 KKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS---GIRTLYFIHKRPYCDLFLT 307
           KK LV+DLDETL+               H  +    +     I  +Y I KRP  D FL 
Sbjct: 277 KKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVYVI-KRPGVDEFLQ 327

Query: 308 KVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYIKDLSIIXX 367
           +V + YE+++FTAS+  Y DP++D L+               C   +G  YIK+LS I  
Sbjct: 328 RVGELYEVVVFTASVSRYGDPLLDVLDKSNNIHHRLFRDA--CYTYEG-NYIKNLSQI-- 382

Query: 368 XXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
                                P SY  +  +AI +  W S
Sbjct: 383 --------GRPLSEIIILDNSPPSYIFHPQHAIPISSWFS 414

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 76/173 (43%), Gaps = 30/173 (17%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI-----SGIRTLY 294
           L+PK+ +  + KK LV+DLDETL+               +L    F I     + +  +Y
Sbjct: 234 LLPKADM-FKGKKCLVLDLDETLVHSSFK----------YLRTADFVIPVEIDNQVHNVY 282

Query: 295 FIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRD 354
            I KRP  D FL ++++ YE+++FTAS+  Y DP++D L+               C   +
Sbjct: 283 VI-KRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTIHHRLFRDS--CYNYE 339

Query: 355 GVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           G  YIK+LS I                       P SY  +  +AI +  W S
Sbjct: 340 G-NYIKNLSQI----------GRPLSDMIILDNSPASYIFHPQHAIPISSWFS 381

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 70/168 (41%), Gaps = 19/168 (11%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKR 299
           L+P        KK LV+DLDETL+                ++ V+   + +  +Y I KR
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTADF----VIPVEID-NQVHNVYVI-KR 281

Query: 300 PYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYI 359
           P  D FL  V + YE+++FTAS+  Y DP++D L+               C   DG  YI
Sbjct: 282 PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHCIHHRLFRDS--CYNYDG-NYI 338

Query: 360 KDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           K+LS I                       P SY  +  +AI +  W S
Sbjct: 339 KNLSQI----------GRPLSDLIILDNSPASYIFHPQHAIPISSWFS 376

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 69/173 (39%), Gaps = 29/173 (16%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS-----GIRTLY 294
           L+P        KK LV+DLDETL+               +L    F +       I  +Y
Sbjct: 272 LLPPRAPAFNGKKCLVLDLDETLVHSSFK----------YLRTADFVLPVDIDDQIHNVY 321

Query: 295 FIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRD 354
            I KRP  D FL +V   YE+++FTAS+  Y DP++D L+               C   +
Sbjct: 322 VI-KRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKHKTIHHRLFRES--CYNYE 378

Query: 355 GVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           G  YIK+LS I                       P SY  +  +AI +  W S
Sbjct: 379 G-NYIKNLSQI----------GRPLSDIIILDNSPASYIFHPQHAIPISSWFS 420

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 71/168 (42%), Gaps = 19/168 (11%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKR 299
           L+P    + + KK L++DLDETL+                 VE+   +  +    ++ KR
Sbjct: 234 LLPPPDKSIKDKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 300 PYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYI 359
           P  + FL +V K +E+++FTAS+  Y DP++D L+               C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKVIHHRLFREA--CYNYEG-NYI 344

Query: 360 KDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           K+LS I                       P SY  +  +AI +  W S
Sbjct: 345 KNLSQI----------GRPLSEIIILDNSPASYIFHPQHAIPISSWFS 382

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 53/95 (55%), Gaps = 6/95 (6%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKR 299
           L+P    + Q +K LV+DLDETL+                 ++ +F     + +Y I KR
Sbjct: 168 LLPPIQQSLQNRKCLVLDLDETLVHSSFKYVSTADFVLPVDIDDQF-----QNVYVI-KR 221

Query: 300 PYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLE 334
           P  D FL   SK +E++IFTAS+++Y +P++D L+
Sbjct: 222 PGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILD 256

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 67/157 (42%), Gaps = 19/157 (12%)

Query: 251 KKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKRPYCDLFLTKVS 310
           KK LV+DLDETL+                ++ V+   + I  +Y I KRP  D FL  V 
Sbjct: 240 KKCLVLDLDETLVHSSFKFLRTADF----VIPVEID-NQIHNVYVI-KRPGVDEFLKLVG 293

Query: 311 KWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYIKDLSIIXXXXX 370
           + YE+++FTAS+  Y DP++D L+               C   DG  YIK+LS I     
Sbjct: 294 QLYEVVVFTASVSRYGDPLLDVLDQTQCIHHRLFRDS--CYNYDG-NYIKNLSQI----- 345

Query: 371 XXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
                             P SY  +  +AI +  W S
Sbjct: 346 -----GRPLSDLIILDNSPASYIFHPQHAIPISSWFS 377

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 67/157 (42%), Gaps = 19/157 (12%)

Query: 251 KKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKRPYCDLFLTKVS 310
           KK LV+DLDETL+                 VE++  I  +    ++ KRP  D FL +V 
Sbjct: 228 KKCLVLDLDETLVHSSFKYVRTADFVLP--VEIEDQIHNV----YVIKRPGVDEFLKRVG 281

Query: 311 KWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYIKDLSIIXXXXX 370
           + YE+++FTAS+  Y DP+++ L+               C   +G  YIK+L+ I     
Sbjct: 282 ELYEVVVFTASVSRYGDPLLNILDQSNSVHHRLFREA--CYNYEG-NYIKNLAQI----- 333

Query: 371 XXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
                             P SY  +  +AI +  W S
Sbjct: 334 -----GRPLSDIIILDNSPASYMFHPQHAIPISSWFS 365

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 16/100 (16%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGI-----SGIRTLY 294
           L+P      + +K LV+DLDETL+               +L    F I     + +  +Y
Sbjct: 297 LLPPQRPEFRGRKCLVLDLDETLVHSSFK----------YLHTADFVIPVEIDNQVHNVY 346

Query: 295 FIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLE 334
            I KRP  D FL +V + +E+++FTAS+  Y DP++D L+
Sbjct: 347 VI-KRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 71/173 (41%), Gaps = 28/173 (16%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGIS-----GIRTLY 294
           L PK+      KK LV+DLDETL+               +L    F +       I  +Y
Sbjct: 291 LPPKTEKKLIGKKCLVLDLDETLVHSSFK----------YLQTADFVLPVNIDEQIHNVY 340

Query: 295 FIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRD 354
            I KRP  + FL +V + +E+++FTAS+  Y DP++D L+               C   +
Sbjct: 341 VI-KRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLFREA-CYNYE 398

Query: 355 GVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           G  YIK+LS +                       P SY  +  +AI +  W S
Sbjct: 399 G-NYIKNLSQM----------GRPLSEIIILDNSPASYIFHPQHAIPISSWFS 440

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 68/168 (40%), Gaps = 19/168 (11%)

Query: 240 LIPKSVLNTQKKKKLVIDLDETLIXXXXXXXXXXXXXQGHLVEVKFGISGIRTLYFIHKR 299
           L+P        +K LV+DLDETL+                 V++   +  +    ++ KR
Sbjct: 271 LLPPIEKKFADRKCLVLDLDETLVHSSFKYLNIADFVLP--VDIDNQVQNV----YVSKR 324

Query: 300 PYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGYI 359
           P  D FL  V   YE+I+FTAS+  Y +P++D L+               C + +G  Y+
Sbjct: 325 PGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDPHKYIHHRLFRDS--CYVYEG-NYV 381

Query: 360 KDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGWIS 407
           K+LS I                       P SY  +  +AI +  W S
Sbjct: 382 KNLSQI----------GRPLGDIIILDNSPASYIFHPQHAIPISSWFS 419

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 12/108 (11%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP  D FL  +S++YE+++F+++   Y+D + + L+               CV +DGV 
Sbjct: 217 KRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEH-CVYKDGV- 274

Query: 358 YIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
           +IKDLS +                       P SY +  +NAI +E W
Sbjct: 275 HIKDLSKL----------NRDLSKVIIIDTDPNSYKLQPENAIPMEPW 312

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 51/108 (47%), Gaps = 12/108 (11%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP CD FL  +S++YE+++F+++   YA+ + + L+               CV +DGV 
Sbjct: 208 KRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFVSYNLFKEH-CVYKDGV- 265

Query: 358 YIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
           +IKD+S +                       P +Y +  +NAI ++ W
Sbjct: 266 HIKDISKL----------NRDLGKVVTIDTDPNTYKLQPENAIPMDPW 303

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP CD FL  +S++YE+++F+++   Y+D + + L+               CV +DG+ 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLDPIHAFISYNLFKEH-CVYKDGI- 278

Query: 358 YIKDLS 363
           +IKD+S
Sbjct: 279 HIKDIS 284

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 16/117 (13%)

Query: 289 GIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXX 348
           G RT     KRP  D FL  +S++YE+++F+++   YA+ V + ++              
Sbjct: 211 GWRTA----KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMDPIHAFVTYNLYKEH 266

Query: 349 DCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
            C+ +DGV +IKDLS +                       P SY +  +NAI V+ W
Sbjct: 267 -CLYKDGV-HIKDLSKL----------NRDLGKTMIIDTDPNSYKLQPENAIPVKPW 311

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 12/108 (11%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP  D FL  +S+++E+++F+++   Y+D + + L+               CV +DGV 
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEH-CVYKDGV- 274

Query: 358 YIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
           +IKDLS +                       P SY +  +NAI ++ W
Sbjct: 275 HIKDLSKL----------NRDLSKVIIIDTEPNSYKLQPENAIPMDPW 312

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 12/108 (11%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP  D FL  +S+++E+++F+++   Y++ + + L+               CV +DGV 
Sbjct: 222 KRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEH-CVYKDGV- 279

Query: 358 YIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
           +IKDLS +                       P SY +  +NAI +E W
Sbjct: 280 HIKDLSKL----------NRDLSKVIIIDTDPNSYKLQPENAIPMEPW 317

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 49/108 (45%), Gaps = 12/108 (11%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP  D FL  +S++YE+++F+++   Y + + + L+               CV +DGV 
Sbjct: 236 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAFISYSLFKEH-CVYKDGV- 293

Query: 358 YIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
           +IKDLS +                       P +Y +  +NAI +E W
Sbjct: 294 HIKDLSKL----------NRDVNKVLIIDTDPNNYKLQPENAIPMEPW 331

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 12/108 (11%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP  D FL  +S++YE+++F+++   Y+D + + L+               C+ +DGV 
Sbjct: 221 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLDPIHAFVSYNLFKEH-CLYKDGV- 278

Query: 358 YIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
           +IKDLS +                       P SY +  +NAI ++ W
Sbjct: 279 HIKDLSKL----------NRDEKKVLIIDVDPNSYKLQPENAIPMKPW 316

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 12/108 (11%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP  D FL  +S++YE+++F+++   Y+D V + L+               C+ +DGV 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLDPIHAFITYNLFKEH-CLYKDGV- 269

Query: 358 YIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
           +IKDLS +                       P +Y +  +NAI ++ W
Sbjct: 270 HIKDLSKL----------NRDLGKTVIIDCDPNAYKLQPENAIPMKPW 307

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP  D FL  +S++YE+++F+++   YA+ + + ++               CV +DGV 
Sbjct: 223 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMDPIHAFISYNLFKEH-CVYKDGV- 280

Query: 358 YIKDLS 363
           +IKDLS
Sbjct: 281 HIKDLS 286

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 288 SGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXX 347
           SG RT     KRP  D FL  +S++YE+++F+++   YA+ + + L+             
Sbjct: 214 SGWRT----AKRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKE 269

Query: 348 XDCVLRDGVGYIKDLS 363
             C+ +DGV +IKDLS
Sbjct: 270 H-CLYKDGV-HIKDLS 283

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 49/108 (45%), Gaps = 12/108 (11%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP  D FL  +S++YE+++F+++   Y + + + L+               CV +DGV 
Sbjct: 228 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAFISYNLFKEH-CVYKDGV- 285

Query: 358 YIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
           +IKDLS +                       P +Y +  +NAI V+ W
Sbjct: 286 HIKDLSKL----------NRDVNKVLIIDTEPNNYKLQPENAIPVKPW 323

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP  D FL  +S++YE+++F+++   Y+D V + L+               C+ +DGV 
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLDPIHAFITYNLFKEH-CLYKDGV- 270

Query: 358 YIKDLS 363
           +IKDLS
Sbjct: 271 HIKDLS 276

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 12/108 (11%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP  + FL  +S++YE+++F+++   Y++   + L+               CV +DGV 
Sbjct: 220 KRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAFVSYNLFKEH-CVYKDGV- 277

Query: 358 YIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
           +IKDLS +                       P SY +  +NAI ++ W
Sbjct: 278 HIKDLSKL----------KRDLSKVIIIDTDPNSYKLQPENAIPMDPW 315

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 52/117 (44%), Gaps = 16/117 (13%)

Query: 289 GIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXX 348
           G RT     KRP  D FL  +S++YE+++F+++   Y++ + + L+              
Sbjct: 221 GWRTA----KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLDPIHAFISYNLYKEH 276

Query: 349 DCVLRDGVGYIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
            CV ++G  +IKDLS +                       P SY +  +NAI ++ W
Sbjct: 277 -CVYKEG-DHIKDLSKL----------NRDLGKVIIVDTDPASYKLQPENAIPMQPW 321

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 37.0 bits (84), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP  D FL  +S++YE+++F+++   +++ + + L+               CV +DG+ 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLDPIHAFITYNLFKEH-CVYKDGI- 284

Query: 358 YIKDLS 363
           +IKDLS
Sbjct: 285 HIKDLS 290

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 48/108 (44%), Gaps = 12/108 (11%)

Query: 298 KRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVG 357
           KRP  D FL  +S++YE+++F+++   Y++ + + L+               CV ++G  
Sbjct: 217 KRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLYKEH-CVYKEGT- 274

Query: 358 YIKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
           +IKDLS +                       P +Y    +NAI V+ W
Sbjct: 275 HIKDLSKL----------NRDLDKVLIIDCDPNNYKFQPENAIPVKPW 312

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 291 RTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDC 350
           +T +   KRP  D FL  +S++YE+++F+++   Y++ + + L+               C
Sbjct: 204 KTGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSERIAEKLDPLHAFISYNLFKEH-C 262

Query: 351 VLRDGVGYIKDLS 363
           V +D V +IKDLS
Sbjct: 263 VYKDHV-HIKDLS 274

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 6/76 (7%)

Query: 288 SGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXX 347
           +G RT     KRP  D FL  +S++YE+++F+++   Y++ + + L+             
Sbjct: 185 NGWRTA----KRPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDPIHAFISYNLFKE 240

Query: 348 XDCVLRDGVGYIKDLS 363
             CV + G  +IKDLS
Sbjct: 241 H-CVYKKG-KHIKDLS 254

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 44/107 (41%), Gaps = 12/107 (11%)

Query: 299 RPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLEXXXXXXXXXXXXXXDCVLRDGVGY 358
           RP  D  L  +S +YE ++F ++   Y+  V++ L+               CV +DG+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLDPIRAFITYNLFKDH-CVYKDGI-H 274

Query: 359 IKDLSIIXXXXXXXXXXXXXXXXXXXXXXXPVSYAMNVDNAIQVEGW 405
           IKDLS +                       P S  + ++NAI  E W
Sbjct: 275 IKDLSHL----------NRDLGKTLIIDTDPNSVKLQMENAILAEPW 311

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 6   YFSNHLITTKKPRKNHVEVTNNQDILD-TSNEDSNTYATHIE 46
           Y SN   T+K+P+K HV+  N   ILD TS +D      H++
Sbjct: 675 YGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVD 716

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 7/83 (8%)

Query: 167 NLNTISETVEDDLNASDE-IILQRD---NVKGSLLRAQSVKLRSRSYSKSEVSLTNH-SS 221
           NL + S  ++D L +S+E   L  D      GSL R +  K  + S+ +SE+S+ N  S 
Sbjct: 294 NLFSHSRYMQDSLTSSEESFALMSDFSATSAGSLARHRFAKSFTDSFERSEISMNNSISE 353

Query: 222 TNTVFGTKRMGRFLFPKKLIPKS 244
              +  + R G  +  KKL+P++
Sbjct: 354 ECNMLSSNRFGGII--KKLLPRA 374

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,632,375
Number of extensions: 1391237
Number of successful extensions: 6875
Number of sequences better than 10.0: 102
Number of HSP's gapped: 7013
Number of HSP's successfully gapped: 105
Length of query: 446
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 333
Effective length of database: 40,524,141
Effective search space: 13494538953
Effective search space used: 13494538953
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)