Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_8.1952.152ON63563530350.0
YHR117W (TOM71)2.152ON63963926030.0
Skud_8.1782.152ON63863825210.0
Suva_15.3142.152ON64464424020.0
ZYRO0G06512g2.152ON60453215690.0
NCAS0B070102.152ON62553515660.0
Kpol_1048.212.152ON59753315460.0
CAGL0L12936g2.152ON60053615390.0
SAKL0E10956g2.152ON60053415290.0
TDEL0B051402.152ON59953315230.0
KLTH0B05170g2.152ON59353215060.0
KNAG0H035302.152ON61454015040.0
Kwal_33.147672.152ON59453214970.0
Skud_14.2112.152ON61755014820.0
Smik_14.2072.152ON61755014700.0
YNL121C (TOM70)2.152ON61755014660.0
Suva_14.2192.152ON61755014630.0
TBLA0C055302.152ON61053414490.0
Ecym_82042.152ON59753314360.0
KAFR0F007202.152ON60853314240.0
TPHA0I015102.152ON60353314150.0
ABR131W2.152ON59453314010.0
KLLA0F24046g2.152ON60453213700.0
NCAS0G024802.152ON59652913650.0
NDAI0B043402.152ON66454113011e-171
CAGL0L04048g2.152ON58753412791e-169
NDAI0F028102.152ON60953112651e-167
NDAI0B057903.481ON523951546e-10
Kpol_505.413.481ON513951529e-10
NCAS0G008105.617ON584901511e-09
Ecym_30256.21ON3181011436e-09
KLTH0F14542g3.481ON513951466e-09
SAKL0G07084g5.617ON585901466e-09
SAKL0F03102g3.481ON5131521457e-09
Kpol_1032.86.21ON3431061392e-08
AEL224W5.617ON580921413e-08
Ecym_44133.481ON510951394e-08
NDAI0F009105.617ON583891386e-08
KLLA0A07062g5.617ON581901377e-08
ACR005W6.21ON3271201348e-08
TBLA0E033005.617ON582901369e-08
Kwal_55.199355.617ON593901351e-07
Suva_8.805.617ON586901342e-07
CAGL0D05060g3.481ON5101691332e-07
KAFR0B066103.481ON5112081322e-07
Suva_7.4083.481ON513951322e-07
TDEL0D055003.481ON5121011313e-07
KAFR0L004106.21ON3311011294e-07
KLLA0D01155g6.21ON335681285e-07
NCAS0F034903.481ON512951297e-07
YGR123C (PPT1)3.481ON513951287e-07
SAKL0E01210g6.21ON3231011268e-07
Smik_6.2153.481ON513951289e-07
Kwal_55.211753.481ON511951271e-06
CAGL0H08195g5.617ON583921271e-06
KLLA0B10912g3.481ON512951261e-06
YOR027W (STI1)5.617ON589901262e-06
TPHA0J003406.21ON3381061242e-06
KNAG0B032005.617ON579901252e-06
Smik_15.2055.617ON589901242e-06
TBLA0C039503.481ON512951243e-06
KNAG0A079003.481ON5121491243e-06
AAR083C3.481ON5381781233e-06
TPHA0D028805.617ON585891216e-06
Skud_15.1925.617ON589921216e-06
Ecym_55825.617ON584921217e-06
Skud_7.4323.481ON513951199e-06
TDEL0G044806.21ON3431071162e-05
NCAS0H008306.21ON3381011143e-05
ZYRO0B04224g3.481ON513951135e-05
TDEL0A048405.617ON576921135e-05
TPHA0D032203.481ON513951135e-05
ZYRO0A05676g5.617ON572901135e-05
Kpol_1018.695.617ON590901127e-05
KLTH0E02178g5.617ON593901119e-05
TBLA0A072706.21ON373891091e-04
KAFR0C058905.617ON575901101e-04
SAKL0A01672g6.328ON128681021e-04
TBLA0G010506.21ON350741082e-04
NDAI0D008106.21ON349951082e-04
Kpol_1037.266.21ON3421011082e-04
KAFR0B002507.546ON1420641092e-04
TBLA0I023106.328ON11662992e-04
ZYRO0F08624g8.506ON3791391072e-04
CAGL0E02739g6.21ON343801062e-04
Kwal_56.224336.21ON322951063e-04
TPHA0D038606.328ON12073993e-04
KNAG0I025206.328ON11789993e-04
KNAG0M011706.21ON3391071045e-04
NDAI0I004406.328ON12867975e-04
Smik_4.4918.470ON612881056e-04
YDR244W (PEX5)8.470ON612881046e-04
KLTH0C11220g6.21ON3271501036e-04
KAFR0J025706.328ON12144959e-04
KLLA0C08910g6.328ON11544950.001
CAGL0G10087g7.546ON1411821030.001
Ecym_20906.328ON17264970.001
Kpol_1028.516.328ON11773940.001
NCAS0A153007.546ON1398721020.001
KLLA0B09966g8.506ON370931000.001
TDEL0H002507.546ON1397821010.002
Suva_2.4108.470ON61189990.002
Skud_4.5068.470ON61188990.003
Suva_16.5217.546ON142472990.003
Kwal_23.54087.546ON1410419990.003
ZYRO0C07788g6.21ON334104960.004
NDAI0J001307.546ON140393980.004
Suva_15.1826.21ON346107960.004
Kpol_1006.43.367ON732162970.005
NDAI0A051003.367ON1007133970.005
TPHA0A052905.72ON666125950.007
Smik_16.4537.546ON1417102960.007
NCAS0B024008.506ON380109940.008
KLLA0C15455g8.470ON56692950.008
Kpol_513.28.506ON37492940.008
TBLA0B049907.546ON141082940.011
CAGL0K11209g8.470ON59096930.012
TBLA0A016908.470ON662128930.012
TPHA0M002706.21ON37789930.012
AAR054C6.328ON13362870.013
TBLA0H033808.506ON37592920.014
Kpol_1050.825.72ON639125930.015
KNAG0H006103.367ON973135930.016
Skud_16.4937.546ON142572920.018
NCAS0A112003.367ON907125920.019
YOR007C (SGT2)6.21ON346107910.020
Kpol_1050.1127.546ON136072920.020
Kwal_27.118908.506ON334128900.021
Skud_15.1686.21ON348101900.021
Skud_3.1356.328ON11869850.023
Smik_2.2958.506ON38592900.024
NDAI0I022406.21ON35089890.028
YPR189W (SKI3)7.546ON143272910.028
TDEL0A074306.328ON12444840.030
TPHA0E007407.412ON746160900.031
YKL022C (CDC16)2.665ON84091900.033
YBR155W (CNS1)8.506ON385114890.035
YCR060W (TAH1)6.328ON11158820.039
CAGL0D01364g3.367ON1148135890.041
TDEL0B013108.506ON380124880.041
Ecym_28207.546ON139878890.049
NDAI0E040407.412ON783160880.053
Smik_15.1766.21ON345107870.054
KNAG0A041208.470ON60282880.055
TDEL0B016608.470ON549128870.063
Kpol_1031.648.470ON60788870.063
Smik_11.2322.665ON79391870.072
NDAI0G037103.5ON112199870.078
KNAG0A039508.506ON386109860.078
SAKL0F16236g7.546ON140850870.088
ZYRO0C16522g3.367ON974135860.089
Skud_2.2828.506ON38579850.097
NCAS0F028705.352ON70071860.10
AGL268C8.506ON379109850.11
KLTH0A00638g7.546ON1411214860.11
Skud_11.2062.665ON80285850.11
NCAS0A00490singletonON62072850.11
NDAI0C052908.506ON37993850.12
AFR453W8.470ON56999840.14
KAFR0H008703.367ON88773850.15
Smik_2.2543.367ON1020117840.17
AEL281C7.546ON139082840.17
KLTH0E10934g8.470ON56889840.17
TBLA0H015203.367ON68983830.21
NCAS0D045006.328ON12171780.21
Suva_4.3613.367ON963119830.22
NCAS0B025608.470ON57882820.25
YBR112C (CYC8)3.367ON966125830.26
NDAI0J007107.458ON33549810.26
KAFR0E029808.506ON38092810.27
CAGL0L09823g2.665ON74364820.30
KLLA0B09262g3.367ON94173820.31
Kwal_23.36703.367ON802135810.34
Skud_2.2403.367ON984127810.38
NDAI0C051308.470ON59077810.39
TBLA0D004607.412ON835109810.40
CAGL0K09240g6.328ON14271760.40
Kwal_27.107407.412ON628226810.41
Suva_3.956.328ON11170750.41
KAFR0D023405.689ON69744810.41
CAGL0H07425g8.506ON38093800.41
KNAG0F040107.546ON141861810.46
Kpol_1018.1067.412ON753170800.49
TDEL0C050903.367ON759135800.51
Suva_4.4058.506ON38595790.54
TDEL0E027505.352ON56488790.61
Ecym_34593.367ON111573790.61
Kwal_27.117378.470ON57589790.63
CAGL0A03630g1.88ON106281790.65
Ecym_13968.470ON57378790.68
ZYRO0A02926g8.470ON577133790.68
SAKL0H11946g8.470ON57389790.69
Kpol_1057.142.665ON72460790.71
Smik_3.1596.328ON11567730.76
TPHA0M016303.367ON104370780.83
KAFR0L018707.412ON71287780.86
KLTH0F10428g3.367ON79573780.86
SAKL0B07986g3.367ON88063780.94
TDEL0B023305.689ON70235780.95
Suva_11.2042.665ON79391780.95
KNAG0B022407.412ON739220771.1
ADL344W3.367ON910125771.2
SAKL0H10934g8.506ON380120761.2
Kwal_33.134281.88ON1052110771.3
TPHA0E011105.352ON69372771.3
Kpol_172.23.367ON41881761.3
Ecym_25598.506ON370126761.4
CAGL0C01903g7.412ON769171761.5
TDEL0G009605.72ON62287761.6
TPHA0L012108.470ON58878761.6
NCAS0E024907.412ON809145761.6
ZYRO0D00572g2.665ON78556761.7
KLLA0B03520g7.546ON140169761.8
KAFR0C018505.352ON646104751.9
KNAG0C055005.352ON585122752.1
Kwal_55.21197singletonOFF11473702.1
KLTH0E11748g8.506ON378109742.1
Suva_8.1295.689ON74135752.2
TBLA0F012303.367ON1189114752.3
ZYRO0D00836g7.546ON140177752.3
YBL084C (CDC27)7.412ON758209742.3
TDEL0C027207.412ON700165742.4
ACR168W2.665ON70755742.6
KLLA0E20857g7.412ON710192733.0
Smik_4.5795.352ON667112733.1
Smik_2.367.412ON751209733.2
Kpol_1028.1017.469ON38757733.2
Suva_2.347.412ON763209733.8
KLLA0A05258g5.72ON632100723.8
SAKL0F12936g7.412ON632213723.8
TBLA0F009003.153ON85386724.1
TPHA0L014208.506ON374107724.2
TBLA0C010102.665ON86470715.6
Kpol_339.135.352ON68672707.7
TPHA0M003703.153ON83856708.0
Kpol_1032.153.153ON84686708.3
NCAS0D013905.72ON63193708.3
ABR206W5.72ON614118699.1
Ecym_50925.72ON626118699.3
Smik_11.2622.517ON182119679.5
KLTH0F09020g8.372ON250177689.7
TBLA0F028207.498ON721666910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_8.195
         (635 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...  1173   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...  1007   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   975   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   929   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   608   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   607   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   600   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   597   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   593   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   591   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   584   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   583   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   581   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   575   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   570   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   569   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   568   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   562   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   557   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   553   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   549   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   544   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   532   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   530   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   505   e-171
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   497   e-169
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   491   e-167
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    64   6e-10
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    63   9e-10
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    63   1e-09
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    60   6e-09
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    61   6e-09
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    61   6e-09
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    60   7e-09
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    58   2e-08
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    59   3e-08
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    58   4e-08
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     58   6e-08
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    57   7e-08
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    56   8e-08
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    57   9e-08
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    57   1e-07
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    56   2e-07
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    56   2e-07
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    55   2e-07
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    55   2e-07
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    55   3e-07
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    54   4e-07
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    54   5e-07
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    54   7e-07
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    54   7e-07
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    53   8e-07
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    54   9e-07
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    54   1e-06
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    54   1e-06
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    53   1e-06
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    53   2e-06
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    52   2e-06
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    53   2e-06
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    52   2e-06
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    52   3e-06
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    52   3e-06
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    52   3e-06
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    51   6e-06
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    51   6e-06
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    51   7e-06
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    50   9e-06
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    49   2e-05
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    49   3e-05
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    48   5e-05
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    48   5e-05
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    48   5e-05
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    48   5e-05
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    48   7e-05
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    47   9e-05
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    47   1e-04
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    47   1e-04
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    44   1e-04
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    46   2e-04
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    46   2e-04
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    46   2e-04
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    47   2e-04
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    43   2e-04
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    46   2e-04
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    45   2e-04
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    45   3e-04
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    43   3e-04
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    43   3e-04
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    45   5e-04
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    42   5e-04
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    45   6e-04
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    45   6e-04
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    44   6e-04
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    41   9e-04
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    41   0.001
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    44   0.001
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    42   0.001
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    41   0.001
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            44   0.001
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    43   0.001
TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON...    44   0.002
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    43   0.002
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    43   0.003
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    43   0.003
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    43   0.003
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    42   0.004
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    42   0.004
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    42   0.004
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    42   0.005
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    42   0.005
TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa] ...    41   0.007
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    42   0.007
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    41   0.008
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    41   0.008
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    41   0.008
TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_...    41   0.011
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    40   0.012
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    40   0.012
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    40   0.012
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    38   0.013
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    40   0.014
Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa] ...    40   0.015
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    40   0.016
Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR18...    40   0.018
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    40   0.019
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    40   0.020
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    40   0.020
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    39   0.021
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    39   0.021
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    37   0.023
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.024
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    39   0.028
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    40   0.028
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    37   0.030
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    39   0.031
YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON} ...    39   0.033
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    39   0.035
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    36   0.039
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    39   0.041
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    39   0.041
Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} simila...    39   0.049
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    39   0.053
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    38   0.054
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    39   0.055
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    38   0.063
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    38   0.063
Smik_11.232 Chr11 complement(381701..384082) [2382 bp, 793 aa] {...    38   0.072
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    38   0.078
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    38   0.078
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    38   0.088
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    38   0.089
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    37   0.097
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    38   0.10 
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    37   0.11 
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    38   0.11 
Skud_11.206 Chr11 complement(375601..378009) [2409 bp, 802 aa] {...    37   0.11 
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       37   0.11 
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    37   0.12 
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    37   0.14 
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    37   0.15 
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    37   0.17 
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    37   0.17 
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    37   0.17 
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    37   0.21 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    35   0.21 
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    37   0.22 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    36   0.25 
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    37   0.26 
NDAI0J00710 Chr10 (150941..151948) [1008 bp, 335 aa] {ON} Anc_7....    36   0.26 
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    36   0.27 
CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} som...    36   0.30 
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    36   0.31 
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    36   0.34 
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    36   0.38 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    36   0.39 
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    36   0.40 
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    34   0.40 
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    36   0.41 
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    33   0.41 
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    36   0.41 
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    35   0.41 
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    36   0.46 
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    35   0.49 
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    35   0.51 
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.54 
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    35   0.61 
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    35   0.61 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    35   0.63 
CAGL0A03630g Chr1 complement(369404..372592) [3189 bp, 1062 aa] ...    35   0.65 
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    35   0.68 
ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {...    35   0.68 
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    35   0.69 
Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON} (25908....    35   0.71 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    33   0.76 
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    35   0.83 
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    35   0.86 
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    35   0.86 
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    35   0.94 
TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {O...    35   0.95 
Suva_11.204 Chr11 complement(378512..380893) [2382 bp, 793 aa] {...    35   0.95 
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    34   1.1  
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    34   1.2  
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    34   1.2  
Kwal_33.13428 s33 complement(219925..223083) [3159 bp, 1052 aa] ...    34   1.3  
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    34   1.3  
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    34   1.3  
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    34   1.4  
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    34   1.5  
TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.7...    34   1.6  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    34   1.6  
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    34   1.6  
ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp...    34   1.7  
KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} simil...    34   1.8  
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    33   1.9  
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    33   2.1  
Kwal_55.21197 s55 (726765..727109) [345 bp, 114 aa] {OFF} [conti...    32   2.1  
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    33   2.1  
Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W ...    33   2.2  
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    33   2.3  
ZYRO0D00836g Chr4 complement(62421..66626) [4206 bp, 1401 aa] {O...    33   2.3  
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    33   2.3  
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    33   2.4  
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    33   2.6  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    33   3.0  
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    33   3.1  
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    33   3.2  
Kpol_1028.101 s1028 complement(221597..222760) [1164 bp, 387 aa]...    33   3.2  
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    33   3.8  
KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} simila...    32   3.8  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    32   3.8  
TBLA0F00900 Chr6 (227895..230456) [2562 bp, 853 aa] {ON} Anc_3.1...    32   4.1  
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    32   4.2  
TBLA0C01010 Chr3 (198773..201367) [2595 bp, 864 aa] {ON} Anc_2.6...    32   5.6  
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    32   7.7  
TPHA0M00370 Chr13 (72373..74889) [2517 bp, 838 aa] {ON} Anc_3.15...    32   8.0  
Kpol_1032.15 s1032 (38837..41377) [2541 bp, 846 aa] {ON} (38837....    32   8.3  
NCAS0D01390 Chr4 (251721..253616) [1896 bp, 631 aa] {ON} Anc_5.72      32   8.3  
ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic ho...    31   9.1  
Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}...    31   9.3  
Smik_11.262 Chr11 (438440..438988) [549 bp, 182 aa] {ON} YKR007W...    30   9.5  
KLTH0F09020g Chr6 complement(775420..776130,776219..776260) [753...    31   9.7  
TBLA0F02820 Chr6 complement(678658..680823) [2166 bp, 721 aa] {O...    31   10.0 

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 1173 bits (3035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/635 (91%), Positives = 581/635 (91%)

Query: 1   MAENSLFRFIARNKVAILXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSKDHRRQSEASTN 60
           MAENSLFRFIARNKVAIL                            GSKDHRRQSEASTN
Sbjct: 1   MAENSLFRFIARNKVAILATVSAGTAAVGAYVYYQQLKQQQQQHLKGSKDHRRQSEASTN 60

Query: 61  LKEDEVGLXXXXXXXXXXXXXXXXXXXXXXXXXXEDFQCTFLPNGEPDISQLKGLTLSQK 120
           LKEDEVGL                          EDFQCTFLPNGEPDISQLKGLTLSQK
Sbjct: 61  LKEDEVGLKNKSSIANENKKKKNKRKRKNRAKSAEDFQCTFLPNGEPDISQLKGLTLSQK 120

Query: 121 QTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEY 180
           QTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEY
Sbjct: 121 QTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEY 180

Query: 181 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQ 240
           TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQ
Sbjct: 181 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQ 240

Query: 241 AMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVNNSSHFDTAYALLSDALQ 300
           AMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVNNSSHFDTAYALLSDALQ
Sbjct: 241 AMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVNNSSHFDTAYALLSDALQ 300

Query: 301 KLYSATNEGYLTADKLFTSATDAYHSLLASQVDGPLKENAALAFCYTGIFHFLKNNLLGA 360
           KLYSATNEGYLTADKLFTSATDAYHSLLASQVDGPLKENAALAFCYTGIFHFLKNNLLGA
Sbjct: 301 KLYSATNEGYLTADKLFTSATDAYHSLLASQVDGPLKENAALAFCYTGIFHFLKNNLLGA 360

Query: 361 QALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFI 420
           QALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFI
Sbjct: 361 QALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFI 420

Query: 421 LQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLPEVPA 480
           LQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLPEVPA
Sbjct: 421 LQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLPEVPA 480

Query: 481 FFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEE 540
           FFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEE
Sbjct: 481 FFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEE 540

Query: 541 KFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSAILARTMDEKLQAT 600
           KFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSAILARTMDEKLQAT
Sbjct: 541 KFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSAILARTMDEKLQAT 600

Query: 601 TFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           TFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI
Sbjct: 601 TFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/639 (78%), Positives = 535/639 (83%), Gaps = 4/639 (0%)

Query: 1   MAENSLFRFIARNKVAILXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSKDHRRQSEASTN 60
           MAENSL RFI +NKVAIL                            G+KD+RRQSEA   
Sbjct: 1   MAENSLLRFITKNKVAILATVSAGTAAVGAYVYYQQIKQQQQQQLKGTKDNRRQSEAFAG 60

Query: 61  LKEDEVGLX---XXXXXXXXXXXXXXXXXXXXXXXXXEDFQCTFLPNGEPDISQLKGLTL 117
             EDE  L                             E F    LPNGEPDI+QLKGL+ 
Sbjct: 61  QNEDEADLKDDGSVVSGSNKRKKKKNKRKRNNKAKSGEGFDYPSLPNGEPDIAQLKGLSP 120

Query: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177
           SQ+Q YAVQLKN+GNHFFT KNF EAIKYYQ AIELDPN+PVFYSNISACYISTGDL KV
Sbjct: 121 SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV 180

Query: 178 LEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL 237
           +E+TTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL
Sbjct: 181 IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL 240

Query: 238 NKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVNNSSHFDTAYALLSD 297
           NKQAMKVLNENLSK +GRGSQ+LPSNTSL SFFGIFD  LE+S VN SS++DTAYALLSD
Sbjct: 241 NKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSD 300

Query: 298 ALQKLYSATNEGYLTADKLFTSATDAYHSLL-ASQVDGPLKENAALAFCYTGIFHFLKNN 356
           ALQ+LYSAT+EGYL A+ L T +TD YHSLL A+ VD PL+ENAALA CYTGIFHFLKNN
Sbjct: 301 ALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNN 360

Query: 357 LLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQ 416
           LL AQ LLQESINLHPTPNSYIFLALTLADKENSQEFFK+FQKA+DL+ EYPPTYYHRGQ
Sbjct: 361 LLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQ 420

Query: 417 MYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLP 476
           MYFILQDY NAK DFQKAQ+L PEN+YPYIQLACLLYKQGKFTESEA FNETKLKFPTLP
Sbjct: 421 MYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLP 480

Query: 477 EVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ 536
           EVP FFAEILTD+GDF TAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ
Sbjct: 481 EVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ 540

Query: 537 LDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSAILARTMDEK 596
           LDEEKFN AI LLTKACELDPRSEQAKIGLAQLKLQMEKID+AIELF+DSAILARTMDEK
Sbjct: 541 LDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEK 600

Query: 597 LQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           LQATTFAEAAKIQKRLRADPIISAKME+TLA YRAKGM+
Sbjct: 601 LQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/638 (77%), Positives = 532/638 (83%), Gaps = 3/638 (0%)

Query: 1   MAENSLFRFIARNKVAILXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSKDHRRQSEASTN 60
           MAENSL +FIA+NKVAIL                            G+K+ RR  E  T+
Sbjct: 1   MAENSLLKFIAKNKVAILATVSAGTAAVGAYAYYKQLKQREQQQLKGTKNRRRPGETFTS 60

Query: 61  LKEDEVGLXXXXXXXXXXXXXXXXXXXXXXX-XXXEDFQCTFLPNGEPDISQLKGLTLSQ 119
             EDEV L                           E F+   L +GEPD++QL+GL LSQ
Sbjct: 61  QNEDEVSLKDDGSITSGSRKRKKNKRKRKNKPKLAESFEYPLLSDGEPDMAQLRGLPLSQ 120

Query: 120 KQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLE 179
           +Q YAVQLK+KGNHFFT+KNF +AIKYYQ AIELDPNDPVFYSN+SACYISTGDLNKV+E
Sbjct: 121 RQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVE 180

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK 239
           YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK
Sbjct: 181 YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK 240

Query: 240 QAMKVLNENLSKGDG-RGSQLLPSNTSLTSFFGIFDPDLEISRVNNSSHFDTAYALLSDA 298
           QAMKVLN NLSK  G RGS++LPSNTSL SFFGIFDPDLEISRV++ S  DTA+ +L +A
Sbjct: 241 QAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDLEISRVSSISPPDTAHDMLLEA 300

Query: 299 LQKLYSATNEGYLTADKLFTSATDAYHSLL-ASQVDGPLKENAALAFCYTGIFHFLKNNL 357
           LQ+LYSAT+EGYL A+ LFT ATDAYHSLL AS+VDG ++ NAALAFCY GIF FLKN+L
Sbjct: 301 LQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAIRGNAALAFCYKGIFQFLKNDL 360

Query: 358 LGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQM 417
           L AQALLQESINLHPTPNSYIF+ALTLADKENSQEFF +FQKAIDLD EY PTYYHRGQM
Sbjct: 361 LDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSFFQKAIDLDPEYSPTYYHRGQM 420

Query: 418 YFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLPE 477
           YFILQDYVNAK DFQKAQ+L P NIYPYIQLACLLYKQGKF+ESE LFNETKLKFPTLPE
Sbjct: 421 YFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQGKFSESEKLFNETKLKFPTLPE 480

Query: 478 VPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQL 537
           VP FFAEILTDKGD++TAIKQYDIAKRL+EVQ KIHVGIGPLIGKATILARQS+QDPTQL
Sbjct: 481 VPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGIGPLIGKATILARQSTQDPTQL 540

Query: 538 DEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSAILARTMDEKL 597
           DEEKFN AI LLT+AC+LDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSA LARTMDEKL
Sbjct: 541 DEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSATLARTMDEKL 600

Query: 598 QATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           QATTFAEAAKIQKRLRADPIISAKME TLASYRA GMI
Sbjct: 601 QATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/644 (73%), Positives = 522/644 (81%), Gaps = 9/644 (1%)

Query: 1   MAENSLFRFIARNKVAILXXXXXXXXXXXXXXXXXXXXXXXXXXXX---GSKDHRRQSEA 57
           MAENS  +F ARNK+AI+                               G+KD +RQ EA
Sbjct: 1   MAENSFSKFFARNKLAIVATVSAGAAAVGAYVYYHQLKQQQQHHQQQLKGTKDRQRQGEA 60

Query: 58  STNLK-EDEVGLXXXXXXXXXXXXXXXXXXXXXXX---XXXEDFQCTFLPNGEPDISQLK 113
                 E+E+GL                             ED +   LP+GEPD+ +L+
Sbjct: 61  LPGQDGEEELGLKEDGSAAADSNKKKKKKNRRKKKSKPKSAEDVEYPLLPHGEPDMDRLR 120

Query: 114 GLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGD 173
           GL+  Q+Q +AVQLK+KGNHFFT K+F +AIKYYQ AIELDPNDPVFYSNISACYISTGD
Sbjct: 121 GLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGD 180

Query: 174 LNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPML 233
           L+KV+EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDG SIEPML
Sbjct: 181 LDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPML 240

Query: 234 ERNLNKQAMKVLNENLSK-GDGRGSQLLPSNTSLTSFFGIFDPDLEISRVNNSSHFDTAY 292
           ERNLNKQAMKVLNE+L K GD + SQ+LPSNTSL SFFGIFDPDLE SRVN  S  D+A 
Sbjct: 241 ERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDLETSRVNTGSLLDSAS 300

Query: 293 ALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLL-ASQVDGPLKENAALAFCYTGIFH 351
           A LS+ALQ LYSAT+EGYL AD L T ATD YHSLL A++ D  ++ENAALAFCY GIF 
Sbjct: 301 ATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVIRENAALAFCYAGIFQ 360

Query: 352 FLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTY 411
           FLKN+LL AQALLQESINLHPTPNSY+F+ALT+ADKENSQEFFK+FQ AIDLD EYPPTY
Sbjct: 361 FLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKFFQNAIDLDPEYPPTY 420

Query: 412 YHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLK 471
           YHRGQMYFILQDY+NAK+DFQKAQ+L P N+YPYIQLACLLYKQ KF+E+E+LFNE KLK
Sbjct: 421 YHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQDKFSEAESLFNEAKLK 480

Query: 472 FPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSS 531
           FP LPEVP F+AEILTDKGDF+ AIKQYDIAKRLEEVQ+KIHVGIGPLIGKATILARQSS
Sbjct: 481 FPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGIGPLIGKATILARQSS 540

Query: 532 QDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSAILAR 591
           QDPTQLDEEKFN AI LLTKACELDPRSEQAKIGLAQL+LQMEKID AI+LFQ+SA LAR
Sbjct: 541 QDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKIDVAIKLFQESATLAR 600

Query: 592 TMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           TMDEKLQATTFAEAAKIQKRLRADPIISAKME TLA+YRA+GMI
Sbjct: 601 TMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/532 (58%), Positives = 390/532 (73%), Gaps = 15/532 (2%)

Query: 105 GEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNI 164
           GEP +  +  ++  QK++++  LK+KGN FF  K++  A+KYY  A+ L   DPVFYSNI
Sbjct: 87  GEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTL-KKDPVFYSNI 145

Query: 165 SACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDF 224
           SACY+S   L+KV+E +TKALE+KPD+SKALLRRASANESL N+ DAMFDLSVLSLNGDF
Sbjct: 146 SACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDF 205

Query: 225 DGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVNN 284
            G+SIEPMLERNLNKQAM VL + L +   + +QLLPS+T+L SFFGIF P+ E +  + 
Sbjct: 206 GGSSIEPMLERNLNKQAMTVLKDKLGQ---QKNQLLPSDTALASFFGIFTPETEFANYDE 262

Query: 285 SSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLL-ASQVDGPLKENAALA 343
           +S  D     L   L+ LY  ++EGY  AD+ F+ A DAY  L   +  D  LKE  A+A
Sbjct: 263 TSEADQK---LKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIA 319

Query: 344 FCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDL 403
             + GIF FLKN+ LGA   +Q++I+LHP  NSYI++AL +ADK  ++E++++F KAI L
Sbjct: 320 LEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKL 379

Query: 404 DSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEA 463
           D +    YYHRGQMYFI   Y  A  DF KA+ L  ENI+PYIQLACL Y++ KF + E 
Sbjct: 380 DPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCET 439

Query: 464 LFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKA 523
           LF+E K KF T PEVP FFAEIL DKGD   A+KQYDIAKRLEE  + IHVGI PL+GKA
Sbjct: 440 LFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKA 499

Query: 524 TILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELF 583
           T+LARQ S        E F  A  LL +AC  DPRSEQ K+GLAQLKLQ E IDDAI+LF
Sbjct: 500 TLLARQPSV-------ENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLF 552

Query: 584 QDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           +++A LART+DEKLQATTFAEAAK+QKR+RADP++SAK+E TLA+Y+A+G+I
Sbjct: 553 EEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/535 (57%), Positives = 396/535 (74%), Gaps = 14/535 (2%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           + +PD+ Q+  L L +++  ++QLK+KGN +F  K++T AIKYY  A++L+  DP+FYSN
Sbjct: 102 SNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSN 160

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           ISACY+S G L+KV+E +TKALE+ P++SKALLRRASANESL N++DA+FDLSVLSLNGD
Sbjct: 161 ISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLSLNGD 220

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSK--GDGRGSQLLPSNTSLTSFFGIFDPDLEISR 281
           + GASIEP+LERNLNKQA+KVLNE ++K  G  +  QLLPS TSL SFFGIFDP+L    
Sbjct: 221 YSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPELTFQN 280

Query: 282 VNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQV-DGPLKENA 340
            N +   D     L   L  L+  T++GYL ADK F  A+  +   LA    D  L E  
Sbjct: 281 YNENDQADVE---LLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEKT 337

Query: 341 ALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKA 400
           A+A  Y GIF FLKN+LLGAQ  ++++I   P  NSY++LAL  ADK  SQE+ KYF KA
Sbjct: 338 AIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDKA 397

Query: 401 IDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTE 460
           ++L+ +    YYHRGQ+YFI QDY  AK +F+KA+ L   NI+PYIQLACL Y++  F  
Sbjct: 398 LELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFDR 457

Query: 461 SEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLI 520
            + LF+ET+ KFPT PEVP F+AEIL DKGDF+ AIKQYDIA RLE+ Q+ IHVGI PL+
Sbjct: 458 CQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPLV 517

Query: 521 GKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAI 580
           GKAT+LARQ    P  L+      A  L+ KACE+DPRSEQA +GLAQLKLQ E++D AI
Sbjct: 518 GKATVLARQ----PNLLN---LKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAI 570

Query: 581 ELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           ELF+ +A L+RTMDEK+QA TFAEAAKIQKR+RADP+ISAK++  LASYR++G+I
Sbjct: 571 ELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/533 (57%), Positives = 388/533 (72%), Gaps = 15/533 (2%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEPD+      T  QK+TY+V LK+KGN FF  + + +A+KYY  A++L   DPVFYSN
Sbjct: 79  NGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDL-KQDPVFYSN 137

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           ISACY+S G+L KV+E +TKALE+KPD+SKALLRRASANE+L NF +AMFDLSVLSLNGD
Sbjct: 138 ISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLSLNGD 197

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283
           F+ ASIEPMLERNLNKQAM+VL + +S       Q LPSNT L SFFGIF P+  +   +
Sbjct: 198 FNEASIEPMLERNLNKQAMRVLKDKMS---SDAKQQLPSNTFLASFFGIFTPETTLKNFD 254

Query: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAY-HSLLASQVDGPLKENAAL 342
            S+  D     L +AL  LY   +E YL AD+ F+ A ++Y   L A+  D  LKE  A 
Sbjct: 255 ESNEADVE---LLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTAT 311

Query: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402
           A  Y GIF FLKN+ LG+   +Q SI LHP  N+YI+ AL +ADK  S+ +F +F KA+D
Sbjct: 312 ALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALD 371

Query: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462
           +D    P YYHRGQM+F+ Q Y  A ADF+KA+     NI+PYIQLACL Y +GKF + E
Sbjct: 372 VDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGKFDDCE 431

Query: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522
            LF+E K KFPT PEVP F+AE+LTDKGDF  A KQYDIAKRLEE  + IHVG+ PL+GK
Sbjct: 432 TLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGK 491

Query: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582
           AT+LARQ    PT    E    +  LL +AC++D RSEQAKIGLAQLKLQ E+ID+AI L
Sbjct: 492 ATLLARQ----PTV---ENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEAITL 544

Query: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           F++++ LAR M+EKLQATTFAEA+K+QK++RADP+++AK++ TLA+YR +G+I
Sbjct: 545 FEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/536 (56%), Positives = 388/536 (72%), Gaps = 18/536 (3%)

Query: 106 EPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNIS 165
           +PD++ +   +  QK+ YA  LK+KGN  F  K F +AI++Y  AI+L   DPVF+SNIS
Sbjct: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLH-EDPVFHSNIS 133

Query: 166 ACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFD 225
           ACY+S GDL+KV+E +T+ALE+KPD+SKALLRRASA E++G + DAMFD+SVLSLNGDF+
Sbjct: 134 ACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFN 193

Query: 226 GASIEPMLERNLNKQAMKVLNENLS-------KGDGRGSQLLPSNTSLTSFFGIFDPDLE 278
           G+SIEPMLERNLNKQA++VL E++            R  Q LPSNTSL+SFFGIF P+ E
Sbjct: 194 GSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETE 253

Query: 279 ISRVNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGPLKE 338
           I   + S+  D     L   L+ LY AT++GY  AD+ F  A   Y   LA+  D   KE
Sbjct: 254 IPAYDESNEADVT---LVRGLKALYGATSDGYQLADECFAKAAKLYREQLANNNDAAFKE 310

Query: 339 NAALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQ 398
            AA A  Y GIF FLKN+L  ++  L+E++ LHP  N+YI+LALT+AD+  S+++F YF+
Sbjct: 311 KAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFE 370

Query: 399 KAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKF 458
           KAI LD      YYHRGQMYFI Q+Y  A  DF+K++   P+NI+PYIQLACL Y++ K 
Sbjct: 371 KAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKM 430

Query: 459 TESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGP 518
            E E LF E +  FPT PEVP F+AEIL DKGD   A+KQY+IA RLE +Q++IHVGI P
Sbjct: 431 AECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAP 490

Query: 519 LIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDD 578
           L+GKATILARQ    PT    E F T   LL  AC+ DPRSEQAK+GLAQL+LQ EK+D+
Sbjct: 491 LVGKATILARQ----PTP---ENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDE 543

Query: 579 AIELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGM 634
           AIELF+++A +ART+DEKLQA TFAEA K+QKR+RADP++S K+E TLA+Y+A+ M
Sbjct: 544 AIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/534 (58%), Positives = 382/534 (71%), Gaps = 17/534 (3%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEP +  +  LT  QK+ YA+ LK+KGN FF  K F +AIKYY  A+EL   DPVFYSN
Sbjct: 82  NGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALEL-KKDPVFYSN 140

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
            SACY+S G L KV+E TT AL++K D+SK LLRRASANESLGN+ DAMFDLS LSL GD
Sbjct: 141 RSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAMFDLSALSLYGD 200

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLS-KGDGRGSQLLPSNTSLTSFFGIFDPDLEISRV 282
           F+GASIEPMLERN+NKQAM VL E L  K D R    LPSNTSL SFFGIF+P+      
Sbjct: 201 FNGASIEPMLERNMNKQAMLVLKEKLEEKKDHR----LPSNTSLASFFGIFEPETSFENY 256

Query: 283 NNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGP-LKENAA 341
           + S   D    LL   L  LY  T+EGY TAD+ FT A  AY +LL    +   LK+ AA
Sbjct: 257 DESVEADR---LLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLEESPENEILKQKAA 313

Query: 342 LAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAI 401
           +A  + GIF FLKN+ L A   L++++  HP  NSYI+LAL +ADK  + E+F+ F KA+
Sbjct: 314 IALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATEYFENFDKAL 373

Query: 402 DLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTES 461
           +LD      YYHRGQMYFI Q Y NA  DF KA+     NI+PYIQLACL Y++ KF + 
Sbjct: 374 ELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYRENKFEDC 433

Query: 462 EALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIG 521
           E LF+E + KFPT PEVP F+AEIL+DKGD + A KQY+IA++LE+  + IHVGI PL+G
Sbjct: 434 ETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDALDGIHVGIAPLVG 493

Query: 522 KATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIE 581
           KAT+LAR+    PT    E F  A     +ACE DPRSEQAKIGLAQLKLQ E++D+AI 
Sbjct: 494 KATLLARE----PTV---ENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEVDEAIT 546

Query: 582 LFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           LF+++A LAR+ DEKLQATTFAEA KIQK++RADPIISAK+E TLA+YRA+GMI
Sbjct: 547 LFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGMI 600

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/533 (56%), Positives = 385/533 (72%), Gaps = 15/533 (2%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEP +  ++ L+   ++TYA  LK++GN FF  K++  A+KYY  A+ +   DPVFYSN
Sbjct: 81  NGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVVK-KDPVFYSN 139

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           ISACY+S G L+KV+E +TKALE+KPD+SKALLRRASANESL N+ DAMFDLSVLSLNGD
Sbjct: 140 ISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDLSVLSLNGD 199

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283
           F+G+SIEPMLERNLNKQAM VL + L       SQ LPSNT+L SFFGIF P+   +  N
Sbjct: 200 FNGSSIEPMLERNLNKQAMFVLKDKLG---NNVSQQLPSNTALASFFGIFPPETTFANYN 256

Query: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLAS-QVDGPLKENAAL 342
            +   D     L + L+ LY  ++EGY  AD+ F  +   + + L+    D  LKE  A+
Sbjct: 257 ENDEADVG---LKNGLEDLYKRSSEGYKLADEAFVKSASFFTNKLSEFPDDAVLKEKTAI 313

Query: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402
           A  + GIF FLKN+ L A   ++++I LHP  NSYI++AL +ADK  ++E+++YF KAI 
Sbjct: 314 ALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQAEEYYQYFDKAIA 373

Query: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462
           LD  Y P YYHRGQMY+I   Y  A  DF KA+     NI+PYIQLACL Y++ KF + E
Sbjct: 374 LDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLACLAYREDKFDDCE 433

Query: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522
            LF+E K KFPT PEVP F+AEIL DKGD   A+KQY+IAKRLEE  + IHVG+ PL+GK
Sbjct: 434 TLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLEEALDGIHVGVAPLVGK 493

Query: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582
           AT+LARQ S        E F  A  LL +AC  DP SEQAK+GLAQLKLQ E++D+AI L
Sbjct: 494 ATLLARQPSV-------ENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEVDEAINL 546

Query: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           F+++A LART+DEKLQATTFAEAAK+QKR++ADP++SAK+E TLA+YRA+GM+
Sbjct: 547 FEEAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGMM 599

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/532 (57%), Positives = 376/532 (70%), Gaps = 15/532 (2%)

Query: 105 GEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNI 164
           GEPD+S L  L+  QK  YA+ LK+KGN FF  K + EAI+YY  AIE+   DPVFYSN 
Sbjct: 76  GEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVK-EDPVFYSNR 134

Query: 165 SACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDF 224
           SACY+S G   KV+E TT AL++KPD+SK LLRRASANESLGNF DAMFDLS +SL GDF
Sbjct: 135 SACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSAVSLYGDF 194

Query: 225 DGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVNN 284
            GASIEP+LERN+NKQ+M VL E L K   +    LPSNTSL SFFGIF P+      ++
Sbjct: 195 SGASIEPLLERNMNKQSMLVLKEKLEK---QQEYKLPSNTSLASFFGIFQPETTFENYDD 251

Query: 285 SSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQV-DGPLKENAALA 343
           +S  D     L + L  LY  T +GY TAD  F  A DA+  LL     D  LK  AA+A
Sbjct: 252 NSEADK---YLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDADLKRKAAIA 308

Query: 344 FCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDL 403
             + GIF FLKN+ + A   L++++   P PN+YI++AL +ADK  + E+F  F+KA+ L
Sbjct: 309 LEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALKL 368

Query: 404 DSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEA 463
           D      YYHRGQMYFI Q +  A  DF+KA+ L   NI+PYIQLACL Y++GKF +SE 
Sbjct: 369 DPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREGKFDDSET 428

Query: 464 LFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKA 523
           LF+E + KFPT PEVP F+AE L+DKGD + A KQYDIA +LE+  + IHVG+ PLIGKA
Sbjct: 429 LFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHVGVSPLIGKA 488

Query: 524 TILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELF 583
           T+L+R+ S        E F  A  L  KAC+ DPRSEQAKIGLAQLKLQ E ID+AI LF
Sbjct: 489 TLLSREPSV-------ENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIALF 541

Query: 584 QDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           +++A LAR+ DEKLQATTFAEA KIQK++RADP++SAK+E TLA+YRA+GMI
Sbjct: 542 EEAADLARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGMI 593

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/540 (56%), Positives = 373/540 (69%), Gaps = 19/540 (3%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           +GEPD+SQL   T  Q++TYA+ LK+KGN  F  K   EAIKYYQ A+E    DPVFY+N
Sbjct: 86  SGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYAN 144

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           ISACY+S  D  KVLE   KALE+KPD+SK LLRRA+  E++ NF DAMFDLSVLSLN D
Sbjct: 145 ISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLSLNND 204

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283
           F GASIEPMLERNLNKQAMK+L E L     +  Q LPS+TS+ SFFGIF P+ E    +
Sbjct: 205 FSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEFKGYD 264

Query: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGP-----LKE 338
            +   D     L   L +L++AT+ G++ AD  F  A + Y  L +   D       L E
Sbjct: 265 ETCEADRT---LQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLNE 321

Query: 339 NAALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQ 398
             A+A  Y+GIF FLKN+++GAQA + E+I L P  NSYI+LALT AD   S E+   F 
Sbjct: 322 KFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNFD 381

Query: 399 KAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKF 458
           KA++L+     TYYHRGQ+YFI QDY  AKADF KA+ L  +NI+ YIQLACL Y++G  
Sbjct: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441

Query: 459 TESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEE---VQEKIHVG 515
            E + LF+E + KFP  PEVP F+AEIL DKGDFS A KQYD+AKRLEE    +  I VG
Sbjct: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVG 501

Query: 516 IGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEK 575
           + PL+GKAT+LARQ S        E F  A  L  +AC+ DPRSEQAK+GLAQL LQ E 
Sbjct: 502 VAPLVGKATVLARQPSP-------ENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQED 554

Query: 576 IDDAIELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           +D AI++F+++A LART DEKLQA TFAEAAK+QK++RADPII AK+E  LA YRA+GMI
Sbjct: 555 VDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/532 (56%), Positives = 379/532 (71%), Gaps = 15/532 (2%)

Query: 105 GEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNI 164
           GEPD+ ++  L+  +K  +A+ LK+KGN FF  K F +A+KYY  AIE+   DPVFYSN 
Sbjct: 77  GEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNR 135

Query: 165 SACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDF 224
           SACY+S G   KV+E TT AL++KPD+SK LLRRASANESLG F DAMFDLS +SL GDF
Sbjct: 136 SACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSAVSLYGDF 195

Query: 225 DGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVNN 284
           +G+SIEP+LERN+NKQAM VL E L K   +    LPSNTSL SFFGIF P+      + 
Sbjct: 196 NGSSIEPLLERNMNKQAMLVLKEKLEK---QQEYKLPSNTSLASFFGIFQPETSFENYDE 252

Query: 285 SSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLA-SQVDGPLKENAALA 343
           +S  D A   L D L  LY  T+ GY  AD  F+ A D Y +LL  +  D  LK+ AA+A
Sbjct: 253 NSEADKA---LLDGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSEDASLKQKAAIA 309

Query: 344 FCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDL 403
             + GIF FLKN+ + A   L++++   P PN+YI++AL +ADK  + E+F  F+KA++L
Sbjct: 310 LEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALEL 369

Query: 404 DSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEA 463
           D      YYHRGQM+FI Q +  A  DF+KA+ L   NI+PYIQLACL Y++GKF++SE 
Sbjct: 370 DPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSET 429

Query: 464 LFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKA 523
           LF+E + KFPT PEVP F+AE L+DKGD + A K+YDIA +LE   + IHVG+ PLIGKA
Sbjct: 430 LFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESALDGIHVGVSPLIGKA 489

Query: 524 TILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELF 583
           T+L+R+ S        E F  A  L  +ACE DPRSEQAKIGLAQLKLQ E ID+AI LF
Sbjct: 490 TLLSREPSV-------ENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDEAIALF 542

Query: 584 QDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           +++A LAR+ DEKLQATTFAEA KIQK++RADPI+SAK+E TLA+YRA+GMI
Sbjct: 543 EEAADLARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQGMI 594

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/550 (55%), Positives = 378/550 (68%), Gaps = 29/550 (5%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEPD S+    T  +K  YA+ LK+KGN +F  K + +AIKYY  A+EL   DPVFYSN
Sbjct: 79  NGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSN 137

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           +SACY+S GDL KV+E +TKALEIKPD+SK LLRRASANE LGNF DAMFDLSVLSLNGD
Sbjct: 138 LSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGD 197

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGS-----------------QLLPSNTSL 266
           F+ ASIEPMLERNLNKQAM  L E     D   +                 + LPS TS+
Sbjct: 198 FNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLPSITSM 257

Query: 267 TSFFGIFDPDLEISRVNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHS 326
            SFFGIF P+L  +   N   F+ A   L D L  LY  + E Y  AD+ FT A   +  
Sbjct: 258 ASFFGIFKPELTFA---NYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFEE 314

Query: 327 LL-ASQVDGPLKENAALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLA 385
            L  S  D  LKE  A++  +TGIF FLKN+ LGA   ++++I L P  NSYI++AL +A
Sbjct: 315 QLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMA 374

Query: 386 DKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPY 445
           D+ +S E++ YF KA+ L+      YYHRGQM FILQ+Y  A  DF KA+ L PENI+PY
Sbjct: 375 DRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434

Query: 446 IQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRL 505
           IQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK DF  A+KQYD+A  L
Sbjct: 435 IQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIEL 494

Query: 506 EEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIG 565
           E   ++I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRSEQAKIG
Sbjct: 495 ENKLDRIYVGIAPLVGKATLLTR----NPTV---ENFVEATNLLEKASKLDPRSEQAKIG 547

Query: 566 LAQLKLQMEKIDDAIELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMT 625
           LAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+Q+++R+DPI++AK++ T
Sbjct: 548 LAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQET 607

Query: 626 LASYRAKGMI 635
           LA  R +G++
Sbjct: 608 LAKLREQGLM 617

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/550 (55%), Positives = 377/550 (68%), Gaps = 29/550 (5%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NG+PD S     T  +K  YA+ LK+KGN FF  K + +AIKYY  A+EL  +DPVFYSN
Sbjct: 79  NGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KDDPVFYSN 137

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           +SACY+S GDL KV+E +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVLSLNGD
Sbjct: 138 LSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGD 197

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGD-----------------GRGSQLLPSNTSL 266
           F+ ASIEPMLERNLNKQAM  L E     D                    ++ LPS TS+
Sbjct: 198 FNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENLPSITSM 257

Query: 267 TSFFGIFDPDLEISRVNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHS 326
            SFFGIF P+L  +  + S+  D     L + L  LY  + E Y  AD+ FT A   +  
Sbjct: 258 ASFFGIFKPELTFANYDESNEADKD---LMNGLTNLYKRSPESYDKADESFTKAVKLFDE 314

Query: 327 LL-ASQVDGPLKENAALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLA 385
            L  +  D   KE  A++  +TGIF FLKN+ LGA   ++++I L P  NSYI++AL +A
Sbjct: 315 QLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMA 374

Query: 386 DKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPY 445
           D+ +S E++ YF KA+ LDS     YYHRGQM FILQ+Y  A  DF KA+ L PENI+PY
Sbjct: 375 DRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434

Query: 446 IQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRL 505
           IQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK DF  A+KQYD+A  L
Sbjct: 435 IQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAIEL 494

Query: 506 EEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIG 565
           E   + I+VGI PL+GKAT+L R    +PT    E F  A  LL +A +LDPRSEQAKIG
Sbjct: 495 ENKLDGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEEASKLDPRSEQAKIG 547

Query: 566 LAQLKLQMEKIDDAIELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMT 625
           LAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+QKR+R+DPI++AK++ T
Sbjct: 548 LAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQET 607

Query: 626 LASYRAKGMI 635
           LA  R +G++
Sbjct: 608 LAKLREQGLM 617

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/550 (54%), Positives = 375/550 (68%), Gaps = 29/550 (5%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEPD S     T  +K  YA+ LK+KGN FF  K + +AIKYY  A+EL   DPVFYSN
Sbjct: 79  NGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALEL-KEDPVFYSN 137

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           +SACY+S GDL KV+E +TKALE+KPD+SK LLRRASANE LG F DAMFDLSVLSLNGD
Sbjct: 138 LSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGD 197

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGS-----------------QLLPSNTSL 266
           F+ ASIEPMLERNLNKQAM  L E     D   +                 + LPS TS+
Sbjct: 198 FNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLPSVTSM 257

Query: 267 TSFFGIFDPDLEISRVNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHS 326
            SFFGIF P+L  +  + S+  D     L + L  LY  + E Y  AD+ FT A   +  
Sbjct: 258 ASFFGIFKPELTFANYDESNEADKE---LMNGLSNLYKRSPESYDKADESFTKAARLFEE 314

Query: 327 LL-ASQVDGPLKENAALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLA 385
            L  +  D  LKE  A++  +TGIF FLKN+ LGA   ++++I L P  NSYI++AL +A
Sbjct: 315 QLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMA 374

Query: 386 DKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPY 445
           D+ +S E++ YF KA+ LDS     YYHRGQM FILQ+Y  A  DF KA+ L PENI+PY
Sbjct: 375 DRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434

Query: 446 IQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRL 505
           IQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK DF  A+KQYD+A  L
Sbjct: 435 IQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIEL 494

Query: 506 EEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIG 565
           E   + I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRSEQAKIG
Sbjct: 495 ENKLDGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEKASKLDPRSEQAKIG 547

Query: 566 LAQLKLQMEKIDDAIELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMT 625
           LAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+Q+R+R+DP+++ K++ T
Sbjct: 548 LAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQET 607

Query: 626 LASYRAKGMI 635
           LA  R +G++
Sbjct: 608 LAKLREQGLM 617

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/550 (54%), Positives = 375/550 (68%), Gaps = 29/550 (5%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEPD S+    T  +K  YA+ LK+KGN +F  K + +AIKYY  A+EL   DPVFYSN
Sbjct: 79  NGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL-KEDPVFYSN 137

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           +SACY+S GDL KV+E +TKALE+KPD+SK LLRRASANE LGNF DAMFDLSVLSLNGD
Sbjct: 138 LSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGD 197

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGS-----------------QLLPSNTSL 266
           F+ ASIEPMLERNLNKQAM  L E     D   +                 + LPS TS+
Sbjct: 198 FNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLPSVTSM 257

Query: 267 TSFFGIFDPDLEISRVNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHS 326
            SFFGIF P+L  +  + S+  D     L + L  LY  + + Y  AD+ FT A   +  
Sbjct: 258 ASFFGIFKPELTFANCDESNEADKE---LMNGLANLYKRSPDSYDRADESFTKAVKLFED 314

Query: 327 LL-ASQVDGPLKENAALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLA 385
            L     D  +KE  A++  +TGIF FLKN+ LGA   + ++I+L P  NSYI++AL +A
Sbjct: 315 QLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALIMA 374

Query: 386 DKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPY 445
           D+ +S E++ YF KA+ LD      YYHRGQM FILQ+Y  A  DF KA+ L PENI+PY
Sbjct: 375 DRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPY 434

Query: 446 IQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRL 505
           IQLACL Y++ KF + E LF+E K KFP  PEVP FFAEILTDK DF  A+KQYD+A  L
Sbjct: 435 IQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIEL 494

Query: 506 EEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIG 565
           E   E I+VGI PL+GKAT+L R    +PT    E F  A  LL KA +LDPRSEQAKIG
Sbjct: 495 ENKLEGIYVGIAPLVGKATLLTR----NPTV---ENFIEATNLLEKASKLDPRSEQAKIG 547

Query: 566 LAQLKLQMEKIDDAIELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMT 625
           LAQ+KLQ E ID+AI LF++SA LARTM+EKLQA TFAEAAK+Q+R+R+DP+++ K++ T
Sbjct: 548 LAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQET 607

Query: 626 LASYRAKGMI 635
           LA  R +G++
Sbjct: 608 LAKLREQGLM 617

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/534 (55%), Positives = 378/534 (70%), Gaps = 20/534 (3%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEP++      T  +K+ Y++ LK+KGN  F    F EAIKYY  AIEL  N P+FYSN
Sbjct: 91  NGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKEN-PIFYSN 149

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           +SACY+S   L ++++Y  KALE+KPD+SK LLRRA+ANE L N+ DAMFDLSVLSLNGD
Sbjct: 150 LSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSVLSLNGD 209

Query: 224 FDGASIEPMLERNLNKQAMKVLNENL--SKGDGRGSQLLPSNTSLTSFFGIFDPDLEISR 281
           ++GASIEP+LERNLNKQAM VL + L  SK D      LPS+TSL++FFGIF P+L    
Sbjct: 210 YNGASIEPILERNLNKQAMSVLKDKLKNSKDDQ-----LPSDTSLSAFFGIFKPELSFEN 264

Query: 282 VNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAY-HSLLASQVDGPLKENA 340
            + ++  D     L + L  L+   +E YL ADK F +A + Y   L  +  D  LK  A
Sbjct: 265 YDETNDADKE---LLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEETPDDTDLKVKA 321

Query: 341 ALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKA 400
           ++A+ Y GIF+FLKN+L GA   + +SI L+P  NSYI+ AL +ADK  SQ++  YF KA
Sbjct: 322 SIAYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLDYFDKA 381

Query: 401 IDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTE 460
           + LD +    YYHR Q+ F+ QD+  A  DF+KA+   P NI+PYIQLACL Y++ KF +
Sbjct: 382 LKLDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRENKFDD 441

Query: 461 SEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEV-QEKIHVGIGPL 519
            E LF+E K KFPTLPEVP F+AE+LTDKGDF  A+K Y+ A+RLEE  ++ IHVG+ PL
Sbjct: 442 CETLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEASKDGIHVGVAPL 501

Query: 520 IGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDA 579
           IGKAT+LAR+    PT    E    A  LL +A  +DPRSEQAKIGLAQLKLQ E+ID++
Sbjct: 502 IGKATLLARE----PTL---ENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEEIDES 554

Query: 580 IELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKG 633
           I LF++SA LARTM+EKLQATTFAEAAK+QK +RADPIIS K+E TLA+YRA+ 
Sbjct: 555 IRLFEESADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQN 608

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/533 (53%), Positives = 368/533 (69%), Gaps = 15/533 (2%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEPD+S +   T  QK+ Y++ +K+KGN  F  K + EAIKYY CA+ L   DPVFYSN
Sbjct: 78  NGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLK-KDPVFYSN 136

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
            SAC++    L KV+E TT ALE+KPD+SK LLRRA+ANESLGNF DAM DLS +SL G 
Sbjct: 137 RSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVSLYGG 196

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283
           ++  SIEP+LERN+NKQAM+VL   L+  DG   QL PSNTSL SFFGIF  +   +  +
Sbjct: 197 YNSQSIEPVLERNMNKQAMQVLKRKLA--DGSKHQL-PSNTSLASFFGIFPSETSFANYD 253

Query: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYH-SLLASQVDGPLKENAAL 342
             S  D     L   L+ L       Y  +D+ F  A D    S  A   D  L+   A+
Sbjct: 254 EQSEADN---FLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAI 310

Query: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402
           A  + GIF FLKN  L A  LLQ++++LHP PNSYI++AL +ADK  + E+ +YF KA++
Sbjct: 311 ALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALE 370

Query: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462
           L       YYHRGQMYF+ Q +  +  DF KA+   P+NI+PYIQLACL Y++ KF + E
Sbjct: 371 LAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCE 430

Query: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522
            LF+E + KFPT PEVP F+AEIL+DKGD  +A+K+Y+ A++LE+ QE IHVG+ PL+GK
Sbjct: 431 TLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGK 490

Query: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582
           AT+LARQS           F  A AL  +AC+ DPRSEQAKIGLAQLKLQ E++D+AI+L
Sbjct: 491 ATVLARQSHSG-------DFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQL 543

Query: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           F+++  LAR  +EKLQATTFAEAAKIQKR+RADPI+SAK++ TL +YR +G++
Sbjct: 544 FEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/533 (54%), Positives = 367/533 (68%), Gaps = 13/533 (2%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEPD + +  LT  QK  +A++LK+KGN +F  K++  A+K+Y  A+ L   DPVFYSN
Sbjct: 88  NGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALIL-KKDPVFYSN 146

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           +SACY+S  +L+KV+E +TKALE+KPD+SKALLRRA+ANE L N++DAMFDLSVLSLN D
Sbjct: 147 MSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNND 206

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283
           F+GA+IEPMLERNLNKQA+KVL++  SK   +    LPSNTS+ SFF IF P++     +
Sbjct: 207 FNGATIEPMLERNLNKQAIKVLDQK-SKNPSKNESELPSNTSMASFFSIFTPEISFDSYD 265

Query: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGP-LKENAAL 342
             S  D     L + L++LYSA    Y  A+  F  + + Y  LL S  D   + +  A+
Sbjct: 266 EESDADKE---LLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322

Query: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402
           A  Y GIF+FL+N+L+ AQ L  +SI+  P  NSYI+LAL  ADK    E  KYF +A+ 
Sbjct: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382

Query: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462
           LD    P YYHRGQ+ F+ QDYVNAK DF KA+ L   NI+PYIQLACL Y++G F + +
Sbjct: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442

Query: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522
             F   + KFP  PE+P F  EIL DKGD   A KQY+   RLE  Q+ IHVGI PLIGK
Sbjct: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502

Query: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582
           AT LARQ    PT    E F+ A  LL  A E DPRSEQA +GLAQLKLQ E +D AIEL
Sbjct: 503 ATALARQ----PTP---ENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIEL 555

Query: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           F+ ++  +R+MDEKLQATTFAEAAK+QKR+RADP+I AK+E TLA Y A+G +
Sbjct: 556 FEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/533 (53%), Positives = 376/533 (70%), Gaps = 15/533 (2%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEPD+S     +   K+ YA+ LK+KGN +F  ++F  A+KYY  A+ L   DPVFYSN
Sbjct: 85  NGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTL-KQDPVFYSN 143

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           ISACY+S G L KV+E +T+AL++K D+SKALLRRASA ESL N+ DAM DLSVLSLNGD
Sbjct: 144 ISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAMVDLSVLSLNGD 203

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283
           F+GASIEPMLERNLNKQAM+VL E +++      QLLPSNTSL SFFG+F P++ ++  N
Sbjct: 204 FNGASIEPMLERNLNKQAMQVLKEKIAENK---PQLLPSNTSLASFFGVFKPEVSLNNFN 260

Query: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGP-LKENAAL 342
            +S  +     L + L  LYS TN+GYL AD+ F  A            +   +KE  A+
Sbjct: 261 ENSESEKE---LLNGLTNLYSRTNDGYLVADESFQKAVKLLEKEYEENKENNDIKEKYAI 317

Query: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402
           A  Y GI  FLKN+ L A   +Q++I + P  NSYI+ +L LADK  ++E  K F  AI+
Sbjct: 318 ALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILADKGETEESIKNFDAAIN 377

Query: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462
           LD+    TYYHRGQ+YF+ Q Y  A  DF KA+ L   NI PYIQLACL YK+ KF + E
Sbjct: 378 LDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLAYKENKFNDCE 437

Query: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522
            LF+E + KFPT PEVP F+A++L ++ +F  A+KQYDI+K+LEE  E IHVGI P+IGK
Sbjct: 438 TLFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKLEEAVEGIHVGIAPMIGK 497

Query: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582
           AT+LAR    +P     E    +  L  +AC+LDPRSEQAKIGLAQLKLQ E++D+AI L
Sbjct: 498 ATLLAR----NPIV---ENLLESTELFEEACKLDPRSEQAKIGLAQLKLQQEEVDEAIAL 550

Query: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           F+++A LAR MDEKLQATTFAEA+K+QK++R+DP+I+ K++ TLA+Y+ +G++
Sbjct: 551 FEEAAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQGLM 603

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/533 (51%), Positives = 367/533 (68%), Gaps = 15/533 (2%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEPD+S +   T  QK+ YA+ LK+KGN  F  + + EAIK+Y CA++L   DPVFYSN
Sbjct: 75  NGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSN 133

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
            SACY+    L KV+E TT AL++KPD+SK LLRRA+ANESLGN+ DAM DLS +SL G 
Sbjct: 134 RSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVSLYGG 193

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283
           +   +IEP+LERN+NKQAM+VL + LS G+      LPSNTSL SFF IF  +  +   +
Sbjct: 194 YSSQTIEPVLERNMNKQAMQVLKQKLSGGE---KHELPSNTSLASFFRIFPSETSLENYD 250

Query: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVD-GPLKENAAL 342
            +S  D    +L   L  L++     Y  AD+ FT A + + +   +  D   LK+  A+
Sbjct: 251 ETSEADR---ILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAI 307

Query: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402
           A  + GI  FLKN  L A  LLQ++I+L P PNSYI++ L +ADK  + E+ + F+KA++
Sbjct: 308 ALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALE 367

Query: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462
           LD +    YYHR QM F++Q +  A  DF KA+   P  +YPYIQLACL Y++ KF + E
Sbjct: 368 LDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCE 427

Query: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522
            LF+E + +FPT PEVP F+AEIL+DKGDF  A+K+YD A++LE+ QE IHVG+ PL+GK
Sbjct: 428 TLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGK 487

Query: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582
           A +LARQ S          F  A  L   ACE DPRSEQAKIGLAQLKLQ E++D+AI+L
Sbjct: 488 AALLARQPSAS-------NFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKL 540

Query: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635
           F+ +A L+R  +EKLQATTFAEAAKIQKR+RADP++SAK++ TL +YRA+GM+
Sbjct: 541 FEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/532 (52%), Positives = 365/532 (68%), Gaps = 13/532 (2%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NG+PD+S+    T  Q   YA+ LK+KGN FF  K+F +AI+YY  AI L   DPVFYSN
Sbjct: 84  NGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSN 142

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
            SA Y+S  +  KV+E TT AL++KPD+SK  LRRASA E+LG F+DAMFDLS +SL G+
Sbjct: 143 RSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGE 202

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283
           + G S+E +LERN+NKQA KVL E L +  G+ S L PSNTSL SFFGIF+P+      +
Sbjct: 203 YSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPL-PSNTSLASFFGIFNPETSFDDYD 261

Query: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDG-PLKENAAL 342
             +  D     L   L+ LY      Y  AD+ FT A + Y   L S  D   LK+ AA+
Sbjct: 262 GENEADVE---LKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318

Query: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402
           AF + GIF F KN+ + A   L+ES++L+P P++YI++AL +ADK  + ++ +YF KA++
Sbjct: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378

Query: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462
           LD      YYHRGQM+F+++++  A ADF KA+ L PENI+ YIQ ACL ++  +F + E
Sbjct: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438

Query: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522
            LF+E + KFPT PEVP F+AEIL  K     AIKQYDIA +LE+    IHVGI P+IGK
Sbjct: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498

Query: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582
           AT L R    +PT    E F  A  L  +AC++DPRSEQAKIGLAQLKLQ E+IDDAI+L
Sbjct: 499 ATALIR----NPTV---ENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQL 551

Query: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGM 634
           F+D+A L+R+ DEKLQATTFAEA K+QK++RADP I  K++  +A+YRA+G+
Sbjct: 552 FEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/529 (54%), Positives = 361/529 (68%), Gaps = 14/529 (2%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEP +  +  L    K+ +A  LK KGN  F  K+F  AIKYY  A+ L   DPV+YSN
Sbjct: 75  NGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSL-KEDPVYYSN 133

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           ISACY S  +  KV+E  TKAL ++PD+SK L+RRA+A E LGNF DAMFDLSV SLN D
Sbjct: 134 ISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSVCSLNTD 193

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283
              ASIEP+LERNLN+QAM VLN  L   D +    LPSNT+LTSFFGIF P+L  +  +
Sbjct: 194 MSDASIEPILERNLNQQAMFVLNTKLGVTDKKSQ--LPSNTALTSFFGIFKPELSFANYD 251

Query: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGP-LKENAAL 342
           ++   D     L + L+ LY  T EGY TAD  FT AT+ +   L+   D   +KE  A+
Sbjct: 252 DTCEGDKE---LLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETVKEKTAI 308

Query: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402
           A  + GIF FLKNN L A   +++++ LHP  NSYI++AL LADK ++  +F  ++KA+ 
Sbjct: 309 ALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFANYEKAMK 368

Query: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462
           LD +    YYHRGQMYFI Q Y  A  DF KA+ L PENI+PYIQLACL Y++ KF + E
Sbjct: 369 LDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDCE 428

Query: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522
            LF+E + KFP   EVP F+AEIL DKGDF  A+K+Y+ A  LE+ Q+ +HVGI PL+GK
Sbjct: 429 TLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQDAVHVGIAPLVGK 488

Query: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582
           AT+L R     PT    E F  A +LL +A + DPRSEQAKI L QLKLQ E ID+AIEL
Sbjct: 489 ATLLVRT----PTV---ENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEAIEL 541

Query: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRA 631
           F+ +A LART +EKLQATTFAEAAKIQKR+RADP +SAK++ T+A+ RA
Sbjct: 542 FESAATLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALRA 590

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  505 bits (1301), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 277/541 (51%), Positives = 363/541 (67%), Gaps = 22/541 (4%)

Query: 105 GEPDISQLKGLTLSQ---KQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFY 161
            +PD +++  L  +    K  +A +LKNKGN +F +K+   AIKYY+ A+ LD  DPVFY
Sbjct: 136 NDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLD-QDPVFY 194

Query: 162 SNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLN 221
           SNISACY +   L+KV+E + KALE+KPD+SKALLRRA+A E+LGN  +A++D S+LSL 
Sbjct: 195 SNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDFSILSLF 254

Query: 222 GDFDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISR 281
           G++ G  +EP+L R L+K +  VL   L         LL S+++L SFFGIF P+  I+ 
Sbjct: 255 GEYSGQYLEPLLNRILDKVSTDVLRAKLDNKKTDNFILL-SDSALVSFFGIFPPETTITN 313

Query: 282 VNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGP----LK 337
            N     D     L   L+ L   T+EG+L ADK F  A + +   L S  D      L 
Sbjct: 314 YNPDDEADKE---LVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDENSGLL 370

Query: 338 ENAALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQ---EFF 394
           E  A+A  Y+G+F FLK +LLG++  LQ++I+L+P PNSYI++A+ +ADK N +   ++F
Sbjct: 371 EKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKNDLDYF 430

Query: 395 KYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYK 454
           KYF KA  L+  + PTYYHRGQ+  + Q +  A+  F KA+ L   N+YPYIQLAC+ Y 
Sbjct: 431 KYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLACVAYY 490

Query: 455 QGKFTESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHV 514
              F + + LF+E + KFPTLPEVP F+AEIL DKG+   A+KQYDIA RLE   + IHV
Sbjct: 491 NSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETAYKYIHV 550

Query: 515 GIGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQME 574
           GI PLIGKA  LAR     PTQ   E F+T   LL KACELDPRSEQAKI LAQLKLQ E
Sbjct: 551 GIAPLIGKAAALARI----PTQ---ENFDTMTELLEKACELDPRSEQAKISLAQLKLQTE 603

Query: 575 KIDDAIELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGM 634
            ID AI LF+++A LART  +KLQATTFAEAAKIQKR++ +PI +AK+E TLA+YRA G+
Sbjct: 604 DIDTAIALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADGI 663

Query: 635 I 635
           I
Sbjct: 664 I 664

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  497 bits (1279), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 264/534 (49%), Positives = 351/534 (65%), Gaps = 14/534 (2%)

Query: 101 FLPNGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVF 160
            + N EPDI  +K    ++K  YA +LK +GN +F  K++  AI YY+ A++L  NDPVF
Sbjct: 63  LMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQL-KNDPVF 121

Query: 161 YSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSL 220
           YSN++ACYIS     + +E  +KALE+ PD+SK LL+RA+  E++G F DA+ DL+ +SL
Sbjct: 122 YSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSL 181

Query: 221 NGDFDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEIS 280
           NGD++ A+I+P++ER LNKQAM  L ++L   +   +++LPS TS+ +FFG+FD + +I 
Sbjct: 182 NGDYNDATIQPIVERVLNKQAMMALKDHLEASEK--NKVLPSYTSMAAFFGVFDAETDIP 239

Query: 281 RVNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLAS-QVDGPLKEN 339
             + +   D    +LSDAL  LYS T EGY   D  FT AT+ Y + L + + +    E 
Sbjct: 240 GHDATEESDK---ILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEK 296

Query: 340 AALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQK 399
           AA+AF +T I  FLKN+ L A+ L+ E+I LHP P SYI+L L +ADK   +E++  FQK
Sbjct: 297 AAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQK 356

Query: 400 AIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFT 459
           AIDLD      YYHRGQM FI+Q Y  A  DF KA+   P NI+PYIQLAC+ Y++G F 
Sbjct: 357 AIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFD 416

Query: 460 ESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPL 519
           + E LF+E + KFP  PEVP FFAEIL+DKG+   A  +YD A  LE   E IHVGI PL
Sbjct: 417 DCETLFSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPL 476

Query: 520 IGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDA 579
           +GKAT L +     PT    E F  A  L  +A   DPRSE+AK+GLAQ KLQ E +DDA
Sbjct: 477 VGKATTLLKY----PTV---ENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDA 529

Query: 580 IELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKG 633
           I LF+++AIL RT+DEKLQATTFAEA K+Q R+RAD  + AK    L   R  G
Sbjct: 530 IRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  491 bits (1265), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 262/531 (49%), Positives = 349/531 (65%), Gaps = 16/531 (3%)

Query: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163
           NGEP++S +  LT   K  +A+ LK+KGN  F T  F +AIKYY  A++L  +DP++YSN
Sbjct: 90  NGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSN 148

Query: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223
           ISACY S     KV+EY TKAL+++P  SK L+RRA A E++GNF DAMFD+S  SLNGD
Sbjct: 149 ISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGD 208

Query: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283
            + ASIEP+LER LNKQA  VL E +S       Q LPS+T L SFF +F P+   +   
Sbjct: 209 MNDASIEPILERILNKQAEFVLKEKIS---ANKEQNLPSSTPLASFFRVFKPETSFANYE 265

Query: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDG-PLKENAAL 342
            S+  D     L + L  LY  + EG+  ADK F  A + +   L+   D   +KE  A+
Sbjct: 266 ESNEADRE---LMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAI 322

Query: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402
           A  Y+GI +++KN  L A   ++ +I LHP  NSYI+ +L  +D   + E+ + F KA++
Sbjct: 323 ALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALE 382

Query: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462
           L+   P  YYHRGQ YFI Q Y  A  DF K + L   NI+ YIQLACL Y++ KF + E
Sbjct: 383 LEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCE 442

Query: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLE-EVQEKIHVGIGPLIG 521
            LF+E + KFPT PEVP FFAE+L D+G+   A+K++D A  LE +  E+IHVGI PLIG
Sbjct: 443 TLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIG 502

Query: 522 KATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIE 581
           KAT+L  +    PT    E F   I LL +AC+ DPRSEQA++GLAQLKLQ E ID+AI+
Sbjct: 503 KATLLISK----PTV---ENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQ 555

Query: 582 LFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAK 632
           LF+++A LA++ +EKLQATTFAEAAKIQKR+RADP + AK+  T+   R++
Sbjct: 556 LFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 53/95 (55%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A+ LKN+GN +   K +T+A++YY  AIELD    +F+SN +   +   +    L+    
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           ALE+ P + KA  RR  +   L +F  A  DLS++
Sbjct: 73  ALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV 107

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 52/95 (54%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           AV+ KN+GN F   +N+++AI+ Y  AIELDPN  +FYSN +   +   +         +
Sbjct: 12  AVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNE 71

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           AL +   + KA  RR  AN  L  F  A  DL+V+
Sbjct: 72  ALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAI--ELDPNDPVFYSNISACYISTGDLNKVLEYT 181
           A +LK KGN  F +K+FT AI+Y+  AI     PN  V YSN SACY S     + L   
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNH-VLYSNRSACYTSLKQFQEALNDA 62

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
            + ++I PD SK   R  +A+  LG+  DA
Sbjct: 63  QQCVKINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +FT  ++  A+K Y   I+  P D   YSN +A         + ++   KA+E  P
Sbjct: 396 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDP 455

Query: 190 DHSKALLRRASANESLGNFTDAMFDL 215
           +  +A LR+A+A  ++ +F  A+  L
Sbjct: 456 NFVRAYLRKATAQIAIKDFVKALETL 481

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A  LK +GN  F  K+F  A+K Y  AIEL PN+ VFY N +A Y S     + +     
Sbjct: 96  AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAES 155

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
           A+ I P +S+   R   A  +LG   +AM     VL + GD
Sbjct: 156 AVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGD 196

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 52/95 (54%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A++ KN+GN F   K + EA++YY  AIELD    +F+SN +   +   +    LE   K
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           ++E+ P + KA+ RR  +   L  F+ A  DL  +
Sbjct: 72  SIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLEYT 181
           A + K +GN  F  K+F +AI+ +  AIE+   PN  V YSN SACY ST   NK LE  
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKPNH-VLYSNRSACYTSTKQFNKALEDA 61

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
            + + I P  SK   R  +A+  LG+  +A
Sbjct: 62  KQCVNINPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +FT  ++  A+K Y   I+  P D   YSN +A         + ++    A+   P
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 190 DHSKALLRRASANESLGNFTDAMFDL 215
           +  +A +R+A+A  ++  F   +  L
Sbjct: 459 NFIRAYIRKATAQIAVREFVSVIETL 484

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE 186
           K +GN F+  + F EAI++Y  A EL   D  + +N +A     G+    ++  T+A+E
Sbjct: 263 KAEGNKFYKARKFDEAIEHYSKAWELH-KDITYLNNRAAAEYEKGEYETAIKTLTEAVE 320

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 9/75 (12%)

Query: 122 TYAVQLKNKGNH---------FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTG 172
           T A+++  K NH         + +TK F +A++  +  + ++P     Y+ + A +   G
Sbjct: 27  TKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVNINPAWSKGYNRVGAAHFGLG 86

Query: 173 DLNKVLEYTTKALEI 187
           DL++  +   KALE+
Sbjct: 87  DLDEAEQGYKKALEL 101

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 70/152 (46%), Gaps = 9/152 (5%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A++ KN+GN F   KNF++A + Y  AIELD    +++SN +  ++   +    L    K
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMK 243
           A+E+ P + KA  RR  +   L  F  A  DL ++           EP+  R L+     
Sbjct: 72  AIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV-----LRAKPNEPVATRALDVCERV 126

Query: 244 VLNENLSKGDGRGSQLLPSNT----SLTSFFG 271
           +  E   K    GS  +  N     +L+SF G
Sbjct: 127 IRKEKFEKAISGGSDAVTVNVCEKLNLSSFEG 158

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 59/106 (55%), Gaps = 3/106 (2%)

Query: 120 KQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDL-NKVL 178
           K+  A  LK +GN   + KN+  AI  Y  AIE+ P++P +YSN +A Y    D  N VL
Sbjct: 94  KKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVL 153

Query: 179 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
           +  T A+++ P +SKA  R  +A  + GN  DA+     VL L GD
Sbjct: 154 DANT-AIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGD 198

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 50/92 (54%), Gaps = 3/92 (3%)

Query: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLE 179
           T A + K +GN  F  K+F +AI+ +  AIE+   PN  V YSN SACY S     + L 
Sbjct: 2   TTAEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNH-VLYSNRSACYASMRKFREALA 60

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDA 211
              + + IKPD SK   R  +A+  LG+  +A
Sbjct: 61  DAQECVRIKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +FT  ++  A+K Y   I+  P D   YSN +A           ++    A++  P
Sbjct: 394 QGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDP 453

Query: 190 DHSKALLRRASANESLGNFTDAMFDL 215
           +  +A +R+A+A  ++  +  A+  L
Sbjct: 454 NFVRAYIRKATAQIAVQEYAAAIETL 479

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 51/105 (48%), Gaps = 8/105 (7%)

Query: 115 LTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDL 174
           + ++  ++ A + K KGN  +  + F EAI  Y+ A +L   D  + +N +A     GD 
Sbjct: 245 MHVNNDRSKAEEAKAKGNELYKKRQFDEAIANYEKAWDLH-KDITYLNNRAAAEYEKGDY 303

Query: 175 NKVLEYTTKAL----EIKPDH---SKALLRRASANESLGNFTDAM 212
              ++   KA+    E++ D+   +K+  R  +A+  L +   A+
Sbjct: 304 ESAIKTLEKAVEEGRELRADYKVIAKSFARLGNAHYKLADLKKAI 348

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 52/95 (54%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A++ K++GN F  +K++ +AI+ Y  AIELD    +F+SN +   +        LE ++K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           A+E+   + K   RR  A   L +F  A  DL V+
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 399 KAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYP-ENIYPYIQLAC 450
           KAI+LDS     Y+ RG  Y  LQD+++AK D +    + P E       LAC
Sbjct: 68  KAIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPGEATAKRTLLAC 120

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPN-DPVFYSNISACYISTGDLNKVLEYTT 182
           A + K +GN  FT+K+F +AI+ +  AIE+ P  + V YSN SA Y S     + L   T
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 183 KALEIKPDHSKALLRRASANESLGNFTDA 211
           + ++I P  SK   R  +A   LGN  +A
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 42/83 (50%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +FT  ++  A+K Y   I+  P D   YSN +A         + ++    A++  P
Sbjct: 395 EGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDP 454

Query: 190 DHSKALLRRASANESLGNFTDAM 212
           +  +A +R+A+A  ++  + +A+
Sbjct: 455 NFVRAYIRKATAQIAIKEYANAL 477

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 51/90 (56%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLEYT 181
           A Q K +GN  F +K++ +AI+ +  AIE+   PN  V +SN SACY S  D  K L+  
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNH-VLFSNRSACYASNKDFVKALDDA 61

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
            + ++I P  +K   R  +A+  LG+  +A
Sbjct: 62  NECVKINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 55/121 (45%), Gaps = 12/121 (9%)

Query: 103 PNGEPDISQLKG----LTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDP 158
           P  EP +   K     + +   ++ A   K +GN  +  + F EAI+ Y  A E   ND 
Sbjct: 230 PKAEPKVETKKPEPEPMEVDDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETH-NDI 288

Query: 159 VFYSNISACYISTGDLNKVLEYTTKAL----EIKPDH---SKALLRRASANESLGNFTDA 211
            + +N +A     GD    +E  TKA+    E++ D+   SK+  R  ++   LG+   A
Sbjct: 289 TYLNNRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKA 348

Query: 212 M 212
           +
Sbjct: 349 I 349

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 56/113 (49%), Gaps = 1/113 (0%)

Query: 100 TFLPNGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPV 159
           T L N E ++ Q +  +    +  A + + +G  +FT  ++ +A++ Y   I+ +PND  
Sbjct: 366 TKLRNTEKELKQKEAESYMDPEK-AEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDAR 424

Query: 160 FYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAM 212
            YSN +A           +    KA+E  P+  +A +R+A+   ++ ++  A+
Sbjct: 425 GYSNRAAALSKLMSFADAIRDCDKAIEKDPNFVRAYIRKATGQIAIKDYAGAI 477

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 58/120 (48%), Gaps = 7/120 (5%)

Query: 105 GEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNI 164
           GEP ++        + +  A  LK +GN     K++  AI+ Y  AIE+ P D V+Y+N 
Sbjct: 77  GEPKVAA------EELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANR 130

Query: 165 SACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS-VLSLNGD 223
           +A Y S     K +E   KA ++   +SK   R   A  +LG   +A+     VL + GD
Sbjct: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLEYT 181
           A + K++GN  F  KN+ EAI+ +  AIE+   PN  V YSN SACY S     K LE  
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNH-VLYSNRSACYTSKKQFVKGLEDA 63

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
            + ++I P  SK   R  +A+  +G+  +A
Sbjct: 64  NECVKINPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +FT  ++  A+K Y   I  DP+D   YSN +A         + +     A+E  P
Sbjct: 395 EGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDP 454

Query: 190 DHSKALLRRASANESLGNFTDAMFDL 215
           +  +A +R+A+A  ++ +F  A+  L
Sbjct: 455 NFIRAYIRKATAQIAIKDFVPAIETL 480

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE 186
           K +GN  +    F EAI++Y  A EL  ND  + +N SA     GD    +E   +A+E
Sbjct: 259 KAEGNKLYKAHKFDEAIEHYNKAWELH-NDITYLNNRSAAEFEKGDYQTAIETLHEAVE 316

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 46/90 (51%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLEYT 181
           A + K +GN  F  K+F +A + +  AIE    PN  V YSN SACY S     + LE  
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETPNH-VLYSNRSACYTSLKKFKEALEDA 61

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
            + ++I P  SK   R  +A   LGN  DA
Sbjct: 62  EECVKINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 10/128 (7%)

Query: 113 KGLTLSQKQTY-----AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISAC 167
           K L L + ++Y     A + + +G  FFT  ++  A+  Y   I+  P D   YSN +A 
Sbjct: 385 KELKLREAKSYIDPEKAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAV 444

Query: 168 YISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSV-----LSLNG 222
                     ++    A+   P+  +A +R+ASA  ++  F  AM  L       L +N 
Sbjct: 445 LAKLMSFPDAIKDCDVAISKDPNFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINK 504

Query: 223 DFDGASIE 230
             +   IE
Sbjct: 505 GANAREIE 512

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 15/95 (15%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKAL-- 185
           K +GN ++  + F EAI++Y  A +L   D  + +N SA     GD  + ++  T+A+  
Sbjct: 271 KAEGNKYYKARKFDEAIEHYNKAWDLH-RDVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQ 329

Query: 186 --EIKPDH---SKALLRRASANESLGNFTDAMFDL 215
             E++ D+   SK+  R       +GN    M DL
Sbjct: 330 GREMRADYKLISKSFAR-------IGNAYLKMDDL 357

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLEYT 181
           A + K +GN  FT K++ +AI  +  AIE+   PN  V YSN SACY S       L   
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNH-VLYSNRSACYTSLKKFTDALNDA 63

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
           T+ ++I P  SK   R  +A+  LG+  DA
Sbjct: 64  TECVKINPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +FT  ++  A+K Y   I+  P D   YSN +A         + +    KA+E  P
Sbjct: 399 EGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 458

Query: 190 DHSKALLRRASANESLGNFTDAMFDL 215
           +  +A +R+A+A  ++  F  A+  L
Sbjct: 459 NFVRAYIRKATAQIAVQEFAGALETL 484

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 8/88 (9%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKAL-- 185
           K +GN F+  + F EAI++Y  A EL   D  + +N +A     GD    +   T A+  
Sbjct: 263 KAEGNKFYKARQFEEAIEHYNKAWELH-RDITYLNNRAAAEYEKGDYETAIATLTDAVEQ 321

Query: 186 --EIKPDH---SKALLRRASANESLGNF 208
             E++ D+   SK+  R  +A   LG+ 
Sbjct: 322 GREMRADYKVISKSFARIGNAYHKLGDL 349

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 79/169 (46%), Gaps = 11/169 (6%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A++ KN+GN     +++ +AI+ Y  AIELD    V++SN + C++   +     +   K
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPM--LERNLNKQA 241
           AL + P + KA  RR  A   L  F  A  DL+V+      D A+   +   E+ + ++ 
Sbjct: 69  ALALDPKNVKAYHRRGLACVGLLEFKKARADLTVVLKAKPSDAAAKRALDICEKVIREER 128

Query: 242 MKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFD------PDLEISRVNN 284
            +   + +  GD      L S  +L+SF    D      P LE  ++ N
Sbjct: 129 FR---KAIGGGDSDSKPKLCSTLNLSSFDANSDLAKYDGPSLEFEQLKN 174

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 92/208 (44%), Gaps = 24/208 (11%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A   K++GN F   ++F  A + Y  AIE DP   +FYSN +   +   +    L   T 
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTN 68

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLS---------VLSLNGDFDGASIEPMLE 234
           A+E+   + KA  RR  AN  L NF  A  D +         +++ NG FD  + E ++ 
Sbjct: 69  AIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIAKNG-FD--TCEKVIR 125

Query: 235 RNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFD------PDLEISRVNNSSHF 288
               K+A+   +E        G   +  +TSL+SF    D      P+LE  ++ N    
Sbjct: 126 EERFKKAIGGSDEKT------GGATICQSTSLSSFDANADLSKYAGPELEFKQLTNEKGE 179

Query: 289 DTAYALLSDALQKLYSATNEGYLTADKL 316
           ++   +++ +   + S  N+ +L    L
Sbjct: 180 NSGIEVINMSQSFISSLVNDVFLKGKNL 207

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 53/95 (55%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A++ KN+GN F   K+F +AI+ Y  AI+LD    +++SN +  +    +    L    +
Sbjct: 12  ALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           AL++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 72  ALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 55/101 (54%)

Query: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177
           S++   A++LKN+GN F   ++FT+AI  Y  AI LD    +++SN +  ++   +    
Sbjct: 6   SEQSAEALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSS 65

Query: 178 LEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           L    +AL++ P ++KA  RR  +   L  F  A  DL ++
Sbjct: 66  LNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIV 106

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 51/101 (50%), Gaps = 1/101 (0%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A +LK +GN     K+F  AI  Y  AI + PN+ ++Y+N +A Y S  D  K  E    
Sbjct: 99  AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAES 158

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
           A+ + P++SK   R   A  +L    +A+     VL L GD
Sbjct: 159 AIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGD 199

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +GN     K F EAI+ Y  AIE+ P++ V+YSN +A Y S     + ++   +A+E+ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 190 DHSKALLR 197
            +SK   R
Sbjct: 161 TYSKGFSR 168

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 48/95 (50%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           AV  KN+GN +   +N+ +AI+ Y  AIELDP   +F+SN +   +   +    +     
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDV 71

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           AL + P + KA  RR  ++  L     A  DL V+
Sbjct: 72  ALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A++ KN+GN F   K+F +AI+ Y  AI+LD    +++SN +  +    +    L    +
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           A+++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 55/101 (54%), Gaps = 1/101 (0%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A  LK +GN    +K+F  AIK Y  AIE+ P++ V+Y+N +A Y S     + ++    
Sbjct: 97  AEDLKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAES 156

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
           A+++ P +SK   R   A  +LG   +A+    +VL + GD
Sbjct: 157 AIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGD 197

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A++ KN+GN F   K+F +AI+ Y  AI+LD    +++SN +  +    +    L    +
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           A+++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 50/95 (52%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A++ KN+GN +   K + EA++YY  AIELD    +++SN +   +   +     E   K
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           A+ + P + KA+ RR  +   L  F  A  DL V+
Sbjct: 70  AIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 49/92 (53%), Gaps = 3/92 (3%)

Query: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLE 179
           T A + K +GN  F  K++ +AI  +  AIE+   PN  VFYSN SACY S     + L 
Sbjct: 2   TTADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNH-VFYSNRSACYASLKKFPEALN 60

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDA 211
              + ++I P  SK   R  +A+  LG+  +A
Sbjct: 61  DAEECVKINPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +FT  ++  A+K Y   I+  P D   YSN +A         + +E   KA+E  P
Sbjct: 396 EGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDP 455

Query: 190 DHSKALLRRASANESLGNFTDAMFDL 215
           +  +A +R+A+A  ++  F  A+  L
Sbjct: 456 NFIRAYIRKATAQIAVKEFAAAIETL 481

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 48/122 (39%), Gaps = 9/122 (7%)

Query: 341 ALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKE-NSQEFFKYFQK 399
           A +F   G  H   NNL  A    Q+S+  H TP   I   L   +KE   QE  +Y   
Sbjct: 330 AKSFARMGNVHHKTNNLKKAIEFYQKSLTEHRTPE--ILTKLRNTEKELKKQEAEEY--- 384

Query: 400 AIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFT 459
              ++ E        G+ YF   D+ NA   + +     PE+   Y   A  L K   F 
Sbjct: 385 ---INPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFP 441

Query: 460 ES 461
           E+
Sbjct: 442 EA 443

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 8/89 (8%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVL----EYTTKALE 186
           GN  +  + F EAI +Y  A  L   D  + +N SA     GD    L    E   K  E
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLH-QDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 187 IKPDH---SKALLRRASANESLGNFTDAM 212
           ++ D+   +K+  R  + +    N   A+
Sbjct: 322 MRTDYKLIAKSFARMGNVHHKTNNLKKAI 350

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 52/95 (54%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A++LKN+GN F   K + +A +YY  AIE DP + + YSN +   +   +    L+   +
Sbjct: 13  ALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKR 72

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           A+E+  ++ KA  RRA +   L  F  A  DL ++
Sbjct: 73  AIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLEYT 181
           A + K +GN  FT K++ +AI+ +  AIE+   PN  V YSN SACY S    +  L   
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNH-VLYSNRSACYTSLKKFSDALNDA 63

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
            + ++I P  SK   R  +A+  LG+  +A
Sbjct: 64  NECVKINPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +FT  ++  A+K Y   I+  P D   YSN +A         + +    KA+E  P
Sbjct: 402 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 190 DHSKALLRRASANESLGNFTDAMFDL 215
           +  +A +R+A+A  ++  +  A+  L
Sbjct: 462 NFVRAYIRKATAQIAVKEYASALETL 487

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKAL-- 185
           K +GN F+  + F EAI++Y  A EL   D  + +N +A     G+    +     A+  
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGEYETAISTLNDAVEQ 324

Query: 186 --EIKPDH---SKALLRRASANESLGNF 208
             E++ D+   SK+  R  +A   LG+ 
Sbjct: 325 GREMRADYKVISKSFARIGNAYHKLGDL 352

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 1/106 (0%)

Query: 119 QKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVL 178
           +++  A  LK +GN    TK++  AIK Y  AIE+ P + V+Y+N +A Y S    +  +
Sbjct: 88  EQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAV 147

Query: 179 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
                A+++ P +SK   R   A  + G   DA+     VL + GD
Sbjct: 148 NDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGD 193

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 46/90 (51%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLEYT 181
           A + K +GN  F  K + EA+  +  AIE+   PN  V YSN SA Y S    N+ L+  
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETPNH-VLYSNRSASYASEQKFNEALKDA 63

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
            +  +I P  +K   R  +A+  +GN  DA
Sbjct: 64  LECTKINPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 8/96 (8%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGD----LNKVLE 179
           A + K +GN  +  +NF EAI  Y  A ELD N+  + +N SA     G+    +N + E
Sbjct: 251 AEEAKVEGNKAYKARNFDEAIACYNKAWELD-NNITYLNNRSAAEFEKGEYDTAINTLNE 309

Query: 180 YTTKALEIKPDH---SKALLRRASANESLGNFTDAM 212
              K  E++ D+   +K+  R  +A   +GN  +A+
Sbjct: 310 AIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAI 345

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +FT  ++  A+K Y   I+  P D   YSN +A           +    KA+E  P
Sbjct: 391 EGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDP 450

Query: 190 DHSKALLRRASANESLGNFTDAMFDL 215
           +  +A +R+A+A  ++ +F+ A+  L
Sbjct: 451 NFVRAYIRKATAQIAVKDFSYAIETL 476

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLEYT 181
           A + K +GN  FT K++ +AI+ +  AIE+   PN  V YSN SACY S    +  L   
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTPNH-VLYSNRSACYASLKKFSDALNDA 63

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
            + + I P  SK   R  +A+  LG+  +A
Sbjct: 64  KECININPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +FT  ++  A+K Y   I+  P D   YSN +A         + +    KA+E  P
Sbjct: 402 EGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 190 DHSKALLRRASANESLGNFTDAMFDLSV 217
           +  +A +R+A+A  ++  +  A+  L  
Sbjct: 462 NFVRAYIRKATAQIAVQEYAAALETLDA 489

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 14/91 (15%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGD-------LNKVLEY 180
           K +GN F+  + F EAI++Y  A EL   D  + +N +A     G+       LN  +E 
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELH-RDITYLNNRAAAEYEKGEYKTAIATLNDAVE- 323

Query: 181 TTKALEIKPDH---SKALLRRASANESLGNF 208
             +  E++ D+   S++  R  +A   LG+ 
Sbjct: 324 --QGREMRADYKVISRSFARIGNAYHKLGDL 352

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 51/95 (53%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A++ KN+GN    T+++  AI+ Y  AI+LD    +++SN +  ++   +    +    K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           ALEI P + KA  RR  +   L  F +A  DL ++
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV 106

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 69/149 (46%), Gaps = 8/149 (5%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A++ K++GN +  ++++ +AI+ Y  AIELD    +FYSN +  ++   +    L     
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMK 243
           A+++  ++ KA  RR  A   L  F  A  DL++L      D  +     +R L      
Sbjct: 72  AIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTILLKYKPNDATA-----KRGLEMCESF 126

Query: 244 VLNENLSK---GDGRGSQLLPSNTSLTSF 269
           +  E   K   GD  G   L    SL+SF
Sbjct: 127 IREERFKKAIGGDDHGKVKLCQTVSLSSF 155

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 77/178 (43%), Gaps = 11/178 (6%)

Query: 100 TFLPNGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPV 159
           T   +G P   +   +T +     A+  KN+GN +   K++  A++ Y  AIE D    +
Sbjct: 18  TVAGSGHPSPPRRDSMTAAT----ALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSI 73

Query: 160 FYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL- 218
           F+SN +   +        LE + +A+E+   + KA  RR  A+  L  +  A  DL V+ 
Sbjct: 74  FFSNRALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVV 133

Query: 219 -SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQ-LLPSNTSLTSFFGIFD 274
            +  GD        + ER L ++      E   + DG   Q  L    SL SF G  D
Sbjct: 134 RAKPGDEAVRRALEVCERMLRRERF----ERAIRADGDEEQRRLCKTLSLASFAGNAD 187

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPN-DPVFYSNISACYISTGDLNKVLEYTT 182
           A + K +GN  F+ K + +A+  +  AIE+ P  + V YSN SACY S       L    
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDAN 64

Query: 183 KALEIKPDHSKALLRRASANESLGNFTDA 211
           +  +I P  SK   R  +A+  LG+  +A
Sbjct: 65  ECTKINPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A + + +G  FF    + +A+K Y   I   P+D   YSN +A         + +    K
Sbjct: 392 AEEARIQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEK 451

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSV 217
           ALE  P+  KA +R+A+A  ++  ++ A+  L +
Sbjct: 452 ALEKDPNFVKAYIRKATAQIAIKEYSSALETLDI 485

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 44/91 (48%), Gaps = 8/91 (8%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLN---KVLE-YTTK 183
           K++GN  +    F EAI++Y  A EL  ND  + +N +A     GD     K LE    K
Sbjct: 262 KDEGNKLYKAHKFDEAIEHYDKAWELH-NDITYLNNKAAAQYEKGDYETTIKTLEDAIEK 320

Query: 184 ALEIKPDH---SKALLRRASANESLGNFTDA 211
             E++ D+   +KA  R  +A E L +   A
Sbjct: 321 GRELRADYKIIAKAFTRMGNAYEKLNDLKKA 351

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIEL-DPNDPVFYSNISACYISTGDLNKVLEYTT 182
           A + K +GN  FT KN+  AI+ +  AIE+ +    V +SN SACY S    +  L    
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDAN 64

Query: 183 KALEIKPDHSKALLRRASANESLGNFTDAMFD 214
           + ++I P  SK   R  +A+  LG+  +A  D
Sbjct: 65  ECVKINPSWSKGYNRLGAAHLGLGDLDEAESD 96

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +FT  ++  A+K Y   I+  P D   YSN +A         + +    KA+E  P
Sbjct: 402 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 190 DHSKALLRRASANESLGNFTDAMFDLSV 217
           +  +A +R A+A  ++  F  A+  L V
Sbjct: 462 NFVRAYIRMAAAQIAVKEFAAALETLDV 489

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 8/88 (9%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE- 186
           K +GN F+    F EAI++Y  A EL   D  + +N +A     GD   V+     A+E 
Sbjct: 266 KAEGNKFYKAHQFDEAIEHYNRAWELH-KDITYLNNRAAAEYEKGDYETVIATLNDAVEK 324

Query: 187 ---IKPDH---SKALLRRASANESLGNF 208
              ++ D+   SK+  R  +A   LG+ 
Sbjct: 325 GRDMRADYKVISKSFARIGNAYHKLGDL 352

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 3/92 (3%)

Query: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIE--LDPNDPVFYSNISACYISTGDLNKVLE 179
           T A + K +GN  F  K+F  A++ +  AI+   +PN  V YSN S  Y S    ++ L 
Sbjct: 2   TSAEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNH-VLYSNRSGAYASLKKFDEALS 60

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDA 211
             T+ ++IK D SK   R  +A+  LGN  +A
Sbjct: 61  DATECVKIKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G  +FT  ++  A+K Y   I   P+D   YSN +A           ++   KA+EI P 
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 191 HSKALLRRASANESLGNFTDAMFDLSV 217
             +A +R+A+A  ++  ++ A+  L V
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETLDV 485

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A + K +GN  +  + F EAI  Y+ A  L   D  + +N +A     GD N  ++   +
Sbjct: 258 AEKAKAEGNQLYKQRKFDEAIAKYEEAWNLQ-KDITYLNNRAAAEYEKGDYNSAIKTLNE 316

Query: 184 ALE 186
           A+E
Sbjct: 317 AVE 319

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 51/95 (53%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A + KN+GN     K+F +AI+ Y  AI+LD    +++SN +  +    +    L    +
Sbjct: 12  AHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDE 71

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           A+++ P + KA  RRA +  +L  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177
           ++ +  A  LK +GN     K+F  AIK Y  AIE+ P + V+Y+N +A + S     + 
Sbjct: 91  AETKAKAETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEA 150

Query: 178 LEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
           ++    A++  P +SK   R   A  +LG   DA+     VL + GD
Sbjct: 151 IKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGD 197

 Score = 37.4 bits (85), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%)

Query: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181
           T AV   N+     + K + EAIK  + AI+ DP     YS +     + G     LE  
Sbjct: 129 TNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAY 188

Query: 182 TKALEIKPDHSKALLRR 198
            K L+I+ D +  +++R
Sbjct: 189 KKVLDIEGDKASDVMKR 205

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 53/101 (52%), Gaps = 1/101 (0%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A   K +GN     K++  AI+ Y  AI+  P + ++Y+N +A Y S  + +  ++   K
Sbjct: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAM-FDLSVLSLNGD 223
           A+EI P +SK   R A A  +L    +A+ +   VL + GD
Sbjct: 159 AIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGD 199

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%)

Query: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181
           T  +   N+   + + K +  AIK  + AIE+DP     YS ++    +     + LEY 
Sbjct: 131 TNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYY 190

Query: 182 TKALEIKPDHSKALLRR 198
            K L+++ D +   ++R
Sbjct: 191 KKVLDMEGDKATPAMKR 207

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A++ K++GN F   ++F +A + Y  AIELD    +F+SN +  ++   +    L    K
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           ALE+   + KA  RR  +   L  F  A  DL  +
Sbjct: 72  ALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 3/92 (3%)

Query: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLE 179
           T A + K +GN  F  K++ +A + +  AI++   PN  V YSN SACY S     + L+
Sbjct: 2   TSADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNH-VLYSNRSACYTSLKKFAEGLK 60

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDA 211
              + ++I P  SK   R  +A   L N  DA
Sbjct: 61  DAEECVKINPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +F+  ++  A+K Y   I+  P D   YSN +A         + +    +A+E  P
Sbjct: 388 EGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDP 447

Query: 190 DHSKALLRRASANESLGNFTDAMFDLSVL 218
           +  +A +R+ASA  ++  F  A+  L  +
Sbjct: 448 NFIRAYIRKASAQIAVKEFAAAVETLDTV 476

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 121 QTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEY 180
           Q  A + K +GN F+  + F EAI++Y  A EL   D  + +N +A     GD    +  
Sbjct: 245 QVAAEEEKAEGNKFYKARKFDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGDYETAIAT 303

Query: 181 TTKAL----EIKPDH---SKALLRRASANESLGNFTDAM 212
            T A+    E++ D+   +K+  R  +A   LG+   ++
Sbjct: 304 LTNAVDEGREMRADYKVIAKSFARIGNAYHKLGDLKKSI 342

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 48/95 (50%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A+  KNKGN +    ++  AI++Y  AI LD    +++SN +  ++   +    +     
Sbjct: 12  ALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDN 71

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 218
           AL++ P + KA  RR  +   +  F  A  DL+V+
Sbjct: 72  ALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLEYT 181
           A + K +GN  F  K++ +AI  +  AIE+   PN  V YSN SACY S     + L+  
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNH-VLYSNRSACYASNKKFEEALKDA 61

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
            + ++I P  SK   R  +A   L    +A
Sbjct: 62  EECVKISPSWSKGYNRVGAAQFGLSQLDEA 91

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 45/88 (51%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  FFT  ++  A+K Y   ++  P D   +SN +A         + +E   KA+ I P
Sbjct: 386 QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDP 445

Query: 190 DHSKALLRRASANESLGNFTDAMFDLSV 217
           +  +A +R+A+A  ++  F  A+  L++
Sbjct: 446 NFVRAYIRKATAQIAVKEFAAAIETLNI 473

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE 186
           K +GN  +  + F EAI++Y  A EL   D  + +N SA     GD +  ++    A+E
Sbjct: 250 KAEGNKLYKARQFEEAIEHYNKAWELH-KDITYLNNRSAAEFEKGDYDTAIKTLNDAVE 307

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLEYT 181
           A + K +GN  F  K++ +AI  +  AI++   PN  V YSN SACY S       L+  
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNH-VLYSNRSACYTSLKKFVNALKDA 63

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
            + ++I P  SK   R  +A+  +G+  +A
Sbjct: 64  EECVKINPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 43/83 (51%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  +FT  ++  A+K Y   I+  P D   YSN +A         + ++   KA+E  P
Sbjct: 403 EGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDP 462

Query: 190 DHSKALLRRASANESLGNFTDAM 212
           +  +A +R+A+A  ++  F+ A+
Sbjct: 463 NFVRAYIRKATAQIAVREFSSAL 485

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 113 KGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTG 172
           K + +S++  + V   N+   + + K F  A+K  +  ++++P+    Y+ + A +   G
Sbjct: 30  KAIDVSEQPNH-VLYSNRSACYTSLKKFVNALKDAEECVKINPSWSKGYNRVGAAHFGMG 88

Query: 173 DLNKVLEYTTKALEI 187
           DL++      KALE+
Sbjct: 89  DLDEAEAGYKKALEL 103

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLEYT 181
           A + K +GN  F  K++ +A + +  AIE    PN  V YSN SAC+ S    N+ L   
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNH-VLYSNRSACFTSLKKFNEALNDA 61

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
            + ++I P  SK   R  +A   LG   +A
Sbjct: 62  NECVKINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 8/92 (8%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKAL-- 185
           K +GN F+  + F EAI++Y  A +L   D  + +N SA     GD  + ++  T+A+  
Sbjct: 271 KAEGNKFYKARKFDEAIEHYNKAWDLH-KDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQ 329

Query: 186 --EIKPDH---SKALLRRASANESLGNFTDAM 212
             E++ D+   SK+  R  +A   L +F  A+
Sbjct: 330 GREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 57/126 (45%), Gaps = 10/126 (7%)

Query: 97  FQCTFLPNGEPDI-SQLKGLTLSQK----QTY-----AVQLKNKGNHFFTTKNFTEAIKY 146
           +Q +   +  PDI ++L+     QK    Q Y     A + + +G  +FT  ++  A+K 
Sbjct: 364 YQKSLTEHRTPDILTKLRNCEKEQKVREAQAYIDPEKAEEARLQGKEYFTKGDWPNAVKA 423

Query: 147 YQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLG 206
           Y    +  P D   YSN +A         + ++    A+   P+  +A +R+A+A  ++ 
Sbjct: 424 YTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRKATAQIAVR 483

Query: 207 NFTDAM 212
            F  A+
Sbjct: 484 EFASAI 489

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 129 NKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEI 187
           N+   F + K F EA+      ++++P     Y+ + A Y   G L++  +   KALEI
Sbjct: 43  NRSACFTSLKKFNEALNDANECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEI 101

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A   K++GN    ++++ +AI+ Y  AI   P DP++YSN S  Y+   D    +     
Sbjct: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAM 212
            + I  + SKA +R A+       + DA+
Sbjct: 197 CISIDANFSKAYIRLANIKVQQHQYIDAL 225

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELD--PNDPVFYSNISACYISTGDLNKVLEYT 181
           A + K +GN  F  K++ +AI  +  AIE+   PN  V YSN SA Y S+    + L   
Sbjct: 5   ADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNH-VLYSNRSAAYTSSKQYEQALSDA 63

Query: 182 TKALEIKPDHSKALLRRASANESLGNFTDA 211
            + ++I P  +K   R+ +A + L  + +A
Sbjct: 64  DECIKINPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 61/139 (43%), Gaps = 10/139 (7%)

Query: 95  EDFQCTFLPNGEPDI-SQL----KGLTLSQKQTY-----AVQLKNKGNHFFTTKNFTEAI 144
           E +Q +   +  PDI S+L    K L   + + Y     A + + +G  +FT  ++  A+
Sbjct: 346 EYYQKSLTEHRTPDILSKLRKAEKDLKQQEAEAYLSPEKAEEARLEGKEYFTKADWPNAV 405

Query: 145 KYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANES 204
           K Y   I+  P+D   YSN +A           +    KA+E  P   +A LR+A+   +
Sbjct: 406 KSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPSFIRAYLRKATCQIA 465

Query: 205 LGNFTDAMFDLSVLSLNGD 223
           +  F  A+  L +     D
Sbjct: 466 VKEFAGAIETLDLARERDD 484

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A + K +GN  +  + F EAI +Y  A E    D  + +N SA     GD    ++  T+
Sbjct: 251 ADKAKAEGNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTE 309

Query: 184 ALE 186
           A+E
Sbjct: 310 AVE 312

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 127 LKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE 186
           LK KGN FF   ++  A+ YYQ AI  DP++P+ YSN +   I     ++ ++   K L+
Sbjct: 7   LKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLK 66

Query: 187 -IKPDHSK 193
            I P++ K
Sbjct: 67  MICPENDK 74

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A  LK +GN     K++  A++ Y  AI+L P   V+Y+N +A Y S    ++ ++    
Sbjct: 103 AEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAES 162

Query: 184 ALEIKPDHSKALLR 197
           A++++P+ SK   R
Sbjct: 163 AIKVEPNWSKGYSR 176

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%)

Query: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181
           T AV   N+   + + + + EAIK  + AI+++PN    YS +     + G   + LE  
Sbjct: 135 TKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAY 194

Query: 182 TKALEIKPDHSKALLRR 198
            KALE+  D +  +++R
Sbjct: 195 KKALEVDGDKATDIMKR 211

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +GN     K+F  A++ Y  AI++ P + ++Y+N +A + S  +  + ++    A++I P
Sbjct: 107 EGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDP 166

Query: 190 DHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
            +SK   R A A   LG   +A+     VL + GD
Sbjct: 167 SYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGD 201

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 40/77 (51%)

Query: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181
           T A+   N+     + K F EAIK  + AI++DP+    YS ++      G   + LE  
Sbjct: 133 TNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESY 192

Query: 182 TKALEIKPDHSKALLRR 198
            K L+I+ D++ A ++R
Sbjct: 193 KKVLDIEGDNATAGMKR 209

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 50/101 (49%), Gaps = 1/101 (0%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A  LK +GN     K++  AIK Y  AI   P + V+++N +A Y S    ++ +E    
Sbjct: 100 AEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANS 159

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
           A++I P +SK   R   A  + G   DA+     VL + GD
Sbjct: 160 AIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGD 200

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%)

Query: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181
           T AV   N+   + + K + EA++    AI+++P     YS +     + G     LE  
Sbjct: 132 TNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAY 191

Query: 182 TKALEIKPDHSKALLRR 198
            K L+I+ D +  +++R
Sbjct: 192 KKVLDIEGDKATEMMKR 208

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G  F   +N T++I+++Q A+ +DPND   +  +   Y + G +   ++   KA+E+ PD
Sbjct: 691 GISFLEDQNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPD 750

Query: 191 HSKA 194
           H+ A
Sbjct: 751 HNYA 754

 Score = 34.7 bits (78), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%)

Query: 397  FQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQG 456
            F KA+ L  +    +++   +     D V A     +AQ++ P+N  P++ +A L  K+G
Sbjct: 993  FIKAMVLSPKDVEIWFNLALLALQNNDTVLAGEIMSRAQSMAPQNSSPWLGMALLYEKEG 1052

Query: 457  KFTESEALFNET 468
            K TES  +F  +
Sbjct: 1053 KSTESANMFGHS 1064

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKAL 185
           +LK KGN  F   +++EAI +Y   I +DP++P+ YSN +   +     ++ +    K L
Sbjct: 5   ELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGL 64

Query: 186 EI 187
           ++
Sbjct: 65  QL 66

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 63/139 (45%), Gaps = 13/139 (9%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPND----PVFYSNISACYISTGDLNKVLE 179
           A   KN+ N  +  K F EA + Y+  IE+  ND       ++N++AC +   +  + + 
Sbjct: 78  AENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCIN 137

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDA----MFDLSVLSLNGDFDGASIEPMLER 235
              KAL+  P + K   R A A   L    +A     F L++ S N      ++E +++R
Sbjct: 138 LCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKSL--QTLEGVIDR 195

Query: 236 N---LNKQAMKVLNENLSK 251
               L++  +K L E   K
Sbjct: 196 KQQELHEAEVKRLEEKQKK 214

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%)

Query: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177
           ++ +  A  LK +GN     K+F  AI  Y  AIE+ P + ++Y+N +A + S    ++ 
Sbjct: 87  AETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEA 146

Query: 178 LEYTTKALEIKPDHSKALLR 197
           +    KA+EI P +SK   R
Sbjct: 147 VVDAEKAIEIDPAYSKGYSR 166

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 50/95 (52%)

Query: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177
           ++ +  A  LK +GN     K+F +A+  Y  AI++ P + V+Y+N +A + S     + 
Sbjct: 91  AETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEA 150

Query: 178 LEYTTKALEIKPDHSKALLRRASANESLGNFTDAM 212
           ++    A+++ P +SK   R   A  +LG   +A+
Sbjct: 151 VKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKAL 185
           Q K +GN  F   ++  A + YQ  ++++P +P+ YSN +   I  G   +V+E   K L
Sbjct: 5   QYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGL 64

Query: 186 EIKPDHSKALLRR 198
              P+ +  + ++
Sbjct: 65  TFTPNTTDTVYKK 77

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 7/89 (7%)

Query: 127 LKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKAL- 185
           +K +GN  F   NF+ A +YY   I L+P +P+ YSN +   I     ++ ++   + L 
Sbjct: 7   VKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLG 66

Query: 186 ------EIKPDHSKALLRRASANESLGNF 208
                 + +P   K L R   A ESL  F
Sbjct: 67  KLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 60/107 (56%), Gaps = 1/107 (0%)

Query: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177
           ++ +  A  LK +GN    +K++  A++ Y  AI++ P + V+++N +A Y ++ + ++ 
Sbjct: 95  AETKAKAEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEA 154

Query: 178 LEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
           ++   +A+++ P +SK   R A A     NF +++     VL + GD
Sbjct: 155 VKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGD 201

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 35/67 (52%)

Query: 127 LKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE 186
           LK +GN FF   ++ +A  YY   I+L+P +P+ YSN +   I  G+    +E   + L+
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 187 IKPDHSK 193
                +K
Sbjct: 66  YTSSSTK 72

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 52/88 (59%), Gaps = 1/88 (1%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F+T  +F + I  ++ A++++PND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 468 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 527

Query: 194 ALLRRASANESLGNFTDAM-FDLSVLSL 220
           A    A ++ ++G F +A  + LSVLS+
Sbjct: 528 ARYNLAVSSMNIGCFKEAAGYLLSVLSM 555

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F+T  +F + I  ++ A+ ++PND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 467 FYTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 194 ALLRRASANESLGNFTDAM-FDLSVLSL 220
           A    A ++ ++G F +A  + LSVLS+
Sbjct: 527 ARYNLAVSSMNIGCFKEAAGYLLSVLSM 554

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 67/150 (44%), Gaps = 12/150 (8%)

Query: 127 LKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE 186
           LK +GN    TK+F  AI  Y  AI   P++ V+++N +A Y S     + +E    A++
Sbjct: 101 LKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIK 160

Query: 187 IKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNG---------DFDGASIEPMLERN 236
           + P +SK   R   A  +LG   +A+     VL + G         D+D A  +  +E++
Sbjct: 161 VNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKK--VEQS 218

Query: 237 LNKQAMKVLNENLSKGDGRGSQLLPSNTSL 266
           LN +       N    D  G    P   S+
Sbjct: 219 LNVERSAPAASNAESPDAAGGSGFPDIASM 248

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYI 169
             K +GN +F   N+  AIK Y+  IE++P +P+ YSN +   I
Sbjct: 5   HFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALI 48

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYI 169
           + K KGN  +   NFT+A+ +Y+ AI  DP +PV YSN +   I
Sbjct: 6   EFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALI 49

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
           antiviral protein
          Length = 1411

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 43/82 (52%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G  +   +   E+I+++Q A+ +DP D   +  +   Y++ G +   L+   +AL++   
Sbjct: 686 GVAYLEKQQDAESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDLDEH 745

Query: 191 HSKALLRRASANESLGNFTDAM 212
           HS AL  +A  +  LG + +++
Sbjct: 746 HSYALYYKAVCHSQLGEYEESL 767

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%)

Query: 106 EPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNIS 165
           E D    + + L      A  LK KGN FF   ++  AI YY+ A  LD ++P+++SN++
Sbjct: 23  EYDAKVGRRIVLESMNETAEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMA 82

Query: 166 ACYI 169
              I
Sbjct: 83  TALI 86

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKAL 185
           + K  GN +F   N+ +A++YY+  IE++P +P+ YSN +   I      + LE     L
Sbjct: 5   EYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGL 64

Query: 186 EIKPDHSKALLRR 198
           +   D    + ++
Sbjct: 65  KYVNDADSQVYKK 77

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 41/72 (56%)

Query: 141 TEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRAS 200
           +++I+++Q AI +DPND   +  +   Y+  G +   ++   KA+E+   H+ A   ++ 
Sbjct: 682 SDSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAKYFKSI 741

Query: 201 ANESLGNFTDAM 212
           A   +G FT+++
Sbjct: 742 ALSEMGEFTESI 753

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPN----DPVFYSNISACYISTGDLNKVLE 179
           A   KN+GN  +  K F +A   Y  A+++  +    +   Y N++AC +   +    + 
Sbjct: 70  ATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCIN 129

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDAM 212
           Y  +AL++   + KA  R   A   LG F D++
Sbjct: 130 YCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1397

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 41/82 (50%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G  +  T+    +I+++Q A+ +DP D   +  +   Y + G +   ++   +ALE+  +
Sbjct: 673 GIFYLETQEEASSIEWFQSALRIDPKDVESWVGLGQAYYACGRIEASMKVFERALELDSE 732

Query: 191 HSKALLRRASANESLGNFTDAM 212
           H      +A +  +LG F D++
Sbjct: 733 HQHCRYLKAQSLAALGQFVDSI 754

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 53/89 (59%), Gaps = 1/89 (1%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F+T  +F + I  ++ A++++PND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 467 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 194 ALLRRASANESLGNFTDAM-FDLSVLSLN 221
           A    A ++ ++G + +A  + L+VLS++
Sbjct: 527 ARYNLAVSSMNIGCYKEAAGYLLTVLSMH 555

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F+T  +F + I  ++ A++++PND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 467 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 194 ALLRRASANESLGNFTDAM-FDLSVLSL 220
           A    A ++ ++G   +A  + LSVLS+
Sbjct: 527 ARYNLAVSSMNIGCLKEAAGYLLSVLSM 554

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 42/72 (58%)

Query: 141 TEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRAS 200
           +++I+++Q A+ +DPND   +  +   Y + G +   ++   KA+E++P H+ A   RA 
Sbjct: 712 SDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIELQPSHTYARYFRAL 771

Query: 201 ANESLGNFTDAM 212
           +   +G + +++
Sbjct: 772 SLCDMGEYLESL 783

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 53/121 (43%), Gaps = 4/121 (3%)

Query: 397  FQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQG 456
            F KA  L+ +    +++   +     D   A+    + Q+L P++  P++ +A +L +QG
Sbjct: 1001 FIKATALEPKATDIWFNLAMLGLKKNDTEFAQQVLNRLQSLAPQDSSPWLGMALILEEQG 1060

Query: 457  KFTESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGI 516
               ES  LF  + +    L    +  A++L  K      I   D  + +E V++   V I
Sbjct: 1061 NIVESSKLFAHSYI----LSNGRSKAAQVLYAKSVLENHIDNGDDERDIETVEKLTTVSI 1116

Query: 517  G 517
             
Sbjct: 1117 A 1117

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
            (SKI3) - Contains 8 copies of the TPR domain [contig 8]
            FULL
          Length = 1410

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 90/419 (21%), Positives = 162/419 (38%), Gaps = 55/419 (13%)

Query: 141  TEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRAS 200
            +E+I+++Q A+ +DP+D   +  +   Y + G +   ++   KALE++P  + A   +A 
Sbjct: 697  SESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSAYAHYFKAL 756

Query: 201  ANESLGNFTDAMFDLSVLS----LNGDFDGASIEPMLERN--LNKQAMKVLNENLSKGDG 254
            +   +G + D++  L  L+    L   +  + +E M+E    L  Q     +  ++    
Sbjct: 757  SLSRMGLYNDSIEILKTLAAGNPLEESYQVSLVEIMVEHANVLCSQGFLTRSVAIAADAV 816

Query: 255  RGSQLLPSNTS----------------------------LTSFFGIFDPDLEISRVNNSS 286
            R  + +  N +                            L S   IF    EI  + N++
Sbjct: 817  RKVEYIALNINHKLHNLWIALSNALRIFLLVQSQVGMLPLESLVNIF----EIEELKNTT 872

Query: 287  HFDTA-----YALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGPLKENAA 341
              D        +LLSD  Q   S   +  + + K   + TD  +S L   V   L  N  
Sbjct: 873  AIDETDGVELSSLLSDDDQDNVSIAAKFLVLSGKHSIACTD--YSSLPRTVRASLWYNLG 930

Query: 342  LAFCYTGIFHFLKNNLLGAQALL--QESINLHP-TPNSYIFLALTLADKENSQEFFKYFQ 398
            +    +  F  LK+      A++  ++SI     T  ++I   +   D  N +     F 
Sbjct: 931  IVELIS--FIILKSETYRDAAIMSFKKSIEYQSNTAETWIGFGIASIDL-NVRVAQHCFI 987

Query: 399  KAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKF 458
            KA  L       +Y    +     D   A++   K+Q + P++  P++ LA    K+G  
Sbjct: 988  KATALSPRETSVWYDMAVLALKYNDIDFARSVLMKSQTIAPQDSSPWLGLALASEKEGLV 1047

Query: 459  TESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIG 517
             ES  LF  + +    L    +  A+IL  K   +  I   D  + +   QE   V  G
Sbjct: 1048 EESSRLFAHSFV----LSNGKSKAAQILYAKSVLNNRIGNEDDERDIGPAQELTAVAYG 1102

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 38/194 (19%), Positives = 75/194 (38%), Gaps = 31/194 (15%)

Query: 377 YIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQN 436
           Y  L +   +K++  E  ++FQ A+ +D     ++   GQ Y+       +   F+KA  
Sbjct: 683 YRVLGIANLEKQSESESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALE 742

Query: 437 LYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFP-------TLPEVPAFFAEILTDK 489
           + P + Y +   A  L + G + +S  +        P       +L E+    A +L  +
Sbjct: 743 VEPTSAYAHYFKALSLSRMGLYNDSIEILKTLAAGNPLEESYQVSLVEIMVEHANVLCSQ 802

Query: 490 GDFSTAIK-QYDIAKRLE----EVQEKIH-------------------VGIGPLIGKATI 525
           G  + ++    D  +++E     +  K+H                   VG+ PL     I
Sbjct: 803 GFLTRSVAIAADAVRKVEYIALNINHKLHNLWIALSNALRIFLLVQSQVGMLPLESLVNI 862

Query: 526 LARQSSQDPTQLDE 539
              +  ++ T +DE
Sbjct: 863 FEIEELKNTTAIDE 876

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 53/104 (50%), Gaps = 1/104 (0%)

Query: 121 QTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEY 180
           ++ A  LK +GN     K++  AIK Y  AI + P + V+Y+N +A + S  + ++ ++ 
Sbjct: 90  KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKD 149

Query: 181 TTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
              A+++   +SK   R   A  + G   +A+     VL + GD
Sbjct: 150 AESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGD 193

 Score = 37.4 bits (85), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%)

Query: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181
           T AV   N+     + KN+ EAIK  + A+++D +    YS +     + G   + LE  
Sbjct: 125 TNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAY 184

Query: 182 TKALEIKPDHSKALLRR 198
            K L+I+ D +  +++R
Sbjct: 185 KKVLDIEGDSATDVMKR 201

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 3/93 (3%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G  +   +  + +I+++Q AI +DPND   +  +   Y++ G +   ++   KA+E+   
Sbjct: 676 GIAYLQNQQESSSIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDGS 735

Query: 191 HSKALLRRASANESLGNFTDAMFDL--SVLSLN 221
           H  A   +A A   +G F+ A  DL  SV  LN
Sbjct: 736 HLHAQYFKALALADMGEFS-ASIDLLTSVTELN 767

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 54/107 (50%), Gaps = 1/107 (0%)

Query: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177
           ++ +  A +LK +GN     K +  AIK Y  AI++ P + ++Y+N +A + S  + ++ 
Sbjct: 96  AETKAKAEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEA 155

Query: 178 LEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
           ++    A+ + P + +   R   A  + G   +A+     VL + GD
Sbjct: 156 IKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 70/162 (43%), Gaps = 4/162 (2%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           N ++   Y  +++++DSE   T+YH G+++ I  DY  A   FQ+A N    N   +  +
Sbjct: 267 NPEKALNYLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSI 326

Query: 449 ACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEIL-TDKGDFSTAIKQYDIAKRLEE 507
             L Y+  ++ ++   +       P + EV      +  T     + A+  Y  A RLE 
Sbjct: 327 GVLYYQIYQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLEP 386

Query: 508 VQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNTAIALL 549
               I   +  L  +   L+ Q      +++ +K N  I L+
Sbjct: 387 DNTHIRERLDALTNQ---LSTQQGNINQKIEYQKKNENIPLM 425

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 60/133 (45%), Gaps = 19/133 (14%)

Query: 391 QEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLAC 450
           Q+   Y  K++++DS+   T+YH G+++ I  DY  A   FQ+A N    N   +  +  
Sbjct: 294 QKALGYLLKSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGV 353

Query: 451 LLYKQGKFTES-EALFNETKLKFPTLPEVPAFFAEILTDKG--------DFSTAIKQYDI 501
           L Y+  ++ ++ +A     +L          + +E+  D G          + A+  Y  
Sbjct: 354 LYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLNDALDAYKQ 405

Query: 502 AKRLEEVQEKIHV 514
           A RL+   E IH+
Sbjct: 406 AARLDP--ENIHI 416

>TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa]
           {ON} Anc_5.72 YHR166C
          Length = 666

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 60/125 (48%), Gaps = 5/125 (4%)

Query: 113 KGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTG 172
           + +TL++K   A  L   G+ F   KN   AI+ Y+ A++++P D   +  +   Y    
Sbjct: 462 RAITLNKKNISAWTLM--GHEFVELKNSQAAIECYRHAVDINPRDFKAWYGLGQAYEVLD 519

Query: 173 DLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAM--FDLSV-LSLNGDFDGASI 229
                L Y  KA  +KP   +     AS    +GNF DA+  F+ ++ LS+N D D + +
Sbjct: 520 MHLYSLYYFQKACTLKPLDKRMWQALASCYVKIGNFNDAIKSFERALQLSINTDQDSSLL 579

Query: 230 EPMLE 234
             + E
Sbjct: 580 YKLAE 584

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%)

Query: 376 SYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQ 435
           ++  +     + +NSQ   + ++ A+D++      +Y  GQ Y +L  ++ +   FQKA 
Sbjct: 473 AWTLMGHEFVELKNSQAAIECYRHAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKAC 532

Query: 436 NLYPENIYPYIQLACLLYKQGKFTES 461
            L P +   +  LA    K G F ++
Sbjct: 533 TLKPLDKRMWQALASCYVKIGNFNDA 558

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
           (REAL)
          Length = 1417

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 55/102 (53%), Gaps = 4/102 (3%)

Query: 141 TEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRAS 200
           +++I+++Q A+ +DPND   +  +   Y + G +   ++   KA++++P H+ A   +A 
Sbjct: 704 SDSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTYAQYFKAV 763

Query: 201 ANESLGNFTDAMFDLSVL----SLNGDFDGASIEPMLERNLN 238
           +   +G + +++  L  +    S    F  A +E +++ +L+
Sbjct: 764 SLCDIGEYLESLEILKKVCQEDSTEESFQSALVEVLMKYSLD 805

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%)

Query: 397  FQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQG 456
            F KA  L+ +   T+++   +     D   A+    K Q+L P++  P++ +A +L KQG
Sbjct: 993  FIKATALEPKATDTWFNLAMLGLKKNDAEFAQQVLNKLQSLAPQDSSPWLGMALILEKQG 1052

Query: 457  KFTESEALF 465
               ES  LF
Sbjct: 1053 NVIESSKLF 1061

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 45/109 (41%), Gaps = 5/109 (4%)

Query: 108 DISQLKGLTL-SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIEL----DPNDPVFYS 162
           ++  LK L    +    A   KN+GN  FT K F EA   Y   IE+    D  +   ++
Sbjct: 63  ELEALKALAYEGEPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFA 122

Query: 163 NISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDA 211
           N +AC +   +    +     AL + P + K   R   A   L N  +A
Sbjct: 123 NRAACQLELKNYRSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G  F+  + F + I  ++ A+E++PND + ++ + A   ++    + ++   KAL +KP 
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 191 HSKALLRRASANESLGNFTDAMFD-LSVLSLN 221
             +A    A ++ ++G + +A    LS LS++
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMH 514

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 4/92 (4%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPND----PVFYSNISACYISTGDLNKVLE 179
           A   KN+GN  +  K F +A + Y  AI++  +D       Y+N +AC +   +  + + 
Sbjct: 74  AGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCIN 133

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDA 211
               AL + P + K   R A A  ++  F D 
Sbjct: 134 DCKMALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

>TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1410

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 40/82 (48%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G  +   +   ++I+++Q AI +D +D   +  +   Y S G +   ++   K LE+ P 
Sbjct: 682 GISYLEKQQAADSIEWFQSAIRVDDSDVESWVGLGQSYYSCGRIEASIKVFEKPLELSPH 741

Query: 191 HSKALLRRASANESLGNFTDAM 212
           H  AL  +A     +G F +++
Sbjct: 742 HPHALYFKALGLSDVGQFVESI 763

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 51/96 (53%), Gaps = 4/96 (4%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F+    F   I  +Q A++++PND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 434 FYANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 493

Query: 194 ALLRRASANESLGNFTDA----MFDLSVLSLNGDFD 225
           A    A ++ ++G + +A    +  LS+  + G+F+
Sbjct: 494 ARYNLAVSSMNIGCYKEAAEHLLTALSMHDVEGEFE 529

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 59/128 (46%), Gaps = 21/128 (16%)

Query: 102 LPNGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFY 161
           LP  +PDI    GL                  F+TT ++ + I  ++ A+ ++PND + +
Sbjct: 488 LPTIDPDIQLCLGLL-----------------FYTTADYDKTIDCFKTALTVNPNDELMW 530

Query: 162 SNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDA----MFDLSV 217
           + + A   ++    + +    +AL +KP   +A    A ++ ++G F +A    +  LS+
Sbjct: 531 NRLGASLANSNRSEEAVAAYHRALTLKPSFVRARYNLAVSSINIGCFKEAAEHLLTALSM 590

Query: 218 LSLNGDFD 225
             +NG  D
Sbjct: 591 HEINGILD 598

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A +LK KGN     K +++AI  Y  AI+L P +  +Y+N +  YI   + +  +    K
Sbjct: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193

Query: 184 ALE----IKPDHSKALLRRASANESLGNF 208
           ++E    I P + KA  R   A   +G++
Sbjct: 194 SIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKAL 185
            L++KGN  ++   +  A+ YY+ A   +P++PV  +N+S   +        L    +AL
Sbjct: 10  HLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRAL 69

Query: 186 EI 187
           EI
Sbjct: 70  EI 71

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 4/92 (4%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPND----PVFYSNISACYISTGDLNKVLE 179
           A   KN+GN F+  K + +A + Y   I++  +D       Y+N +AC +   +  K +E
Sbjct: 74  AGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIE 133

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDA 211
              KAL     + K   R   A  S+  F ++
Sbjct: 134 DCKKALSFNVKNIKCYYRMGKAFLSVDRFDES 165

>Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa]
           {ON} complement(185867..187786) [1920 nt, 640 aa]
          Length = 639

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 59/125 (47%), Gaps = 5/125 (4%)

Query: 113 KGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTG 172
           + LTL++K T A  L   G+ F   KN   AI+ Y+ A++++P D   +  +   Y    
Sbjct: 434 RALTLNKKNTSAWTLM--GHEFVELKNSQAAIECYRRAVDINPRDFKAWYGLGQAYEVLD 491

Query: 173 DLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAM--FDLSV-LSLNGDFDGASI 229
                L Y  KA  +KP   +     AS    +GN  D++  ++ ++ LSLN D D   +
Sbjct: 492 MHLYSLYYFQKACTLKPLDKRMWQALASCYAKVGNIRDSIKSYERALQLSLNADQDSTLL 551

Query: 230 EPMLE 234
             + E
Sbjct: 552 YRLAE 556

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 42/87 (48%)

Query: 375 NSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKA 434
           +++  +     + +NSQ   + +++A+D++      +Y  GQ Y +L  ++ +   FQKA
Sbjct: 444 SAWTLMGHEFVELKNSQAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKA 503

Query: 435 QNLYPENIYPYIQLACLLYKQGKFTES 461
             L P +   +  LA    K G   +S
Sbjct: 504 CTLKPLDKRMWQALASCYAKVGNIRDS 530

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 59/135 (43%), Gaps = 19/135 (14%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           + Q+   Y  K++++D     T+YH G+++ +  DY  A   FQ+A N    N   +  +
Sbjct: 296 DPQKALNYLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSI 355

Query: 449 ACLLYKQGKFTES-EALFNETKLKFPTLPEVPAFFAEILTDKG--------DFSTAIKQY 499
             L Y+  ++ ++ +A     +L          + +E+  D G          + A+  Y
Sbjct: 356 GVLYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLTDALDAY 407

Query: 500 DIAKRLEEVQEKIHV 514
             A RL+   E IH+
Sbjct: 408 KQAARLDP--ENIHI 420

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 1/83 (1%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G       ++T A   +Q A+  D  +P+F+ +I   Y         L+  T+A+ + P 
Sbjct: 322 GRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 381

Query: 191 HSKALLRRASANESLGN-FTDAM 212
            S+      +  E+  N  TDA+
Sbjct: 382 ISEVWYDLGTLYETCNNQLTDAL 404

>Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR189W
           (REAL)
          Length = 1425

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 41/72 (56%)

Query: 141 TEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRAS 200
           +++I+++Q A+ +DPND   +  +   Y + G +   ++   KA+ +KP H+ A   +A 
Sbjct: 712 SDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIGLKPSHTYAQYFKAV 771

Query: 201 ANESLGNFTDAM 212
           +   +G + +++
Sbjct: 772 SLCDMGEYLESL 783

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%)

Query: 397  FQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQG 456
            F KA  L+ +    +++   +     D   A+    K+Q+L P++  P++ +A +L KQG
Sbjct: 1001 FIKATALEPKATDIWFNLAMLGLKKNDTDFAQQVLNKSQSLAPQDSSPWLGMALILEKQG 1060

Query: 457  KFTESEALF 465
               ES  LF
Sbjct: 1061 NIVESSKLF 1069

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 55/125 (44%), Gaps = 3/125 (2%)

Query: 391 QEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLAC 450
           Q+   Y  K++++D     T+YH G+++ I  DY  A   FQ+A N    N   +  +  
Sbjct: 289 QKALNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGV 348

Query: 451 LLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEIL-TDKGDFSTAIKQYDIAKRLEEVQ 509
           L Y+  ++ ++   +       P + EV      +  T     + A+  Y  A RL+   
Sbjct: 349 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDP-- 406

Query: 510 EKIHV 514
           E +H+
Sbjct: 407 ENVHI 411

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 26/59 (44%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           G       ++T A   +Q A+  D  +P+F+ +I   Y         L+  T+A+ + P
Sbjct: 313 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNP 371

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177
           ++ +  A  LK +GN     K++  AI  Y  AI++ P + ++Y+N +A + S  + ++ 
Sbjct: 96  AETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQA 155

Query: 178 LEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
           ++    A+ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 156 VKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 38/72 (52%)

Query: 141 TEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRAS 200
           ++AI+++Q A+ ++PN+   +  +   Y+S G +   +    KA E+ PDH  A    A 
Sbjct: 685 SDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLYAKYFTAQ 744

Query: 201 ANESLGNFTDAM 212
           +   +G +  ++
Sbjct: 745 SLSEMGEYVKSI 756

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 52/112 (46%), Gaps = 2/112 (1%)

Query: 377 YIFLALTLADKENSQE--FFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKA 434
           + F  + +A+ E  QE    ++FQ A+ ++     ++   GQ Y        +   F+KA
Sbjct: 669 WPFRVIGIANLERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKA 728

Query: 435 QNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEIL 486
             L P+++Y     A  L + G++ +S ++F E  ++ P        ++E L
Sbjct: 729 TELDPDHLYAKYFTAQSLSEMGEYVKSISIFEEIIMETPKEESFQVSYSETL 780

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 60/128 (46%), Gaps = 5/128 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIEL--DPN--DPVFYSNISACYISTGDLNKVLE 179
           A   KN+GN  +  K + +A + Y   IE+  D N  +   +SN +AC +   +  + + 
Sbjct: 78  AENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVN 137

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK 239
              +AL+  P + K   R A A   L    DA   +    L  D + A+++ +L++ + +
Sbjct: 138 DCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIE-FGLKLDSESAALKALLQKVIKR 196

Query: 240 QAMKVLNE 247
           +  K  +E
Sbjct: 197 EEDKKAHE 204

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 1/101 (0%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A  LK +GN     K++  AI  Y  AI++ P + ++Y+N +A + S    ++ +E    
Sbjct: 102 AEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAES 161

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
           A+ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 162 AISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%)

Query: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181
           T A+   N+     + K + EA++  + AI +DP     YS +     + G   + LE  
Sbjct: 134 TNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAY 193

Query: 182 TKALEIKPDHSKALLRR 198
            K L+I+ D++   ++R
Sbjct: 194 KKVLDIEGDNATEAMKR 210

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 5/69 (7%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE- 186
           K +GN  F    + EA+  Y   I   P +PV YSN +   I  G+  + ++   + L+ 
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQH 71

Query: 187 ----IKPDH 191
                 PDH
Sbjct: 72  ASTTTTPDH 80

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 4/92 (4%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPV----FYSNISACYISTGDLNKVLE 179
           A   K +GN  +  K F +A + Y   I ++  D       ++N +AC +   +  + +E
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIE 142

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDA 211
             +KAL I P + K   R + A  SL    +A
Sbjct: 143 DCSKALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 36/89 (40%), Gaps = 1/89 (1%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183
           A  LK +GN       + EAIK Y  AI+   N   +YSN S  Y   G     +   T 
Sbjct: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKN-VAYYSNRSLAYSKLGRYEDAVNDATL 140

Query: 184 ALEIKPDHSKALLRRASANESLGNFTDAM 212
           A+ I P  SKA  R   A        D M
Sbjct: 141 AINIDPSFSKAYSRLGYAKCCQDKLEDGM 169

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
           complex component and TPR protein, mediates 3'-5' RNA
           degradation by the cytoplasmic exosome; null mutants
           have superkiller phenotype of increased viral dsRNAs and
           are synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 42/72 (58%)

Query: 141 TEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRAS 200
           +++I+++Q A+ +DPND   +  +   Y + G +   ++   KA++++P H+ A   +A 
Sbjct: 719 SDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTFAQYFKAI 778

Query: 201 ANESLGNFTDAM 212
           +   +G + +++
Sbjct: 779 SLCDVGEYLESL 790

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%)

Query: 397  FQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQG 456
            F KA  L+ +   T+++   +    +D   A+    K Q+L P++  P++ +A +L +QG
Sbjct: 1008 FIKATALEPKATNTWFNLAMLGLKKKDTEFAQQVLNKLQSLAPQDSSPWLGMALILEEQG 1067

Query: 457  KFTESEALF 465
                S  LF
Sbjct: 1068 DIIGSSKLF 1076

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 27/44 (61%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYI 169
           +LK +GN  +  +++  A+++Y   +E D  +P+ +SN + C I
Sbjct: 6   RLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLI 49

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 59/160 (36%), Gaps = 42/160 (26%)

Query: 397 FQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIY------------- 443
           ++KAI  D  +   YY  G +   L  Y  A   F+KA+++ P N+              
Sbjct: 585 YRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLS 644

Query: 444 ------PYIQLAC---------------LLYKQGKFTESEALFNETKLKFPTLPEVPAFF 482
                  Y +LAC               LLY  G++T +   F E K   P    V    
Sbjct: 645 YQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVHFLL 704

Query: 483 AEILTDKGDFSTAIKQYDIAKRLE--------EVQEKIHV 514
            +I +  G    AIK+Y IA  L+        E  EK H 
Sbjct: 705 GQIYSILGRKKDAIKEYTIALNLDPKGRQLIMEALEKCHT 744

>YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON}
           CDC16Subunit of the anaphase-promoting complex/cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; required for sporulation
          Length = 840

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 51/91 (56%), Gaps = 5/91 (5%)

Query: 112 LKGLTLSQKQTYAVQLKNKGNHFFTTKNFTE-AIKYYQCAIELDPNDPVFYSNISACYIS 170
           +K L  S + T ++QL N G H +   N  E AIK ++C +E +  +   + ++   Y+ 
Sbjct: 663 VKDLDPSSRTTISIQL-NLG-HTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLK 720

Query: 171 TGDLNKVLEYTTKALEIKPDHSK--ALLRRA 199
           T  L K +++  K+L +KP++S   ALL+ A
Sbjct: 721 TKKLQKAIDHLHKSLYLKPNNSSATALLKNA 751

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 4/114 (3%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPV----FYSNISACYISTGDLNKVLE 179
           A   K +GN  +  K F +A + Y   + ++  D       Y+N +AC +   +  + +E
Sbjct: 83  AENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIE 142

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPML 233
             +KAL I P + K   R + A   L    +A    +  +   D +  SI  ML
Sbjct: 143 DCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAATFANQRIDPENKSILNML 196

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 36.2 bits (82), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (46%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKAL 185
           K +GN  F    + EA+  Y   I   P +PV YSN +   I  G+  + ++   + L
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGL 65

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 59/135 (43%), Gaps = 19/135 (14%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           + Q+   Y  K++++D     T+YH G+++ I  DY  A   FQ+A N    N   +  +
Sbjct: 279 DPQKALSYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 338

Query: 449 ACLLYKQGKFTES-EALFNETKLKFPTLPEVPAFFAEILTDKG--------DFSTAIKQY 499
             L Y+  ++ ++ +A     +L          + +E+  D G          S A+  Y
Sbjct: 339 GVLYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLSDALDAY 390

Query: 500 DIAKRLEEVQEKIHV 514
             A RL+   E IH+
Sbjct: 391 KQAARLD--PENIHI 403

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 133 HFFTTKN-FTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKAL 185
           H + +++ F +A + Y+CA++++P     ++ +  CY+   DL +      +AL
Sbjct: 90  HLYRSRDMFQKAAELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 143

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 52/124 (41%), Gaps = 5/124 (4%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPND----PVFYSNISACYISTGDLNKVLE 179
           A   KN+GN  +  K F +A + Y   IE+  +D       Y+N +AC +   +  + L 
Sbjct: 78  AGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLN 137

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK 239
               AL+  P + K   R   A  +L    +A   +    L  D     ++ +L+  L K
Sbjct: 138 DCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLDIVLKK 196

Query: 240 QAMK 243
           Q  K
Sbjct: 197 QEAK 200

>Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} similar
           to Ashbya gossypii AEL281C
          Length = 1398

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%)

Query: 142 EAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASA 201
           EAI+++Q A+ LD  D   +  +   Y   G +   +    KALE+ P H  A    A++
Sbjct: 686 EAIQWFQSAVRLDSLDTEAWIGLGQAYSVCGRIAASVNVYEKALELNPKHKFARYLLAAS 745

Query: 202 NESLGNFTDAMFDLSVLS 219
              +G F   +  LSVL+
Sbjct: 746 LCQMGEFEKGIELLSVLN 763

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 81/193 (41%), Gaps = 11/193 (5%)

Query: 377 YIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQN 436
           Y  L +   +K+   E  ++FQ A+ LDS     +   GQ Y +      +   ++KA  
Sbjct: 671 YRVLGIFYLEKQQEAEAIQWFQSAVRLDSLDTEAWIGLGQAYSVCGRIAASVNVYEKALE 730

Query: 437 LYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPT----LPEVPAFFAEILTDKGDF 492
           L P++ +    LA  L + G+F +   L +    ++P     L ++  F  +  TD  + 
Sbjct: 731 LNPKHKFARYLLAASLCQMGEFEKGIELLSVLNEEYPLEEIFLVQLSGFLVDYSTDLHNQ 790

Query: 493 STAIKQYDIA----KRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNTAIAL 548
              IK    A    + +E V  K++  +  +    T+    S    TQ   EKF     L
Sbjct: 791 GYLIKSIGTALKAVRLIEVVVTKLNKKVSSVF--VTLSKVLSLFMLTQSQFEKFPLESLL 848

Query: 549 -LTKACELDPRSE 560
            + +ACEL   S+
Sbjct: 849 NILEACELKNTSK 861

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 60/160 (37%), Gaps = 42/160 (26%)

Query: 396 YFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENI------------- 442
           YF+KA+  DS++   YY  G     L ++ +A   F+KA+++ P N+             
Sbjct: 621 YFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNVILICCCGVAFEKL 680

Query: 443 -YP-----YIQLAC---------------LLYKQGKFTESEALFNETKLKFPTLPEVPAF 481
            YP     Y +LAC               LLY    +  +   F E     P    V   
Sbjct: 681 SYPEKALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEATVHFI 740

Query: 482 FAEILTDKGDFSTAIKQYDIAKRLE--------EVQEKIH 513
             ++    G    A+K+Y IA  L+        E  EK H
Sbjct: 741 LGQLYNIMGRKKDAVKEYTIAMNLDPKGNQVILEALEKCH 780

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177
           ++ +  A  LK +GN     K++  AI  Y  AI++ P + ++Y+N +A + S  + ++ 
Sbjct: 96  AETKAKAEDLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEA 155

Query: 178 LEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL-SVLSLNGD 223
           ++    ++ I P + +   R   A  + G   +A+     VL + GD
Sbjct: 156 VKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGD 202

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 46/82 (56%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F+   +F + I  ++ A++++PND + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 456 FYANDDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPSFVR 515

Query: 194 ALLRRASANESLGNFTDAMFDL 215
           A    A ++ ++G + +A+  L
Sbjct: 516 ARYNLAVSSMNIGCYKEAVEHL 537

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 2/76 (2%)

Query: 391 QEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLAC 450
           Q  F++   +I  D E     +  GQ YF  +   N K DF+ ++N Y  N   Y ++ C
Sbjct: 248 QSEFQHVWDSIHQDGEDVMPNHLNGQTYFNSRQLGNIKYDFENSKNEYLNNPNAY-EIGC 306

Query: 451 LLYKQG-KFTESEALF 465
           +L + G K +E+   F
Sbjct: 307 ILMENGAKLSEAAMAF 322

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 60/128 (46%), Gaps = 19/128 (14%)

Query: 102 LPNGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFY 161
           LP  +PD+    GL                  F+    F + I  ++ A+ ++PND + +
Sbjct: 391 LPRVDPDVQLCLGLL-----------------FYADSEFDKTIDCFKAALSVNPNDELMW 433

Query: 162 SNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAM-FDLSVLSL 220
           + + A   ++    + ++   KAL++KP   +A    A ++ ++G + +A  + LS L +
Sbjct: 434 NRLGASLANSNRSEEAIQAYYKALQLKPSFVRARYNLAVSSINIGCYKEAAEYLLSALKM 493

Query: 221 NGDFDGAS 228
           + + +G S
Sbjct: 494 H-EVEGVS 500

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 48/88 (54%), Gaps = 1/88 (1%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F++   F + I  ++ A+++ PND + ++ + A   ++    + ++   KAL +KP   +
Sbjct: 460 FYSNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVR 519

Query: 194 ALLRRASANESLGNFTD-AMFDLSVLSL 220
           A    A ++ ++G + + A + L+ LS+
Sbjct: 520 ARYNLAVSSINIGCYKEAAQYLLTALSM 547

>Smik_11.232 Chr11 complement(381701..384082) [2382 bp, 793 aa] {ON}
           YKL022C (REAL)
          Length = 793

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 51/91 (56%), Gaps = 5/91 (5%)

Query: 112 LKGLTLSQKQTYAVQLKNKGNHFFTTKNFTE-AIKYYQCAIELDPNDPVFYSNISACYIS 170
           +K L  S + T ++QL N G H +   N  E AIK ++C +E +  +   + ++   Y+ 
Sbjct: 616 VKDLDPSSRTTISIQL-NLG-HTYRKLNENEIAIKCFKCVLEKNDKNSEIHCSLGYLYLK 673

Query: 171 TGDLNKVLEYTTKALEIKPDHSKA--LLRRA 199
           T  L K +++  K+L +KP+++ A  LL+ A
Sbjct: 674 TKKLQKAIDHLHKSLYLKPNNASATTLLKNA 704

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 19/99 (19%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSN----ISACYISTGDLNKVLEYTTKALEIKP 189
            F  KNF  ++K +Q   EL  N+PV   +    I AC+    D    +    ++LE+ P
Sbjct: 207 LFRKKNFMASLKLFQ---ELLVNNPVLKPDPRIGIGACFWQLKDYKMAINAWERSLELDP 263

Query: 190 DHS------------KALLRRASANESLGNFTDAMFDLS 216
            +             K L+   + +E   NF DAM DLS
Sbjct: 264 TNKNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 5/109 (4%)

Query: 108 DISQLKGLTL-SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPV----FYS 162
           ++  LK L    +    A   KN+ N  +  K F +A + Y   I++   D       ++
Sbjct: 68  ELEALKALAYEGEPHEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFA 127

Query: 163 NISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDA 211
           N +AC +   +    +    KA+EI P + K   R   A  +LG F +A
Sbjct: 128 NRAACELELKNYRSCVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 38.1 bits (87), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 142 EAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDH 191
           E+I+++Q A+ +D ND   +  +   Y + G L   ++   KA E+ PDH
Sbjct: 696 ESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATELAPDH 745

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 59/144 (40%), Gaps = 8/144 (5%)

Query: 377 YIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQN 436
           Y  L ++  +K+   E  ++FQ A+ +D+    ++   GQ Y+       +   F+KA  
Sbjct: 681 YRVLGVSYLEKQKEPESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATE 740

Query: 437 LYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEILTD-------K 489
           L P++++     A  L   G++ +   +      K P           IL D       +
Sbjct: 741 LAPDHLFAGYFKAISLAGIGEYEQCIEIIAALLEKLPNEESFQVSMVNILIDYSVELFSQ 800

Query: 490 GDFSTAIKQ-YDIAKRLEEVQEKI 512
           G  + A+ Q  D  KR+E +   I
Sbjct: 801 GYLAKAVAQAVDSIKRIEYIISNI 824

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 37.7 bits (86), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 59/135 (43%), Gaps = 19/135 (14%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           + Q+   +  K++++D     T+YH G+++ I  DY  A   FQ+A N    N   +  +
Sbjct: 285 DPQKALSFLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 344

Query: 449 ACLLYKQGKFTES-EALFNETKLKFPTLPEVPAFFAEILTDKG--------DFSTAIKQY 499
             L Y+  ++ ++ +A     +L          + +E+  D G          + A+  Y
Sbjct: 345 GVLYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLTDALDAY 396

Query: 500 DIAKRLEEVQEKIHV 514
             A RL+   E +H+
Sbjct: 397 KQAARLDP--ENMHI 409

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 1/83 (1%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G       ++T A   +Q A+  D  +P+F+ +I   Y         L+  T+A+ + P 
Sbjct: 311 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 370

Query: 191 HSKALLRRASANESLGN-FTDAM 212
            S+      +  E+  N  TDA+
Sbjct: 371 ISEVWYDLGTLYETCNNQLTDAL 393

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 37.4 bits (85), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 127 LKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPV----FYSNISACYISTGDLNKVLEYTT 182
            K +GN  +  K F +A + Y   + ++  D       ++N +AC +   +  + +E  +
Sbjct: 86  FKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCS 145

Query: 183 KALEIKPDHSKALLRRASA 201
           KAL I P ++K   R + A
Sbjct: 146 KALSINPKNTKCYYRTSKA 164

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAIELDP-NDP---VFYSNISACYISTGDLNKVLEYT 181
           + +N+G  +F   ++  + + Y+ ++   P N P   + YSNI A  +  G+ +K L+ +
Sbjct: 405 EFRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKIGEYSKSLKNS 464

Query: 182 TKALEIKPDHS 192
           + ALE+ PD +
Sbjct: 465 SSALEMFPDDT 475

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 46/109 (42%), Gaps = 5/109 (4%)

Query: 108 DISQLKGLTL-SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDP----VFYS 162
           ++  LK L    +    A   KN+GN  +  K F +A   Y   IE+  +D     +   
Sbjct: 60  ELEALKALAYDGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLL 119

Query: 163 NISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDA 211
           N +AC +   +  + +    +AL++ P + KA  R   A   L    +A
Sbjct: 120 NRAACELELKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEA 168

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 79/214 (36%), Gaps = 18/214 (8%)

Query: 279 ISRVNNSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGPLKE 338
           +  V  S +F   Y+ L D    +YS          + +   T A+     S    P   
Sbjct: 596 VQAVKTSENFAPGYSTLGD----IYS----------EYYQDPTRAFKCYFKSFEMDPSDL 641

Query: 339 NAALAFC--YTGIFHFLKNNLLGAQALLQESIN--LHPTPNSYIFLALTLADKENSQEFF 394
            AA   C  Y G   +   +L+  + +  E     L      Y  L +   +K+   E  
Sbjct: 642 TAARYMCEKYCGSCDWQSASLIAERVVKAEKSKSILQNVNWPYRVLGIAHLEKQAESESI 701

Query: 395 KYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYK 454
           ++FQ A+ ++     ++   GQ Y+       +   F+KA  + P N Y +   A  L K
Sbjct: 702 EWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALEVSPGNAYAHYFKALSLSK 761

Query: 455 QGKFTESEALFNETKLKFPTLPEVPAFFAEILTD 488
            G + ES  +F E   + P          E+L +
Sbjct: 762 MGLYDESIEIFRELTAEHPDEESYQVSMVEVLVE 795

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 40/72 (55%)

Query: 141 TEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRAS 200
           +E+I+++Q A+ ++P D   +  +   Y S G +   ++   KALE+ P ++ A   +A 
Sbjct: 698 SESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALEVSPGNAYAHYFKAL 757

Query: 201 ANESLGNFTDAM 212
           +   +G + +++
Sbjct: 758 SLSKMGLYDESI 769

>Skud_11.206 Chr11 complement(375601..378009) [2409 bp, 802 aa] {ON}
           YKL022C (REAL)
          Length = 802

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 3/85 (3%)

Query: 112 LKGLTLSQKQTYAVQLKNKGNHFFTTKNFTE-AIKYYQCAIELDPNDPVFYSNISACYIS 170
           +K L    + T ++QL N G H +   N  E AIK ++C +E    +   + ++   Y+ 
Sbjct: 621 VKDLDPGSRTTISIQL-NLG-HTYRKLNENEIAIKCFKCVLEKSDKNSEIHCSLGYLYLK 678

Query: 171 TGDLNKVLEYTTKALEIKPDHSKAL 195
           T  L K +++  K+L IKP+++ A+
Sbjct: 679 TKKLQKAIDHLHKSLYIKPNNASAM 703

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G   F  + + +A+K Y   I+ +P  PV + N +A +       +V++   KA+ + P
Sbjct: 435 EGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDP 494

Query: 190 DHSKALLRRASA 201
            + KA +R+  A
Sbjct: 495 SYIKAYVRKGFA 506

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 8/95 (8%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAI-ELDPNDPVFYSNISACYISTGDLNKVLEYTTKA 184
           +LK  GN  +  K + +A+ Y+  A+ +   N  + YSN +A +I      + LE     
Sbjct: 10  ELKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNC 69

Query: 185 LEIKPDHSKALLRRASA-------NESLGNFTDAM 212
           +E+ P+  K   R   A       +E+  NF  A+
Sbjct: 70  VELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKAL 104

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 118 SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKV 177
           ++K+  A + K  GN  +  +NF EAI +Y  A      D  + +NI A     GD   V
Sbjct: 289 TEKKRRADEEKRIGNDLYKKRNFKEAIIHYTKAWNTF-QDITYLNNIGAAQFERGDYGNV 347

Query: 178 LEYTTKAL 185
           L+   +A+
Sbjct: 348 LKSLGQAV 355

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 5/93 (5%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPV-----FYSNISACYISTGDLNKVL 178
           A   KN+GN  +  K F +A   Y   I+++ N  V      ++N +AC +   +  + +
Sbjct: 76  AENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCI 135

Query: 179 EYTTKALEIKPDHSKALLRRASANESLGNFTDA 211
                AL++ P + K   R   A  +L    +A
Sbjct: 136 NDCKNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/99 (19%), Positives = 54/99 (54%), Gaps = 2/99 (2%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F+  ++F + I  ++ A+ + P+D   ++ + A   ++    + ++   +A+++KP   +
Sbjct: 427 FYANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVR 486

Query: 194 ALLRRASANESLGNFTDAMFD-LSVLSLNGDFDGASIEP 231
           A    A ++ ++G + +A    L+ LS++ + +G ++ P
Sbjct: 487 ARYNLAVSSMNIGCYREAAEHLLTALSMH-EVEGVAMAP 524

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           + Q+   Y  K++++D     T+YH G+++ I  DY  A   FQ+A N    N   +  +
Sbjct: 285 DPQKALNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 344

Query: 449 ACLLYKQGKFTES 461
             L Y+  ++ ++
Sbjct: 345 GVLYYQISQYRDA 357

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 1/83 (1%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G       ++T A   +Q A+  D  +P+F+ +I   Y         L+  T+A+ + P 
Sbjct: 311 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 370

Query: 191 HSKALLRRASANESLGN-FTDAM 212
            S+      +  E+  N  TDA+
Sbjct: 371 ISEVWYDLGTLYETCNNQLTDAL 393

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 50/117 (42%), Gaps = 1/117 (0%)

Query: 391 QEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLAC 450
           Q+   Y  K+++ D     T+YH G+++ I  DY  A   FQ+A N    N   +  +  
Sbjct: 281 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 340

Query: 451 LLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEIL-TDKGDFSTAIKQYDIAKRLE 506
           L Y+  ++ ++   +       P + EV      +  T     S A+  Y  A RL+
Sbjct: 341 LYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLD 397

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 55/146 (37%), Gaps = 9/146 (6%)

Query: 133 HFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHS 192
           H   T ++T A   +Q A+  D  +P+F+ +I   Y         L+  T+A+ + P  S
Sbjct: 308 HMIRT-DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYIS 366

Query: 193 KALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSKG 252
           +      +  E+  N      D    +   D +   I   LE  L KQ     N N S G
Sbjct: 367 EVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEA-LTKQLENPGNMNKSNG 425

Query: 253 DGRGSQLLPSNTSLTSFFGIFDPDLE 278
                   P+N S      I  P L+
Sbjct: 426 -------APTNASPAPPPVILQPTLQ 444

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 41/82 (50%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G ++   +   E+I+++Q A+ +D +D   +  +   Y + G +   ++   +ALE+ P+
Sbjct: 667 GVYYLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELSPE 726

Query: 191 HSKALLRRASANESLGNFTDAM 212
           H  A L  A +   L  F  ++
Sbjct: 727 HKYAGLFLAISLCQLSEFEKSL 748

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 49/111 (44%)

Query: 363 LLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQ 422
           +++  ++L+     Y  L +   + +   E  ++FQ A+ +DS     +   GQ Y    
Sbjct: 649 VIKNDMHLNSVNWPYRVLGVYYLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACG 708

Query: 423 DYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFP 473
               +   F++A  L PE+ Y  + LA  L +  +F +S     +   K+P
Sbjct: 709 RIEASIKVFERALELSPEHKYAGLFLAISLCQLSEFEKSLEALRKLVNKYP 759

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F++  ++ + +  ++ A+ + P+D + ++ + A   ++    + ++   KAL++KP   +
Sbjct: 429 FYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 488

Query: 194 ALLRRASANESLGNFTDAM-FDLSVLSLN 221
           A    A +  ++G F +A  + L+ LS++
Sbjct: 489 ARCNLAVSCMNMGCFKEAAEYLLTALSMH 517

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 1/83 (1%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G      K+FT A +  Q A+  D  +P+F+ +I   Y   G  +  L+  T+A+ + P 
Sbjct: 421 GRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPY 480

Query: 191 HSKALLRRASANESLGN-FTDAM 212
            S+      +  E+  +  TDA+
Sbjct: 481 ISEVWYNLGTLYETCNDQITDAL 503

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 71/324 (21%), Positives = 123/324 (37%), Gaps = 49/324 (15%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIE--LDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIK 188
           G+ +    +  +A   YQ A+    DPN P  +  I   Y   G L+   E   K L++ 
Sbjct: 239 GHCYLMLDDLQKAYNAYQQALNNLSDPNVPKLWHGIGILYDRYGSLDFAEEAFKKVLDLD 298

Query: 189 PDHSKA---LLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVL 245
           P+  KA     R     +  G + +A+  L+ +            P+ E ++  Q   +L
Sbjct: 299 PNFEKANEIYFRLGIIYKHKGRWNEAIESLNCIL------KRPPPPLTESDIWFQIGNIL 352

Query: 246 NENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVNNSSHFDTAYALLSDALQKLYSA 305
            EN  K D  G++               D    +S+ NNS+        L   L  LYS 
Sbjct: 353 -EN--KFDWNGAK---------------DAYEHVSKNNNSN------PKLLKQLGCLYSM 388

Query: 306 TNEGYLTADKLFTSATDAYHSLLASQVDGPLKENAALAFCYTGIFHFLKNNLLGAQALLQ 365
            N  +   D          H + + ++D       +  + Y G  H  K +   A   LQ
Sbjct: 389 ENVEFYNLDIAMG------HLVKSLELD----PTDSTTWYYLGRIHMAKKDFTAAYESLQ 438

Query: 366 ESINLHP-TPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDY 424
           +++N     P  +  + +       + +    + +AI L+      +Y+ G +Y    D 
Sbjct: 439 QAVNRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQ 498

Query: 425 VNAKAD-FQKAQNLYPENIYPYIQ 447
           +    D +++A +L PEN  P IQ
Sbjct: 499 ITDALDSYERALSLDPEN--PVIQ 520

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 31/71 (43%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEI 187
           K +GN  F   ++T A K+Y   I  +P +P+ YSN +   I     ++ +      L  
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGLLY 66

Query: 188 KPDHSKALLRR 198
             D     ++R
Sbjct: 67  SSDPEHEAIKR 77

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 51/119 (42%), Gaps = 1/119 (0%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           + Q+   Y  K+++ D     T+YH G+++ I  DY  A   FQ+A N    N   +  +
Sbjct: 281 DPQKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSI 340

Query: 449 ACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEIL-TDKGDFSTAIKQYDIAKRLE 506
             L Y+  ++ ++   +       P + EV      +  T     S A+  Y  A RL+
Sbjct: 341 GVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLD 399

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 2/81 (2%)

Query: 133 HFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHS 192
           H   T ++T A   +Q A+  D  +P+F+ +I   Y         L+  T+A+ + P  S
Sbjct: 310 HMIRT-DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYIS 368

Query: 193 KALLRRASANESLGN-FTDAM 212
           +      +  E+  N  +DA+
Sbjct: 369 EVWYDLGTLYETCNNQLSDAL 389

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 45/82 (54%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKP 189
           +G  ++   +F + I+ ++ +++++PND V ++ + A   ++      ++   +AL +KP
Sbjct: 437 RGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKP 496

Query: 190 DHSKALLRRASANESLGNFTDA 211
              +A    A A+ ++G + +A
Sbjct: 497 SFVRARYNLAVASMNIGCYKEA 518

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 53/125 (42%), Gaps = 17/125 (13%)

Query: 391 QEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLAC 450
           Q+   Y  K+++ D     T+YH G+++ I  DY  A   FQ+A N    N   +  +  
Sbjct: 279 QKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGV 338

Query: 451 LLYKQGKFTES-EALFNETKLKFPTLPEVPAFFAEILTDKG--------DFSTAIKQYDI 501
           L Y+  ++ ++ +A     +L          + +E+  D G          S A+  Y  
Sbjct: 339 LYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLSDALDAYKQ 390

Query: 502 AKRLE 506
           A RL+
Sbjct: 391 AARLD 395

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 55/146 (37%), Gaps = 9/146 (6%)

Query: 133 HFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHS 192
           H   T ++T A   +Q A+  D  +P+F+ +I   Y         L+  T+A+ + P  S
Sbjct: 306 HMIRT-DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYIS 364

Query: 193 KALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSKG 252
           +      +  E+  N      D    +   D +   I   LE  L KQ     N N S G
Sbjct: 365 EVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEA-LTKQLENPGNINKSNG 423

Query: 253 DGRGSQLLPSNTSLTSFFGIFDPDLE 278
                   P+N S      I  P L+
Sbjct: 424 -------APTNASPAPPPVILQPTLQ 442

>NDAI0J00710 Chr10 (150941..151948) [1008 bp, 335 aa] {ON} Anc_7.458
           YJR088C
          Length = 335

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%)

Query: 408 PPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQG 456
           P T++  G++YF L+DY  AK  F++   + P N   + +L+ +LY Q 
Sbjct: 176 PETWWFMGEVYFQLKDYHKAKYCFEEILIIMPFNYEAFARLSEVLYYQA 224

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 38/92 (41%), Gaps = 4/92 (4%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPN----DPVFYSNISACYISTGDLNKVLE 179
           A   KN+GN  +  K F +A + Y   IE+  +    +   Y+N +AC +   +    + 
Sbjct: 78  AENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCIS 137

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDA 211
               AL   P + K   R   A  ++  F  A
Sbjct: 138 DCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} some
           similarities with uniprot|P09798 Saccharomyces
           cerevisiae YKL022c CDC16
          Length = 743

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 28/64 (43%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G  +  +   T A +Y+  A E  P DPV  + I       G+L+K   Y  KA E   D
Sbjct: 530 GMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVLKFKKGELHKAKRYLKKAAECCKD 589

Query: 191 HSKA 194
             ++
Sbjct: 590 MERS 593

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 38/73 (52%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           + Q+      K++++DS    ++YH G+++ I  DY +A   FQ+A N    N   +  +
Sbjct: 339 DPQKALNLLLKSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSI 398

Query: 449 ACLLYKQGKFTES 461
             L Y+  ++ ++
Sbjct: 399 GVLYYQIAQYRDA 411

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 33/84 (39%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G       ++T A   +Q A+  D  +P F+ +I   Y         L+  T+A+ + P 
Sbjct: 365 GRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNPY 424

Query: 191 HSKALLRRASANESLGNFTDAMFD 214
            S+      +  E+  N  +   D
Sbjct: 425 ISEVWYDLGTLYETCNNQVNDALD 448

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 57/135 (42%), Gaps = 19/135 (14%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           N+Q       K++++DS    T+YH G+++ +  DY  A   FQ A N    N   +  +
Sbjct: 297 NTQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSI 356

Query: 449 ACLLYKQGKFTES-EALFNETKLKFPTLPEVPAFFAEILTDKG--------DFSTAIKQY 499
             L Y+  ++ ++ +A     +L          + +E+  D G          + A+  Y
Sbjct: 357 GVLYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLTDALDAY 408

Query: 500 DIAKRLEEVQEKIHV 514
             A RL+     +H+
Sbjct: 409 KQAARLDT--NNVHI 421

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G       ++T A   +Q A+  D  +P F+ +I   Y         L+  T+A+ + P 
Sbjct: 323 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 382

Query: 191 HSKALLRRASANESLGN-FTDAM 212
            S+      +  E+  N  TDA+
Sbjct: 383 ISEVWYDLGTLYETCNNQLTDAL 405

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 17/127 (13%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           + Q+   Y  K+++ D     T+YH G+++ I  DY  A   FQ+A N    N   +  +
Sbjct: 271 DPQKALDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSI 330

Query: 449 ACLLYKQGKFTES-EALFNETKLKFPTLPEVPAFFAEILTDKG--------DFSTAIKQY 499
             L Y+  ++ ++ +A     +L          + +E+  D G          S A+  Y
Sbjct: 331 GVLYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLSDALDAY 382

Query: 500 DIAKRLE 506
             A RL+
Sbjct: 383 KQAARLD 389

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 47/120 (39%), Gaps = 2/120 (1%)

Query: 133 HFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHS 192
           H   T ++T A   +Q A+  D  +P+F+ +I   Y         L+  T+A+ + P  S
Sbjct: 300 HMIRT-DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYIS 358

Query: 193 KALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSKG 252
           +      +  E+  N      D    +   D +   I   LE  L KQ     N N S G
Sbjct: 359 EVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEA-LTKQLENPGNINKSNG 417

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 44/77 (57%)

Query: 135 FTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKA 194
           ++  +F + ++ +Q A++++PND + ++ + A   ++    + ++   KA+ +KP   +A
Sbjct: 452 YSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRA 511

Query: 195 LLRRASANESLGNFTDA 211
               A A+ ++G + +A
Sbjct: 512 RYNLAVASMNIGCYQEA 528

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 49/109 (44%), Gaps = 3/109 (2%)

Query: 113 KGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTG 172
           K  T++ + TYA  L+  G+   +   F  A   Y+ AI  DPN    Y  +  C +  G
Sbjct: 643 KATTINPRFTYAYTLE--GHEQASIDAFDTAKNCYRKAIACDPNHYNAYYGLGTCCMRLG 700

Query: 173 DLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLN 221
             ++ L Y  KA  I P ++  L    SA E L NF +   +   L+ N
Sbjct: 701 QYDQALLYFEKAKMINPSNAILLCCCGSALEKL-NFNEKALNYYELACN 748

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 6/71 (8%)

Query: 105 GEPDISQLKGLT-----LSQKQTYAVQ-LKNKGNHFFTTKNFTEAIKYYQCAIELDPNDP 158
           G  D+++ + L      L  K T + Q  K+ GN  F    +  AI+ Y+  I L+P + 
Sbjct: 10  GHQDVNRQRNLKHWNNGLQDKLTMSFQHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNA 69

Query: 159 VFYSNISACYI 169
           V YSN++  Y+
Sbjct: 70  VGYSNLAMAYL 80

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 89/226 (39%), Gaps = 31/226 (13%)

Query: 344 FCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQE-----FFKYFQ 398
           +C  G    LK +   +    Q S  L P   S+ + A TL   E S           ++
Sbjct: 413 WCCIGNLFSLKKDHEESIKAFQRSTQLDP---SFTY-AYTLQGHEYSSNDAFDTAMTCYR 468

Query: 399 KAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKF 458
           KA+  +S++   YY  G     L  Y      F+KA+++ P N+   I + C      K 
Sbjct: 469 KALASNSQHYNAYYGLGMCSLKLGQYEECLLHFEKARSINPVNV---ILICCCGVALEKL 525

Query: 459 TESEALFNETKLKFPTLPEVP-AFF--AEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVG 515
           +  E       L     P    A F  A++L   G ++ A++ ++   ++   +  IH  
Sbjct: 526 SHQERALQNYDLACELQPMSSLALFKRAQLLLAMGKYNYALESFEKLVKIAPDEATIHFL 585

Query: 516 IGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQ 561
           +G L     I+ R+  QD           A+  LT A  LDP+  Q
Sbjct: 586 LGQLY---QIVGRK--QD-----------AVKELTIAMNLDPKGSQ 615

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 33.5 bits (75), Expect = 0.41,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 32/70 (45%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEI 187
           K +GN  +    + +AI  Y   I   P +PV +SN +   I  G+  + +E   + L++
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 188 KPDHSKALLR 197
                 A LR
Sbjct: 68  AASPQHAALR 77

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%)

Query: 163 NISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLG 206
           N++AC+    DL + L Y+ K ++++P + K  +RR    + LG
Sbjct: 72  NLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRRGKVLQKLG 115

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 43/93 (46%), Gaps = 4/93 (4%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAI----ELDPNDPVFYSNISACYISTGDLNKVLE 179
           A   K +GN  +  K F +A + Y   I    +++  +   Y+N +AC +   +  + + 
Sbjct: 81  AENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCIN 140

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDAM 212
              +AL++ P + K   R A A  +L    +A+
Sbjct: 141 DCKQALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 35.8 bits (81), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 31/61 (50%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G  +   +  +E+++++  A+ +DPND   +  +   Y + G +    +   KA+EI P 
Sbjct: 692 GIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGRVEASTKVFEKAIEIDPL 751

Query: 191 H 191
           H
Sbjct: 752 H 752

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 49/115 (42%), Gaps = 5/115 (4%)

Query: 368 INLHPTPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNA 427
           + L  T   Y  + +   +++   E  ++F  A+ +D     ++   GQ YF       +
Sbjct: 679 MELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGRVEAS 738

Query: 428 KADFQKAQNLYPENIYPYIQLACLLYKQGKFTES-EALFNETKLKFPTLPEVPAF 481
              F+KA  + P ++Y     +  L + G F E  E L N T+L     PE  AF
Sbjct: 739 TKVFEKAIEIDPLHLYAQYFNSLSLAEMGCFEECIEILKNITQLN----PEELAF 789

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 66/170 (38%), Gaps = 16/170 (9%)

Query: 415 GQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPT 474
           G+++F L +Y  +   F   + L P  +      + LL+      +   L NE  +  P 
Sbjct: 474 GKLHFELVNYDVSLHYFTNLRKLQPTRVSDLEIYSTLLWHLHDKVKLSILANELVMNIPN 533

Query: 475 LPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDP 534
            P+        L+ + D   AIK ++ A +++           P    A  L     Q  
Sbjct: 534 APQTWCCMGNFLSLQKDHEDAIKAFEKATQVD-----------PNFAYAYTL-----QGH 577

Query: 535 TQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQ 584
                + F+TA     KA   DP+   A  GL    +++ + D+A+  F+
Sbjct: 578 EHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFE 627

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 68/171 (39%), Gaps = 22/171 (12%)

Query: 397 FQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQG 456
           ++KA+  D ++   YY  G     L  Y  A   F+KA+++ P N+   I + C      
Sbjct: 592 YRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV---ILICCCGVALE 648

Query: 457 KFTESEALFNETKLKFPTLPEVP-AFF--AEILTDKGDFSTAIKQYDIAKRLEEVQEKIH 513
           K    E   +  +L     P    A F  A +L   G +S A++ ++   +L   +  +H
Sbjct: 649 KLQYQEKALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEATVH 708

Query: 514 VGIGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKI 564
             +G L     IL R+               A+   T A  LDP+  Q  I
Sbjct: 709 FLLGQLY---QILGRKKD-------------AVKEFTIAMNLDPKGNQLII 743

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 59/135 (43%), Gaps = 19/135 (14%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           + Q+   +  K+++++     T+YH G+++ I  DY  A   FQ+A N    N   +  +
Sbjct: 257 DPQKALNFLLKSLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 316

Query: 449 ACLLYKQGKFTES-EALFNETKLKFPTLPEVPAFFAEILTDKG--------DFSTAIKQY 499
             L Y+  ++ ++ +A     +L          + +E+  D G          + A+  Y
Sbjct: 317 GVLYYQISQYRDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLTDALDAY 368

Query: 500 DIAKRLEEVQEKIHV 514
             A RL+   E +H+
Sbjct: 369 KQAARLDP--ENVHI 381

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 36/83 (43%), Gaps = 1/83 (1%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G       ++T A   +Q A+  D  +P+F+ +I   Y         L+  T+A+ + P 
Sbjct: 283 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 342

Query: 191 HSKALLRRASANESLGN-FTDAM 212
            S+      +  E+  N  TDA+
Sbjct: 343 ISEVWYDLGTLYETCNNQLTDAL 365

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 41/95 (43%), Gaps = 5/95 (5%)

Query: 108 DISQLKGLTL-SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPV----FYS 162
           ++  LK L    +    A   K +GN  +  K F +A + Y   + ++  D       ++
Sbjct: 66  ELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFA 125

Query: 163 NISACYISTGDLNKVLEYTTKALEIKPDHSKALLR 197
           N +AC +   +  K +E   KAL I P + K   R
Sbjct: 126 NRAACELELKNYRKCVEDCGKALTINPKNIKCYYR 160

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 7/88 (7%)

Query: 411 YYHRGQMYFILQDYVNAKADFQKAQNLYPEN----IYPYIQLACLLYKQGKFTESEALFN 466
           Y  RG  +F   DYV+A  +++K+ N  P+N    I  Y  L   L+K G++   +   +
Sbjct: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEY---KRCLS 332

Query: 467 ETKLKFPTLPEVPAFFAEILTDKGDFST 494
           + +      P+ P  + E + D     T
Sbjct: 333 DIESALEMFPKDPNLWDEPIQDSQPIRT 360

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 50/125 (40%), Gaps = 25/125 (20%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDP----VFYSNISACYISTGDLNKVLEYT 181
           + K++G  FF   ++  A + Y+ ++   P +     V YSN++A     G+  + L   
Sbjct: 275 EYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDI 334

Query: 182 TKALEIKPD---------------------HSKALLRRASANESLGNFTDAMFDLSVLSL 220
             ALE+ P                        K + RRA A E + N+  A+ D   L  
Sbjct: 335 ESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIE 394

Query: 221 NGDFD 225
             +F+
Sbjct: 395 KNNFN 399

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 36/73 (49%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           + Q       K++++DS    T+YH G+++ +  DY  A   FQ+A N    N   +  +
Sbjct: 359 DPQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSI 418

Query: 449 ACLLYKQGKFTES 461
             L Y+  ++ ++
Sbjct: 419 GVLYYQISQYRDA 431

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/89 (19%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F++  ++ + +  ++ A+ + P+D + ++ + A   ++    + ++   KAL++KP   +
Sbjct: 436 FYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 495

Query: 194 ALLRRASANESLGNFTDAM-FDLSVLSLN 221
           A    A +  ++G + +A  + L+ LS++
Sbjct: 496 ARCNLAVSCMNMGCYKEAAEYLLTALSMH 524

>CAGL0A03630g Chr1 complement(369404..372592) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047c TFC4
          Length = 1062

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 34/81 (41%), Gaps = 15/81 (18%)

Query: 137 TKNFTEAIKYY--------QCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIK 188
           ++ + EAI ++         C IEL       Y  ++ CY    D  K  EY  K LE+ 
Sbjct: 493 SEKYKEAIDFFTPLLSIPEWCTIEL-------YEPLTKCYKEIEDYEKAKEYGDKVLEMD 545

Query: 189 PDHSKALLRRASANESLGNFT 209
           P    A L  A  N  LG+ T
Sbjct: 546 PKSMDAKLNVAEINYYLGDKT 566

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 15/78 (19%), Positives = 40/78 (51%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F+    F + I  ++ A+ + PND   ++ + A   ++    + ++   +A+++KP   +
Sbjct: 431 FYANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVR 490

Query: 194 ALLRRASANESLGNFTDA 211
           A    A ++ ++G + +A
Sbjct: 491 ARYNLAVSSMNIGCYKEA 508

>ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 577

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 26/133 (19%), Positives = 60/133 (45%), Gaps = 19/133 (14%)

Query: 102 LPNGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFY 161
           LP  +PD+    GL                  F+    F + I  ++ A+ ++ ND + +
Sbjct: 421 LPQVDPDVQLCLGLL-----------------FYVDDQFDKTIDCFKAALSVNSNDELMW 463

Query: 162 SNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFD-LSVLSL 220
           + + A   ++    + ++   +AL++KP   +A    A ++ ++G + +A    L+ LS+
Sbjct: 464 NRLGASLANSSRSEEAIQAYHRALQLKPSFVRARYNLAVSSINIGCYKEAAEHLLTALSM 523

Query: 221 NGDFDGASIEPML 233
           + +  G +  P +
Sbjct: 524 H-EVSGGATNPSM 535

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/89 (19%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F+  +++ + I  ++ A+ + P+D + ++ + A   ++    + ++   +AL++KP   +
Sbjct: 432 FYANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 491

Query: 194 ALLRRASANESLGNFTDAM-FDLSVLSLN 221
           A    A ++ ++G + +A  + L+ LS++
Sbjct: 492 ARYNLAVSSMNIGCYKEAAEYLLTALSMH 520

>Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON}
           (25908..28082) [2175 nt, 725 aa]
          Length = 724

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G  +      T A +Y+  A ++ PNDP+  + +   +    DL K   Y  KALE   D
Sbjct: 509 GMQYMALNTLTLAEEYFTLAYDIYPNDPLLLNEMGVLHFKKNDLQKSKRYLKKALEAAKD 568

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 113 KGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTG 172
           K +  + K + ++Q+ N  + +        AIK ++  +E+   DP  + ++   Y+ T 
Sbjct: 567 KDMDSTSKTSISIQM-NLAHTYRRLGEIEMAIKCFKAILEVCGKDPDIFCSLGFLYLKTK 625

Query: 173 DLNKVLEYTTKALEIKPDHSKA 194
            L K +++   +L +KP +S A
Sbjct: 626 QLQKAIDHLHLSLSLKPSNSVA 647

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 32.7 bits (73), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 2/67 (2%)

Query: 128 KNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE- 186
           K  GN  F    + EA+  Y   I   P +PV YSN +   I   +    ++   + L  
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 187 -IKPDHS 192
            + P+H+
Sbjct: 72  ALGPEHA 78

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           + Q+      K++++D     T+YH G+++ I  DY  A   FQ+A N    N   +  +
Sbjct: 286 DPQKALNLLLKSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSI 345

Query: 449 ACLLYKQGKF 458
             L Y+  ++
Sbjct: 346 GVLYYQISQY 355

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 35/87 (40%), Gaps = 4/87 (4%)

Query: 121 QTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEY 180
           QT+ V     GNHF   K+  EAIK +  A ELDP     Y+     Y S    +    +
Sbjct: 495 QTWCVL----GNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTF 550

Query: 181 TTKALEIKPDHSKALLRRASANESLGN 207
             KAL     H  A     + +   GN
Sbjct: 551 YRKALACDSQHYNAYYGLGTCDSQNGN 577

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 36/175 (20%), Positives = 65/175 (37%), Gaps = 16/175 (9%)

Query: 415 GQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPT 474
           G++++ +Q+Y  A + F++ + + P  +      + LL+      +   L NE    FP 
Sbjct: 433 GKLHYEIQNYKMALSHFERLRIIQPTRLNDLEIFSTLLWHLHDKVKLSNLANELIDNFPE 492

Query: 475 LPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDP 534
             +         + + D   AIK ++ A  L+           P    A  L     Q  
Sbjct: 493 AAQTWCVLGNHFSLQKDHDEAIKAFNKATELD-----------PRFAYAYTL-----QGH 536

Query: 535 TQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQDSAIL 589
                E F+TA     KA   D +   A  GL     Q    D ++  F+ + ++
Sbjct: 537 EYASNESFDTARTFYRKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKARMI 591

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 36/73 (49%)

Query: 389 NSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQL 448
           ++Q       K++++DS    T+YH G+++ +  DY  A   FQ A N    N   +  +
Sbjct: 293 DTQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSI 352

Query: 449 ACLLYKQGKFTES 461
             L Y+  ++ ++
Sbjct: 353 GVLYYQISQYRDA 365

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G       ++T A   +Q A+  D  +P F+ +I   Y         L+  T+A+ + P 
Sbjct: 319 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 378

Query: 191 HSKALLRRASANESLGN-FTDAM 212
            S+      +  E+  N  TDA+
Sbjct: 379 ISEVWYDLGTLYETCNNQLTDAL 401

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%)

Query: 399 KAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKF 458
           K++++DS    T+YH G+++ +  DY  A   FQ+A N    N   +  +  L Y+  ++
Sbjct: 299 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQY 358

Query: 459 TES 461
            ++
Sbjct: 359 RDA 361

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G       ++T A   +Q A+  D  +P F+ +I   Y         L+  T+A+ + P 
Sbjct: 315 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 374

Query: 191 HSKALLRRASANESLGN-FTDAM 212
            S+      +  E+  N  TDA+
Sbjct: 375 ISEVWYDLGTLYETCNNQLTDAL 397

>TDEL0B02330 Chr2 complement(423968..426076) [2109 bp, 702 aa] {ON}
           Anc_5.689 YOR080W
          Length = 702

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 163 NISACYISTGDLNKVLEYTTKALEIKPDHSKALLR 197
           N+SA Y   GDL K L Y TK +E+ P + K  +R
Sbjct: 78  NMSATYEKLGDLKKALSYATKMVEVDPYNLKCYIR 112

>Suva_11.204 Chr11 complement(378512..380893) [2382 bp, 793 aa] {ON}
           YKL022C (REAL)
          Length = 793

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 49/91 (53%), Gaps = 5/91 (5%)

Query: 112 LKGLTLSQKQTYAVQLKNKGNHFFTTKNFTE-AIKYYQCAIELDPNDPVFYSNISACYIS 170
           ++ L    + T ++QL N G H +   N  E AIK ++C +E +  +   + ++   Y+ 
Sbjct: 612 VRDLDPGSRTTISIQL-NLG-HTYRKLNENEIAIKCFKCVLEKNDKNSEVHCSLGYLYLK 669

Query: 171 TGDLNKVLEYTTKALEIKPDHSKA--LLRRA 199
           T  L K +++  K+L +KP++  A  LL+ A
Sbjct: 670 TKKLQKAIDHLHKSLYLKPNNVSATTLLKNA 700

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 89/220 (40%), Gaps = 17/220 (7%)

Query: 363 LLQESINLHP-TPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFIL 421
           L  E +N  P  P ++  +    +  ++  E  K F+KA  LD ++   Y  +G  +   
Sbjct: 509 LSDELMNSFPEAPETWCVVGNYFSLIKDHGEAIKAFEKATSLDRKFAYAYTLQGHEHAAN 568

Query: 422 QDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAF 481
           + Y  AK  ++KA    P++   Y  L     + GK+ ++   F + ++  P    +   
Sbjct: 569 ETYDTAKIMYRKAIACDPQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNAILICC 628

Query: 482 FAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEK 541
               L        A+  Y++A++L   Q ++ +   P   KA +L              K
Sbjct: 629 CGHSLEKLNLPDQALTYYELAEKL---QPEMTI---PKYKKAQLL----------FSLGK 672

Query: 542 FNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIE 581
           F++A+ +     +L P        L Q+   M +  DAI+
Sbjct: 673 FSSAMYIFESLTKLSPEEVTVHFMLGQIYQTMGRKKDAIK 712

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 431 FQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNE-TKLKFPTLPEVPAFFAEILTDK 489
           ++ A+ L PE   P  + A LL+  GKF+ +  +F   TKL  P    V     +I    
Sbjct: 646 YELAEKLQPEMTIPKYKKAQLLFSLGKFSSAMYIFESLTKLS-PEEVTVHFMLGQIYQTM 704

Query: 490 GDFSTAIKQYDIAKRLEEVQEKI 512
           G    AIK+Y IA  L+ +  ++
Sbjct: 705 GRKKDAIKEYTIALNLDPMGNQV 727

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 54/125 (43%), Gaps = 19/125 (15%)

Query: 399 KAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKF 458
           K+++ DS    T+YH G+++ +  DY  A   FQ+A N    N   +  +  L Y+  ++
Sbjct: 303 KSLEADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQY 362

Query: 459 TES-EALFNETKLKFPTLPEVPAFFAEILTDKG--------DFSTAIKQYDIAKRLEEVQ 509
            ++ +A     +L          + +E+  D G          S A+  Y  A RL+   
Sbjct: 363 RDALDAYTRAIRLN--------PYISEVWYDLGTLYETCNNQLSDALDAYKQAVRLDP-- 412

Query: 510 EKIHV 514
             +H+
Sbjct: 413 NNVHI 417

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 30/74 (40%)

Query: 116 TLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLN 175
           +L    T A    + G       ++T A   +Q A+  D  +P F+ +I   Y       
Sbjct: 304 SLEADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYR 363

Query: 176 KVLEYTTKALEIKP 189
             L+  T+A+ + P
Sbjct: 364 DALDAYTRAIRLNP 377

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 52/120 (43%), Gaps = 5/120 (4%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPV----FYSNISACYISTGDLNKVLE 179
           A   KN+GN  +  + + +A + Y   +E+  +D       + N +AC +   +  + + 
Sbjct: 80  AENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCIN 139

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNK 239
              +AL   P + K   R   A  SL    +A   +    L  D + A++  +L++ + K
Sbjct: 140 DCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIE-FGLRFDSNNAALGALLDKIVKK 198

>Kwal_33.13428 s33 complement(219925..223083) [3159 bp, 1052 aa]
           {ON} YGR047C (TFC4) - transcription factor tau (TFIIIC)
           subunit 131 [contig 117] FULL
          Length = 1052

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 7/110 (6%)

Query: 377 YIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHR--GQMYFILQDYVNAKADFQKA 434
           Y  +A  LA  E  QE  ++F   +DL+ EY      R   + Y  ++DY NAK  F K 
Sbjct: 492 YFEVATALAKAERYQEAIEFFTPLLDLN-EYCTLEVFRMLSKCYKEVEDYENAKIIFGKL 550

Query: 435 QNLYPENIYPYIQLACLLYKQGKFTESEALFNET----KLKFPTLPEVPA 480
             + PE++   + LA + Y  G      AL  E     K +    P++P+
Sbjct: 551 VEMTPEDLETKLTLAEIYYHLGDHDTFNALLLEVVDARKNQAAASPQMPS 600

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAI----ELDPNDPVFYSNISACYISTGDLNKVLEYT 181
           + K++G  +F   ++  A + Y+ ++    +L P   +  SN+ A  + TGD   ++  +
Sbjct: 399 EFKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIS 458

Query: 182 TKALEIKPDHSK 193
           T AL++ P  SK
Sbjct: 459 TSALDLFPKESK 470

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 2/81 (2%)

Query: 133 HFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHS 192
           H   T ++T A   +Q A+  D  +P+F+ +I   Y         L+  T+A+ + P  S
Sbjct: 323 HMIRT-DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYIS 381

Query: 193 KALLRRASANESLGN-FTDAM 212
           +      +  E+  N  +DA+
Sbjct: 382 EVWYDLGTLYETCNNQLSDAL 402

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 1/105 (0%)

Query: 402 DLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTES 461
           ++D     T+YH G+++ I  DY  A   FQ+A N    N   +  +  L Y+  ++ ++
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 462 EALFNETKLKFPTLPEVPAFFAEIL-TDKGDFSTAIKQYDIAKRL 505
              +       P + EV      +  T     S A+  Y  A RL
Sbjct: 367 LDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARL 411

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 48/126 (38%), Gaps = 9/126 (7%)

Query: 105 GEPDISQLKGLTL-SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIEL----DPNDPV 159
           G  ++  LK L    +    A   KN+GN  +  K + +A   Y   IE+    D  +  
Sbjct: 59  GNVELEALKALAYEGEPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGS 118

Query: 160 FYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDA----MFDL 215
            Y N +AC +   +    +    KAL       KA  R   A   L    +A    +F L
Sbjct: 119 LYLNRAACELELRNFRSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEAKGSVLFGL 178

Query: 216 SVLSLN 221
            + S N
Sbjct: 179 KLDSQN 184

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 66/171 (38%), Gaps = 18/171 (10%)

Query: 415 GQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPT 474
           G++++ + +Y  A   F +   L P  I      + LL+    +    +L +     +P 
Sbjct: 490 GKLHYEIVNYEMASIYFMQLFELQPYRISDTEIFSTLLWHLQDYKRLASLVDYLLTYYPN 549

Query: 475 LPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKA-TILARQSSQD 533
            PE        L+ K D   AI+ ++ A +           I P    A T+   + S +
Sbjct: 550 KPETWCCVGNYLSLKKDHEDAIEAFEKATK-----------IDPKFAYAYTLQGHECSSN 598

Query: 534 PTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIELFQ 584
                 + F+ A     KA   DPR   A  G+    +++   D+A+  F+
Sbjct: 599 ------DSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFE 643

>TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.72
           YHR166C
          Length = 622

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 42/87 (48%)

Query: 375 NSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKA 434
           N++  +     +  NS    + +++A+D++++    +Y  GQ Y +L  ++ +   FQKA
Sbjct: 427 NAWTLMGHEFVELRNSHAAIECYRRAVDMNTKDFKAWYGLGQAYEVLDMHLYSLYYFQKA 486

Query: 435 QNLYPENIYPYIQLACLLYKQGKFTES 461
             L P +   +  LA    K G   E+
Sbjct: 487 CTLKPLDKRMWQALASCYAKVGNRQEA 513

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/78 (20%), Positives = 41/78 (52%)

Query: 134 FFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSK 193
           F++   F + I  ++ A+ + P D + ++ + A   ++    + ++   KAL++KP   +
Sbjct: 441 FYSNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPSFVR 500

Query: 194 ALLRRASANESLGNFTDA 211
           A    A ++ ++G + +A
Sbjct: 501 ARYNLAVSSINIGCYKEA 518

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 53/145 (36%), Gaps = 34/145 (23%)

Query: 396 YFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIY------------ 443
           +++KAI  D  +   YY  G     L +Y  A   F+KA+++ P N              
Sbjct: 646 FYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKL 705

Query: 444 -------PYIQLAC---------------LLYKQGKFTESEALFNETKLKFPTLPEVPAF 481
                   Y +LAC               LLY   K+T++   F E     P    V   
Sbjct: 706 GNQEKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFI 765

Query: 482 FAEILTDKGDFSTAIKQYDIAKRLE 506
             ++    G    AIK+Y IA  L+
Sbjct: 766 LGQLYQIMGRKKDAIKRYTIAMNLD 790

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 6/76 (7%)

Query: 140 FTEAIKYYQCAIELDPNDPVFYSNISACYIST---GDLNKVLEYTTKALEIKPDHSKALL 196
           + +A+ Y++ A  ++P++ +    I  C ++    G+  K L Y   A +I+P  S A  
Sbjct: 674 YEQALVYFEKARSINPSNAIL---ICCCGVTMEKLGNQEKALNYYELACQIQPTSSLAKF 730

Query: 197 RRASANESLGNFTDAM 212
           +RA    S+  +T A+
Sbjct: 731 KRAHLLYSMAKYTQAL 746

>ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp,
           785 aa] {ON} similar to uniprot|P09798 Saccharomyces
           cerevisiae YKL022C CDC16 Subunit of the
           anaphase-promoting complex/cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition required for sporulation
          Length = 785

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 26/56 (46%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE 186
           G  +     F+ A +Y+  A +  P DP+  + +   Y    DL+K   Y  +ALE
Sbjct: 572 GMQYMALNTFSLAEEYFTLAYDTCPQDPLLLNEMGVMYFKRNDLHKAKRYLKRALE 627

>KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
           dsRNA virus protection family member contains 8 copies
           of the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 35/69 (50%)

Query: 140 FTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRA 199
           + E+I+++Q +I +  +D   +  +   Y++ G +   ++   K LE+  +H  A    A
Sbjct: 685 YAESIEWFQSSIRVSSSDVESWVGLGQAYLNCGRVEASIKVFKKVLELDENHHFAWYFLA 744

Query: 200 SANESLGNF 208
            A  +LG F
Sbjct: 745 IALSALGEF 753

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%)

Query: 397  FQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQG 456
            F KAI L+S    ++Y    +     D   A+    KAQ++ PE+   ++ LA +  K+G
Sbjct: 975  FIKAIALNSRETGSWYCMAMLALSNNDTDLARDILMKAQSIAPEDSQSWLGLALIYEKEG 1034

Query: 457  KFTESEALF 465
              T+S  +F
Sbjct: 1035 LATDSARMF 1043

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 49/104 (47%), Gaps = 25/104 (24%)

Query: 130 KGNHFFTTKNFTEAIKYYQCAIELDP-NDP---VFYSNISACYISTGDLNKVLEYTTKAL 185
           +G+ FF   ++  A++ Y+ ++   P + P   + YSNI+A  +  G+ + +++   KAL
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 186 EIKPDH---------------------SKALLRRASANESLGNF 208
           ++ P                       SK +LR+A A E L NF
Sbjct: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 50/122 (40%), Gaps = 25/122 (20%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAI----ELDPNDPVFYSNISACYISTGDLNKVLEYT 181
           + + KG   F   +++ A+  Y+ ++    E  P   +  SN+   Y+  G+  K L+  
Sbjct: 292 EFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLA 351

Query: 182 TKALEIKPD---------------------HSKALLRRASANESLGNFTDAMFDLSVLSL 220
             ALE+ P+                      SK ++R A A E   N+T A  +  +L  
Sbjct: 352 PLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVA 411

Query: 221 NG 222
           NG
Sbjct: 412 NG 413

>Kwal_55.21197 s55 (726765..727109) [345 bp, 114 aa] {OFF} [contig
           295] FULL
          Length = 114

 Score = 31.6 bits (70), Expect = 2.1,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 32/73 (43%), Gaps = 6/73 (8%)

Query: 138 KNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDL---NKVLEYTTKALEIKPDHSKA 194
           + F EA+   QC I      P+F S     +    DL     VL+YTTK + ++P     
Sbjct: 19  RAFCEAV---QCVIYYATQKPLFQSARRLFFFQDLDLALRRSVLKYTTKPISVQPFQRFV 75

Query: 195 LLRRASANESLGN 207
           + R AS   S  N
Sbjct: 76  VYRSASLKSSAAN 88

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 46/109 (42%), Gaps = 5/109 (4%)

Query: 108 DISQLKGLTL-SQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDP----VFYS 162
           ++  LK L    +    A   KN+GN  +  K + +A + Y   I++  +D       +S
Sbjct: 61  ELEALKALAYEGEPHEVAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFS 120

Query: 163 NISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDA 211
           N +AC +   +  + +    +AL+    + K   R A A   L    DA
Sbjct: 121 NRAACELELKNYRRCVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W
           (REAL)
          Length = 741

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 163 NISACYISTGDLNKVLEYTTKALEIKPDHSKALLR 197
           NI ACY    DL   L  + K+L++ PD++K  +R
Sbjct: 83  NICACYEKLDDLKSCLSISQKSLKLDPDNAKCYIR 117

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 49/114 (42%), Gaps = 19/114 (16%)

Query: 410 TYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTES-EALFNET 468
           T+YH G+++ I  DY  A   FQ+A N    N   +  +  L Y+  ++ ++ +A     
Sbjct: 287 TWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAI 346

Query: 469 KLKFPTLPEVPAFFAEILTDKG--------DFSTAIKQYDIAKRLEEVQEKIHV 514
           +L          + +E+  D G          + A+  Y  A RL+   E +H+
Sbjct: 347 RLN--------PYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDP--ENVHI 390

>ZYRO0D00836g Chr4 complement(62421..66626) [4206 bp, 1401 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 41/77 (53%)

Query: 143 AIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASAN 202
           +I+++Q A+ ++ +D   +  +   Y + G +   ++   KA+E+  +H  A   +A + 
Sbjct: 686 SIEWFQSALRVNQSDVEAWVGLGQAYYACGRIEASIKVFEKAIELDSEHHYAKYLKAQSL 745

Query: 203 ESLGNFTDAMFDLSVLS 219
             +G F +A+  L+ L+
Sbjct: 746 SLMGQFDEAIDILNALT 762

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 82/209 (39%), Gaps = 22/209 (10%)

Query: 380 LALTLADKENSQEFFKYFQKAI--DLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNL 437
           L L  + + NS +  + F+  I   +    P      G+++F + +Y  +   F + ++L
Sbjct: 442 LILRSSSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGKLHFEIINYDMSLKYFNRLKDL 501

Query: 438 YPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIK 497
            P  +      + LL+      +S  L N      P  PE       +L+ + D   AIK
Sbjct: 502 QPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIK 561

Query: 498 QYDIAKRLEEVQEKIHVGIGPLIGKATILA--RQSSQDPTQLDEEKFNTAIALLTKACEL 555
            ++ A +L+           P    A  L     SS D +       ++A     KA   
Sbjct: 562 AFEKATQLD-----------PNFAYAYTLQGHEHSSNDSS-------DSAKTCYRKALAC 603

Query: 556 DPRSEQAKIGLAQLKLQMEKIDDAIELFQ 584
           DP+   A  GL    +++ + ++A+  F+
Sbjct: 604 DPQHYNAYYGLGTSAMKLGQYEEALLYFE 632

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 68/165 (41%), Gaps = 22/165 (13%)

Query: 397 FQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLAC--LLYK 454
           +++A+  D ++   YY  G  Y  L  Y  A   F+KA+N+ P N+   I + C  +  +
Sbjct: 539 YRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNV---ILICCCGVALE 595

Query: 455 QGKFTESEALFNETKLKFPTLPEVPAF-FAEILTDKGDFSTAIKQYDIAKRLEEVQEKIH 513
           +  + E    + E   +      +  F  A +L     +S A++ ++   +L   +  +H
Sbjct: 596 KLSYQEKALQYYEQACELQPSSSLAKFKKAHLLYSMARYSAALENFEELAKLAPDEATVH 655

Query: 514 VGIGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPR 558
             +G L     I+ R+               A+   T A  LDP+
Sbjct: 656 FLLGQLY---QIMGRKKD-------------AVKEFTVAMNLDPK 684

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLE-YTTKA 184
           G ++F+  N TEA KY+  A  LDPN    +   +  Y   G+  + L  Y+T A
Sbjct: 429 GTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAA 483

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 79/192 (41%), Gaps = 18/192 (9%)

Query: 342 LAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKE--NSQEF---FKY 396
           +A+C  G  H L  +   A     ++I L P    +   A TL   E  N+  F      
Sbjct: 493 IAWCSMGNLHSLNKDHDEAITAFGKAIQLDP----FFAYAYTLQGHEYSNNDAFDNAKSC 548

Query: 397 FQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQG 456
           F+KA+ ++  +    Y  G     L  +  A   F+KA+ L P N+   I   C      
Sbjct: 549 FRKALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKARALNPVNV---ILNCCCGVALE 605

Query: 457 KFTESEALFNETKLKFPTLPEVP-AFF--AEILTDKGDFSTAIKQYDIAKRLEEVQEKIH 513
           +  + E   N  +L     P    A F  +++L + G +S+A+  ++  + L   +  +H
Sbjct: 606 RLQQPERALNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNFERLESLTPDEAHVH 665

Query: 514 VGIGPL---IGK 522
             +G L   +GK
Sbjct: 666 FLLGNLYQIVGK 677

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 53/112 (47%), Gaps = 25/112 (22%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAIE-LDPNDP---VFYSNISACYISTGDLNKVLEYT 181
           + K KG++FF   ++  +++ Y+ ++  L  N P   +  SNI A  +  G+ +K +E +
Sbjct: 376 EFKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENS 435

Query: 182 TKALEIKPD---------------------HSKALLRRASANESLGNFTDAM 212
           + AL + P                        K ++RRA + E L +F++A+
Sbjct: 436 SMALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNAL 487

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 82/209 (39%), Gaps = 22/209 (10%)

Query: 380 LALTLADKENSQEFFKYFQKAI--DLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNL 437
           L L  + + NS +  + F+  I   +    P      G+++F + +Y  +   F + ++L
Sbjct: 435 LILRSSSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGKLHFEIINYDMSLKYFNRLKDL 494

Query: 438 YPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIK 497
            P  +      + LL+      +S  L N      P  PE       +L+ + D   AIK
Sbjct: 495 QPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCVGNLLSLQKDHDAAIK 554

Query: 498 QYDIAKRLEEVQEKIHVGIGPLIGKATILA--RQSSQDPTQLDEEKFNTAIALLTKACEL 555
            ++ A +L+           P    A  L     SS D +       ++A     KA   
Sbjct: 555 AFEKATQLD-----------PNFAYAYTLQGHEHSSNDSS-------DSAKTCYRKALAC 596

Query: 556 DPRSEQAKIGLAQLKLQMEKIDDAIELFQ 584
           DP+   A  GL    +++ + ++A+  F+
Sbjct: 597 DPQHYNAYYGLGTSSMKLGQYEEALLYFE 625

>Kpol_1028.101 s1028 complement(221597..222760) [1164 bp, 387 aa]
           {ON} complement(221597..222760) [1164 nt, 388 aa]
          Length = 387

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 112 LKGLTLSQKQTYAVQLKNKGNHFFTTKNFT-EAIKYYQCAIELDPNDPVFYSNISAC 167
           +K   LS+  ++ + L+ K N + T++N+    IK Y       P +P  Y+N   C
Sbjct: 24  MKKEALSRTVSHEITLETKKNKYMTSRNYNPNLIKLYTVTKSFTPTEPFMYTNNRMC 80

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 82/209 (39%), Gaps = 22/209 (10%)

Query: 380 LALTLADKENSQEFFKYFQKAI--DLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNL 437
           L L  + + NS +  + F+  I   +    P      G+++F + +Y  +   F + ++L
Sbjct: 447 LILRSSSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGKLHFEIINYDMSLKYFNRLKDL 506

Query: 438 YPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIK 497
            P  +      + LL+      +S  L N      P  PE       +L+ + D   AIK
Sbjct: 507 QPARVKDMEIYSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIK 566

Query: 498 QYDIAKRLEEVQEKIHVGIGPLIGKATILA--RQSSQDPTQLDEEKFNTAIALLTKACEL 555
            ++ A +L+           P    A  L     SS D +       ++A     KA   
Sbjct: 567 AFEKATQLD-----------PNFAYAYTLQGHEHSSNDSS-------DSAKTCYRKALAC 608

Query: 556 DPRSEQAKIGLAQLKLQMEKIDDAIELFQ 584
           DP+   A  GL    +++ + ++A+  F+
Sbjct: 609 DPQHYNAYYGLGTSSMKLGQYEEALLYFE 637

>KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 632

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 2/100 (2%)

Query: 113 KGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTG 172
           + L L +  T+A  L   G+ F   KN   AI+ Y+ A +++P D   +  +   Y    
Sbjct: 428 RALMLDKSYTHAWILM--GHEFIEMKNSHAAIECYRRASDVNPRDFQAWYGLGQAYEVLD 485

Query: 173 DLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAM 212
             +  L Y  KA  +KP   +     AS  E L     A+
Sbjct: 486 KHSFALYYFQKACALKPLDKRMWFASASCYEKLDKTVQAI 525

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 79/213 (37%), Gaps = 20/213 (9%)

Query: 373 TPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQ 432
           TP ++  +    +  ++  E  K FQKA  LD  +   Y  +G  Y     +  AK  ++
Sbjct: 413 TPQTWCCVGNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYR 472

Query: 433 K--AQNLYPENIYPYIQLACLLYKQGKFTESEALFNETKLKFPTLPEVPAFFAEILTDKG 490
           K  A N    N    + + CL  K G++ ES   F +     P    +      +    G
Sbjct: 473 KALATNSQHYNASYGLGMCCL--KLGQYEESLLHFQKAHSINPVNVILICCCGVVFEKLG 530

Query: 491 DFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNTAIALLT 550
               A+K Y++A  L+            L  K+ +L    S          +N+A+    
Sbjct: 531 HQQDALKYYELACELQPTSSL------ALFKKSQLLLSMGS----------YNSALVNFE 574

Query: 551 KACELDPRSEQAKIGLAQLKLQMEKIDDAIELF 583
           K   + P        L QL   + +  DAI+ F
Sbjct: 575 KLVIMAPDEATVHFLLGQLYHIVGRKKDAIKEF 607

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 39/81 (48%)

Query: 140 FTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRA 199
           + E++ ++Q A  ++P + +        +   G     L+Y   A E++P  S AL +++
Sbjct: 498 YEESLLHFQKAHSINPVNVILICCCGVVFEKLGHQQDALKYYELACELQPTSSLALFKKS 557

Query: 200 SANESLGNFTDAMFDLSVLSL 220
               S+G++  A+ +   L +
Sbjct: 558 QLLLSMGSYNSALVNFEKLVI 578

>TBLA0F00900 Chr6 (227895..230456) [2562 bp, 853 aa] {ON} Anc_3.153
           YDL040C
          Length = 853

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G +  +TK ++E+IK++Q +++    +   Y ++S      GD   VLE   +  E    
Sbjct: 99  GIYMRSTKQYSESIKWFQASLDNGSKNYQIYRDLSTLQSQVGDFKAVLESRKRYWENYMG 158

Query: 191 HSKALLRRASANESLGNFTDAMFDLS 216
           +       A A +  G +  A+  LS
Sbjct: 159 YRANWTSYAVAQDINGEYHQAVNTLS 184

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 45/107 (42%), Gaps = 8/107 (7%)

Query: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPND----PVFYSNISACYISTGDLNKVLE 179
           A   K +GN  +  K +  A   Y+  IE++ N+     + + N +AC +   +    + 
Sbjct: 74  AENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCIN 133

Query: 180 YTTKALEIKPDHSKALLRRASANESLGNFTDAM----FDLSVLSLNG 222
              KAL   P + K   R A A  ++  + ++     F L V S N 
Sbjct: 134 DCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNS 180

>TBLA0C01010 Chr3 (198773..201367) [2595 bp, 864 aa] {ON} Anc_2.665
           YKL022C
          Length = 864

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/70 (22%), Positives = 34/70 (48%), Gaps = 5/70 (7%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE---- 186
           G  + +    + A +Y+  + +++PNDP+  + +   Y    DL K  ++  +AL+    
Sbjct: 625 GMQYMSINTLSLAEEYFILSYDINPNDPLLLNEMGVLYFKKSDLQKSKKFLKRALDASNK 684

Query: 187 -IKPDHSKAL 195
            + P+   AL
Sbjct: 685 SLNPNSKTAL 694

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 4/72 (5%)

Query: 126 QLKNKGNHFFTTKNFTEAIKYYQCAIELDP-NDP---VFYSNISACYISTGDLNKVLEYT 181
           + K +G   F T ++  A++ YQ ++   P   P   +  SNI A    TG+  K +E +
Sbjct: 396 EFKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEIS 455

Query: 182 TKALEIKPDHSK 193
           T ALE  P   K
Sbjct: 456 TSALEQFPGDQK 467

>TPHA0M00370 Chr13 (72373..74889) [2517 bp, 838 aa] {ON} Anc_3.153
           YDL040C
          Length = 838

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 29/56 (51%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE 186
           G +  +TKN+T++I+++Q +++    +   Y ++S      GD   VL    K  E
Sbjct: 99  GIYMRSTKNYTDSIRWFQASLDNGSTNHQIYRDLSILQSQIGDFKAVLASRKKYWE 154

>Kpol_1032.15 s1032 (38837..41377) [2541 bp, 846 aa] {ON}
           (38837..41377) [2541 nt, 847 aa]
          Length = 846

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 38/86 (44%)

Query: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190
           G +  + K ++E+IK++Q A++   ++   Y ++S      GD   VL    K  E    
Sbjct: 98  GIYMRSNKRYSESIKWFQSALDNGSSNQQIYRDLSTLQSQVGDFKSVLISRRKYWESFMG 157

Query: 191 HSKALLRRASANESLGNFTDAMFDLS 216
           +       A A +  G F  A+  LS
Sbjct: 158 YRANWTSYAIAQDINGEFQQAVNTLS 183

>NCAS0D01390 Chr4 (251721..253616) [1896 bp, 631 aa] {ON} Anc_5.72
          Length = 631

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 42/93 (45%)

Query: 373 TPNSYIFLALTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQ 432
             +++  +     + +NS    + +++A+D++      +Y  GQ Y +L  ++ +   FQ
Sbjct: 435 CTSAWTLMGHEFVELKNSHAAIECYRRAVDINVRDFKAWYGLGQAYEVLDMHLYSLYYFQ 494

Query: 433 KAQNLYPENIYPYIQLACLLYKQGKFTESEALF 465
           KA  L P +   +  L     K G  TE+   F
Sbjct: 495 KACTLKPLDRRMWQALGTCYTKIGNKTEAIKCF 527

>ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR166C (CDC23)
          Length = 614

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 51/118 (43%), Gaps = 5/118 (4%)

Query: 323 AYHSLLASQVDGPLKENAALAFCYTGIFHFLKNNLLGAQALLQESINLHPT-PNSYIFLA 381
           AY S  A+ +D    E      C    +   K     A    + ++ L+ T  N++  + 
Sbjct: 370 AYLSQFAADLDAYRPETC----CIIANYFSAKQQHEKAIMYFRRALTLNKTCTNAWTLMG 425

Query: 382 LTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYP 439
               + +NS    + +++A+D++      +Y  GQ Y +L  ++ A    QKA +L P
Sbjct: 426 HEFVEMKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLDRHLYALYYLQKACSLKP 483

>Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}
           similar to Ashbya gossypii ABR206W
          Length = 626

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 51/118 (43%), Gaps = 5/118 (4%)

Query: 323 AYHSLLASQVDGPLKENAALAFCYTGIFHFLKNNLLGAQALLQESINLHPT-PNSYIFLA 381
           AY S  A+ VD    E      C    +   K     A    + ++ L+ +  N++  + 
Sbjct: 382 AYLSQFAADVDAYRPETC----CIIANYFSAKQQHEKAIMYFRRALTLNKSCTNAWTLMG 437

Query: 382 LTLADKENSQEFFKYFQKAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYP 439
               + +NS    + +++A+D++      +Y  GQ Y +L  ++ A    QKA +L P
Sbjct: 438 HEFVETKNSHAAIECYRRAVDINPCDFKAWYGLGQAYEVLDRHLYALYYLQKACSLKP 495

>Smik_11.262 Chr11 (438440..438988) [549 bp, 182 aa] {ON} YKR007W
           (REAL)
          Length = 182

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 49/119 (41%), Gaps = 4/119 (3%)

Query: 149 CAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNF 208
           C       D        A Y S G+ N   EY  + + +K    K L R     E + N 
Sbjct: 8   CRHHAREEDEALLREQQAGYGSQGNANS--EYDAEQMRLKEHEQKLLAREQELREIVANT 65

Query: 209 TDAMFDLSVLSLNG-DFDGASIEPMLERNLNKQAMKVLNENLSKGDGRGS-QLLPSNTS 265
            D + D+S+++ +G    G  ++  L++   ++      +  S GD   S + +PS+ S
Sbjct: 66  NDKLIDISMINNSGIVIQGTDLQEALDKKQQEEGEVSPEDGRSAGDDNTSGRSVPSSRS 124

>KLTH0F09020g Chr6 complement(775420..776130,776219..776260) [753
           bp, 250 aa] {ON} similar to uniprot|Q03973 Saccharomyces
           cerevisiae YDR174W HMO1 Chromatin associated high
           mobility group (HMG) family member involved in genome
           maintenance rDNA- binding component of the Pol I
           transcription system associates with a 5'-3' DNA
           helicase and Fpr1p a prolyl isomerase
          Length = 250

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 73/177 (41%), Gaps = 39/177 (22%)

Query: 291 AYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSL--LASQVDGPLKENA-------- 340
           A+  L++ALQKL SATN+  + + +L     D    +  +AS V  P ++ A        
Sbjct: 50  AFTTLTEALQKLTSATNQVQVVSSELTNPLEDDKEVIASIASPVKAPARKRAERDPNAPK 109

Query: 341 ---ALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYF 397
               + F Y+             QAL +E       P         L+  E +QE  K +
Sbjct: 110 KPLTVFFAYSAYVR---------QALREERQKAGLPP---------LSSTEITQEISKKW 151

Query: 398 QKAIDLDSE-YPPTY------YHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQ 447
           ++  D++ + +   Y      YH  ++ + L+D  N  A  Q A +  P  I  Y+Q
Sbjct: 152 KEMSDVEKDKWKQAYNVELQNYHLEKLKY-LEDKKNGVAPSQDAPSSAPVPIPDYLQ 207

>TBLA0F02820 Chr6 complement(678658..680823) [2166 bp, 721 aa] {ON}
           Anc_7.498 YJR106W
          Length = 721

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 293 ALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGPLKENAALAFC------- 345
           AL+S    K Y+  N  +L + +L  + T+A  S + SQ  GPL +   L  C       
Sbjct: 616 ALISILFVKKYNDGNWWFLRSIELVQARTEAVDSEIDSQASGPLMDKKFLVSCIFITLQI 675

Query: 346 -YTGIF 350
            Y G+F
Sbjct: 676 IYLGVF 681

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,363,123
Number of extensions: 2633851
Number of successful extensions: 9487
Number of sequences better than 10.0: 304
Number of HSP's gapped: 9387
Number of HSP's successfully gapped: 466
Length of query: 635
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 519
Effective length of database: 40,180,143
Effective search space: 20853494217
Effective search space used: 20853494217
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)