Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_8.1942.153ON129944972e-65
YHR116W (COX23)2.153ON151944983e-65
Skud_8.1772.153ON130944809e-63
Suva_15.3132.153ON132944661e-60
NDAI0B043302.153ON127933496e-43
KLTH0B05148g2.153ON111933461e-42
Ecym_82052.153ON114943452e-42
SAKL0E10934g2.153ON113933417e-42
CAGL0I02728g2.153ON111923372e-41
TDEL0B051502.153ON119943373e-41
Kwal_33.147762.153ON111933312e-40
ZYRO0G06534g2.153ON112943303e-40
KNAG0H035202.153ON109943303e-40
KLLA0F24024g2.153ON122923262e-39
NCAS0B070002.153ON108883112e-37
Kpol_505.202.153ON112933071e-36
ABR130W2.153ON111923061e-36
KAFR0F007302.153ON108982956e-35
TPHA0F018702.153ON180712773e-31
TBLA0B012402.153ON119881854e-18
TDEL0F051508.391ON15571680.55
ZYRO0F04642gsingletonON54923680.84
KLTH0H02552g6.284ON7738631.3
Kpol_1018.193singletonON54834661.4
Ecym_82875.205ON5827602.3
KAFR0D018505.205ON6327602.4
Suva_10.665.205ON7226612.7
TDEL0C055203.415ON17269632.8
TDEL0F024204.105ON96128642.8
TBLA0C061305.205ON6727603.2
Zrou_YGOB_Anc_5.2055.205ON5027583.8
TDEL0A069806.284ON6847593.9
AAL161W5.205ON6426584.6
TBLA0A039308.322ON26673607.5
Smik_12.545.205ON6926577.9
Kwal_56.243936.284ON10026588.8
YLL009C (COX17)5.205ON6926569.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_8.194
         (129 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W (...   196   2e-65
YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}  COX23Mitoch...   196   3e-65
Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W (...   189   9e-63
Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W...   184   1e-60
NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2....   139   6e-43
KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar...   137   1e-42
Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON} ...   137   2e-42
SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly ...   135   7e-42
CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {O...   134   2e-41
TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON...   134   3e-41
Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {O...   132   2e-40
ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {O...   131   3e-40
KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.15...   131   3e-40
KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} simil...   130   2e-39
NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2....   124   2e-37
Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON} (55992..56...   122   1e-36
ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic hom...   122   1e-36
KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON...   118   6e-35
TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.15...   111   3e-31
TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON...    76   4e-18
TDEL0F05150 Chr6 (965659..966126) [468 bp, 155 aa] {ON} Anc_8.39...    31   0.55 
ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} simila...    31   0.84 
KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa...    29   1.3  
Kpol_1018.193 s1018 (487656..487952,487955..487999,488002..48916...    30   1.4  
Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to ...    28   2.3  
KAFR0D01850 Chr4 complement(371230..371421) [192 bp, 63 aa] {ON}...    28   2.4  
Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}...    28   2.7  
TDEL0C05520 Chr3 (987444..987962) [519 bp, 172 aa] {ON} Anc_3.41...    29   2.8  
TDEL0F02420 Chr6 complement(449745..452630) [2886 bp, 961 aa] {O...    29   2.8  
TBLA0C06130 Chr3 complement(1484597..1484800) [204 bp, 67 aa] {O...    28   3.2  
Zrou_YGOB_Anc_5.205 Chr2 (819283..819435) [153 bp, 50 aa] {ON} A...    27   3.8  
TDEL0A06980 Chr1 complement(1223058..1223264) [207 bp, 68 aa] {O...    27   3.9  
AAL161W Chr1 (64596..64790) [195 bp, 64 aa] {ON} Syntenic homolo...    27   4.6  
TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...    28   7.5  
Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}...    27   7.9  
Kwal_56.24393 s56 complement(979862..980164) [303 bp, 100 aa] {O...    27   8.8  
YLL009C Chr12 complement(131205..131414) [210 bp, 69 aa] {ON}  C...    26   9.7  

>Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W
           (REAL)
          Length = 129

 Score =  196 bits (497), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 94/94 (100%), Positives = 94/94 (100%)

Query: 36  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 95
           VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER
Sbjct: 36  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 95

Query: 96  NDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           NDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE
Sbjct: 96  NDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129

>YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}
           COX23Mitochondrial intermembrane space protein that
           functions in mitochondrial copper homeostasis, essential
           for functional cytochrome oxidase expression; homologous
           to Cox17p; contains twin cysteine-x9-cysteine motifs
          Length = 151

 Score =  196 bits (498), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 93/94 (98%), Positives = 93/94 (98%)

Query: 36  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 95
           VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER
Sbjct: 58  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 117

Query: 96  NDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           NDYDRSKCQEYFDAYRECKKQWLTARR NRQQWE
Sbjct: 118 NDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151

>Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W
           (REAL)
          Length = 130

 Score =  189 bits (480), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 89/94 (94%), Positives = 93/94 (98%)

Query: 36  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 95
           +TDRTKVNYVPK++DPSSFQYYPDDPENP+NKYKFALKADSQYYDPCEESSKLSFQCLER
Sbjct: 37  ITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLSFQCLER 96

Query: 96  NDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           NDYDRSKCQEYFDAYRECKKQWLTARR NRQQWE
Sbjct: 97  NDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130

>Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W
           (REAL)
          Length = 132

 Score =  184 bits (466), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 87/94 (92%), Positives = 92/94 (97%)

Query: 36  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 95
           VTDR+KVNYVP+S+DPSSFQYYPDDPENPVNKYKFALK DSQYYDPCEESSKLSFQCLER
Sbjct: 39  VTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPCEESSKLSFQCLER 98

Query: 96  NDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           N YDR+KCQ+YFDAYRECKKQWLTARRNNRQQWE
Sbjct: 99  NSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132

>NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2.153
           YHR116W
          Length = 127

 Score =  139 bits (349), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 61/93 (65%), Positives = 76/93 (81%)

Query: 37  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 96
           T +  VN+ P   D S+F+YYPDDPE  +NKYKF +K  S+YYDPC+ESS++SF+CL+RN
Sbjct: 34  TTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRN 93

Query: 97  DYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           ++DR KC EYFDAYRECKKQWL ARRNNR QW+
Sbjct: 94  NFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126

>KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar to
           uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 111

 Score =  137 bits (346), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 63/93 (67%), Positives = 77/93 (82%)

Query: 37  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 96
            D+TKV+Y PK+ +  SF++YPD+PE+  NKY+FA K  SQ+YDPC+ESSK+S +CLE N
Sbjct: 19  VDKTKVDYAPKNTESGSFKFYPDNPESSFNKYRFAAKDASQFYDPCQESSKMSMKCLELN 78

Query: 97  DYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           +YDRS CQEYFDAYRECKKQWL ARR NR QWE
Sbjct: 79  NYDRSMCQEYFDAYRECKKQWLQARRRNRSQWE 111

>Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ABR130W
          Length = 114

 Score =  137 bits (345), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 62/94 (65%), Positives = 77/94 (81%)

Query: 36  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 95
           VTD+TKVN+ P S+D S+FQ+YPDDPE  +N++KF  K  S YYDPCEESSK+SF+CLE 
Sbjct: 21  VTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSFKCLEL 80

Query: 96  NDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           N+YDRS C +YFDAYRECKKQWL ARR +  +W+
Sbjct: 81  NNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114

>SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly
           similar to gnl|GLV|CAGL0I02728g Candida glabrata
           CAGL0I02728g and similar to YHR116W uniprot|P38824
           Saccharomyces cerevisiae YHR116W COX23 Mitochondrial
           intermembrane space protein that functions in
           mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 113

 Score =  135 bits (341), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 60/93 (64%), Positives = 80/93 (86%)

Query: 37  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 96
           TD+ KVN+ P+++D SSF++YPD+PE+ +NK++FA K  S+Y+DPC+ESSK+SF+CLE N
Sbjct: 21  TDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSFKCLEMN 80

Query: 97  DYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           +YDR  C+EYFDAYRECKKQWL +RR NR QWE
Sbjct: 81  NYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113

>CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116w
          Length = 111

 Score =  134 bits (337), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (83%)

Query: 37  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 96
           TD+ KV+Y PK  D + ++YYPD+PE+ +NKY+FA+K  SQYYDPC+ES+K+SF+CLE N
Sbjct: 19  TDKDKVDYAPKGVDTTEYRYYPDNPESTLNKYRFAMKDHSQYYDPCQESAKMSFKCLELN 78

Query: 97  DYDRSKCQEYFDAYRECKKQWLTARRNNRQQW 128
           DYDR +C+EYFDAYRECKKQWL ARR +R  W
Sbjct: 79  DYDRDQCKEYFDAYRECKKQWLEARRKDRTNW 110

>TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score =  134 bits (337), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 76/94 (80%)

Query: 36  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 95
           V D +KV+Y PK  DPS FQYYP++PE+ VN+  FA+K  SQYYDPC+ES+++S  CL+R
Sbjct: 26  VKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMSLNCLDR 85

Query: 96  NDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           NDY++  C+EYFDAYRECKKQWL +RR +R QWE
Sbjct: 86  NDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119

>Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {ON}
           YHR116W - Hypothetical ORF [contig 101] FULL
          Length = 111

 Score =  132 bits (331), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 75/93 (80%)

Query: 37  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 96
            D++K++Y P+     S+++YPD+PE+  NK++FA K  SQ+YDPC+ESSK+S +CLE N
Sbjct: 19  VDKSKIDYAPQDAKAGSYKFYPDNPESSFNKFRFAAKDVSQFYDPCQESSKMSMKCLELN 78

Query: 97  DYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           DYDRS CQEYFDAYRECKKQWL ARR NR QWE
Sbjct: 79  DYDRSMCQEYFDAYRECKKQWLQARRKNRSQWE 111

>ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116W COX23 Mitochondrial intermembrane space protein
           that functions in mitochondrial
          Length = 112

 Score =  131 bits (330), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 75/94 (79%)

Query: 36  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 95
           V +  KV+Y P+ D P  FQYYPD PE+ +++Y+FA+K  SQY+DPC+ESS++SF CL+R
Sbjct: 19  VVEPKKVDYAPQGDSPDKFQYYPDKPESSLSRYRFAVKDASQYFDPCQESSRMSFNCLDR 78

Query: 96  NDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           N+YDR  C+EYFDAYRECKKQWL ARR NR  WE
Sbjct: 79  NNYDREMCKEYFDAYRECKKQWLRARRENRSLWE 112

>KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.153
           YHR116W
          Length = 109

 Score =  131 bits (330), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 74/94 (78%)

Query: 36  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 95
           V+ +  V++ P   +P  F+Y+PD P++  +KYKF  K DS++YDPC+ESSK+SF CLE+
Sbjct: 16  VSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSFTCLEQ 75

Query: 96  NDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           NDYDRSKC+ YFDAYRECKKQWL ARR N+ QWE
Sbjct: 76  NDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109

>KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} similar
           to uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 122

 Score =  130 bits (326), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 56/92 (60%), Positives = 77/92 (83%)

Query: 38  DRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERND 97
           ++TKVN+ P+  D +++++YPDDPE+ +N+Y+FA+K  S+YYDPC+ESSK+SF+CLE N+
Sbjct: 31  NKTKVNFTPEKTDVNTYKFYPDDPESTLNRYRFAVKGASEYYDPCQESSKMSFKCLELNN 90

Query: 98  YDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           YDR  C +YFDAYRECKKQWL ARR  R+ WE
Sbjct: 91  YDRDLCHDYFDAYRECKKQWLKARREKREFWE 122

>NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2.153
           YHR116W
          Length = 108

 Score =  124 bits (311), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 71/88 (80%)

Query: 42  VNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRS 101
           VN+ P   +P S++Y+PDDP   +NKYKF +K DS+YYDPC+E S++S +CLERN +D+S
Sbjct: 20  VNFTPDEKNPGSYKYFPDDPVQGLNKYKFIMKGDSEYYDPCQECSEMSRKCLERNPFDKS 79

Query: 102 KCQEYFDAYRECKKQWLTARRNNRQQWE 129
           +CQEYFDAYR+CKK W+  RR NR+QWE
Sbjct: 80  QCQEYFDAYRDCKKMWMKTRRENRKQWE 107

>Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON}
           (55992..56330) [339 nt, 113 aa]
          Length = 112

 Score =  122 bits (307), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 75/93 (80%), Gaps = 1/93 (1%)

Query: 37  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 96
           TD++KV++  K DD    ++YPD+PE+ + KY+F  K  SQYYDPC+ES+++SF CL+RN
Sbjct: 21  TDKSKVDFANK-DDKKDLKFYPDNPESTLAKYRFITKETSQYYDPCQESAQMSFNCLDRN 79

Query: 97  DYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           +YD+SKC+ YFDAYRECKKQWL ARR +R QWE
Sbjct: 80  NYDKSKCRAYFDAYRECKKQWLRARRQDRSQWE 112

>ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR116W
          Length = 111

 Score =  122 bits (306), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 57/92 (61%), Positives = 72/92 (78%), Gaps = 1/92 (1%)

Query: 37  TDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERN 96
           TDR  VN+ P S D SSFQ+YPD+ E+P+ +Y+ A K  SQY DPC+ES+ +S +CLERN
Sbjct: 20  TDRAAVNFTP-STDASSFQFYPDNLESPLARYRXAAKGPSQYXDPCQESANMSMKCLERN 78

Query: 97  DYDRSKCQEYFDAYRECKKQWLTARRNNRQQW 128
           +YDR  C+EYFDAYRECKKQWL+ARR +  QW
Sbjct: 79  NYDRDLCREYFDAYRECKKQWLSARRKDNSQW 110

>KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON}
           Anc_2.153 YHR116W
          Length = 108

 Score =  118 bits (295), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 78/98 (79%), Gaps = 6/98 (6%)

Query: 36  VTDRTKVNYVPKSDDPSS----FQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQ 91
           VTD+TKVN+V   +DP +    F+YYPDDPE+  ++ +F  K  ++YYDPC+ES++LSF+
Sbjct: 13  VTDKTKVNFV--QEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLSFK 70

Query: 92  CLERNDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129
           CLE N+YDRS C++YFDAYRECKKQWL AR+ +R +WE
Sbjct: 71  CLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108

>TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.153
           YHR116W
          Length = 180

 Score =  111 bits (277), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (84%)

Query: 54  FQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERNDYDRSKCQEYFDAYREC 113
           F++YPD+PE+   KY+F  K  SQYYDPC+ES+K+SF+CL+ NDYDR KC+ YFDAYREC
Sbjct: 103 FKFYPDNPESSFAKYRFMSKDSSQYYDPCDESAKMSFKCLDMNDYDRDKCRAYFDAYREC 162

Query: 114 KKQWLTARRNN 124
           KKQWL ARRNN
Sbjct: 163 KKQWLRARRNN 173

>TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score = 75.9 bits (185), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 59/88 (67%), Gaps = 3/88 (3%)

Query: 38  DRTKVNYVPKSDD--PSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCL-E 94
           D T V++V    D   ++FQY+PD P + + ++ FA K  S++YDPC ES+++S +C+ +
Sbjct: 28  DPTNVSFVHHDPDNHVTTFQYFPDKPTSTMTRFNFADKESSKFYDPCHESAQMSVRCMTD 87

Query: 95  RNDYDRSKCQEYFDAYRECKKQWLTARR 122
             D  ++ C E+F AYR+CKK W+ A++
Sbjct: 88  HPDDHKTVCAEFFAAYRDCKKAWIDAKK 115

>TDEL0F05150 Chr6 (965659..966126) [468 bp, 155 aa] {ON} Anc_8.391
           YLR245C
          Length = 155

 Score = 30.8 bits (68), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 29/71 (40%), Gaps = 11/71 (15%)

Query: 69  KFALKADSQYYDP--------CEESSKLSFQC---LERNDYDRSKCQEYFDAYRECKKQW 117
           K AL+A    Y P        C  +S L+F C   +E   Y  + C E     +    + 
Sbjct: 22  KLALEARELSYSPYSQFRVGCCLLTSSLTFVCGANVENASYGGAICAERTTIVKAVTSEN 81

Query: 118 LTARRNNRQQW 128
            T R  N+QQW
Sbjct: 82  STERDENKQQW 92

>ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} similar
          to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
          Plasma membrane multidrug transporter member of the
          major facilitator superfamily involved in efflux of
          fluconazole diazaborine benomyl methotrexate and other
          drugs
          Length = 549

 Score = 30.8 bits (68), Expect = 0.84,   Method: Composition-based stats.
 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%)

Query: 45 VPKSDDPSSFQYY-PDDPENPVN 66
          VP+  DP   +Y  PDDPE PVN
Sbjct: 76 VPQQKDPFLVEYTGPDDPERPVN 98

>KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa]
           {ON} similar to uniprot|Q3E7A9 Saccharomyces cerevisiae
           YMR194C-B
          Length = 77

 Score = 28.9 bits (63), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 19/38 (50%)

Query: 80  DPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQW 117
           DPC+  +     CL +  +D SKC    D+  EC  ++
Sbjct: 3   DPCKPQACAIQGCLTKTGFDESKCSHLIDSLYECCSKF 40

>Kpol_1018.193 s1018
           (487656..487952,487955..487999,488002..489165,
           489169..489309) [1647 bp, 548 aa] {ON}
           (487656..487952,487955..487999,488002..489165,
           489169..489309) [1647 nt, 549 aa]
          Length = 548

 Score = 30.0 bits (66), Expect = 1.4,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 37  TDRTKVNYVPKSDDPSSFQYY-PDDPENPVNKYK 69
           +D+  +    + DDP   Q+  P+DP+NP+N YK
Sbjct: 69  SDKDIIEKSSEIDDPFLVQWNGPNDPDNPLNIYK 102

>Ecym_8287 Chr8 (585041..585217) [177 bp, 58 aa] {ON} similar to
           Ashbya gossypii AAL161W
          Length = 58

 Score = 27.7 bits (60), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 91  QCLERNDYDRSKCQEYFDAYRECKKQW 117
           +CL  N  + +KC+E  D YR C K +
Sbjct: 28  ECLLFNGLESTKCKELVDKYRSCMKGY 54

>KAFR0D01850 Chr4 complement(371230..371421) [192 bp, 63 aa] {ON}
           Anc_5.205 YLL009C
          Length = 63

 Score = 27.7 bits (60), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 91  QCLERNDYDRSKCQEYFDAYRECKKQW 117
           QCL     D  KC+EY + YR C K +
Sbjct: 33  QCLLFKGADDGKCKEYIEKYRMCMKSF 59

>Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}
           YLL009C (REAL)
          Length = 72

 Score = 28.1 bits (61), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 92  CLERNDYDRSKCQEYFDAYRECKKQW 117
           C+  N  D  KC+E+ D Y+EC K +
Sbjct: 39  CILFNGQDSDKCKEFIDKYKECMKGY 64

>TDEL0C05520 Chr3 (987444..987962) [519 bp, 172 aa] {ON} Anc_3.415
           YPR101W
          Length = 172

 Score = 28.9 bits (63), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 7/69 (10%)

Query: 40  TKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLERNDYD 99
           T+++Y+P  DD S+ + Y D+ EN + K    L+ +S  +    E++KL  Q L  N  D
Sbjct: 3   TRMDYLPFIDDDSNNERYRDEVENMIEK---ELRPESGLH---PEAAKLKIQ-LRENPLD 55

Query: 100 RSKCQEYFD 108
               +EY D
Sbjct: 56  NISLKEYRD 64

>TDEL0F02420 Chr6 complement(449745..452630) [2886 bp, 961 aa] {ON}
           Anc_4.105 YGL016W
          Length = 961

 Score = 29.3 bits (64), Expect = 2.8,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 42  VNYVPKSDDPSSFQYYPDDPENPVNKYK 69
           ++ +PK+D PSS  +Y    EN VN+YK
Sbjct: 739 LDQIPKADLPSSLPFYSYLLENLVNQYK 766

>TBLA0C06130 Chr3 complement(1484597..1484800) [204 bp, 67 aa] {ON}
           Anc_5.205 YLL009C
          Length = 67

 Score = 27.7 bits (60), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 91  QCLERNDYDRSKCQEYFDAYRECKKQW 117
           QC+  N  + +KC E+ + Y+EC K +
Sbjct: 37  QCILFNGQESTKCTEFINKYKECMKGY 63

>Zrou_YGOB_Anc_5.205 Chr2 (819283..819435) [153 bp, 50 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 50

 Score = 26.9 bits (58), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 91  QCLERNDYDRSKCQEYFDAYRECKKQW 117
           QC+  N  D  KCQE+ + Y++C + +
Sbjct: 20  QCILFNGQDSGKCQEFVNKYKKCMQGY 46

>TDEL0A06980 Chr1 complement(1223058..1223264) [207 bp, 68 aa] {ON}
           Anc_6.284 YMR194C-B
          Length = 68

 Score = 27.3 bits (59), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 80  DPCEESSKLSFQCLERNDYDRSKCQEYFD-AYRECKKQWLTARRNNR 125
           DPC+  +     CL  +DY  SKCQ+  D  YR C K +    + N+
Sbjct: 3   DPCKPEACAIQNCLISSDYKESKCQDLVDQLYRCCDKFYKEDGKENK 49

>AAL161W Chr1 (64596..64790) [195 bp, 64 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL009C (COX17)
          Length = 64

 Score = 26.9 bits (58), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 92  CLERNDYDRSKCQEYFDAYRECKKQW 117
           CL  N  D  KCQE    Y++C K +
Sbjct: 35  CLLFNGVDAVKCQELVQKYKDCMKGY 60

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score = 27.7 bits (60), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 6/73 (8%)

Query: 59  DDPENPVNKYKFALKADSQYYDPCEESSKLSFQCL---ERNDYDRSKCQEYFDAYRECKK 115
           +D +N +N++   LK + +YY    +S    F  L    +   D    QEY+D +  C+ 
Sbjct: 137 EDIKNLLNEFDNKLKTNGEYYTFIYDSC---FNLLLEEGKKTIDSETAQEYWDLFFACQN 193

Query: 116 QWLTARRNNRQQW 128
             +  + +  QQW
Sbjct: 194 YPIKVQSDQYQQW 206

>Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}
           YLL009C (REAL)
          Length = 69

 Score = 26.6 bits (57), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 92  CLERNDYDRSKCQEYFDAYRECKKQW 117
           C+  N  D  KC+E+ + Y+EC K +
Sbjct: 36  CILFNGQDSEKCKEFIEKYKECMKGY 61

>Kwal_56.24393 s56 complement(979862..980164) [303 bp, 100 aa] {ON}
           [contig 163] FULL
          Length = 100

 Score = 26.9 bits (58), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 92  CLERNDYDRSKCQEYFDAYRECKKQW 117
           CL +  YD SKC +  D   EC  ++
Sbjct: 38  CLTKTGYDESKCSQVIDQLYECCTKF 63

>YLL009C Chr12 complement(131205..131414) [210 bp, 69 aa] {ON}
           COX17Copper metallochaperone that transfers copper to
           Sco1p and Cox11p for eventual delivery to cytochrome c
           oxidase; contains twin cysteine-x9-cysteine motifs
          Length = 69

 Score = 26.2 bits (56), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 92  CLERNDYDRSKCQEYFDAYRECKKQW 117
           C+  N  D  KC+E+ + Y+EC K +
Sbjct: 36  CILFNGQDSEKCKEFIEKYKECMKGY 61

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,723,523
Number of extensions: 524974
Number of successful extensions: 1529
Number of sequences better than 10.0: 52
Number of HSP's gapped: 1522
Number of HSP's successfully gapped: 52
Length of query: 129
Length of database: 53,481,399
Length adjustment: 96
Effective length of query: 33
Effective length of database: 42,473,463
Effective search space: 1401624279
Effective search space used: 1401624279
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)