Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_8.1495.353ON58583027e-38
YHR072W-A (NOP10)5.353ON58582992e-37
Skud_8.1325.353ON58582974e-37
Suva_15.2635.353ON58582966e-37
Kwal_34.159765.353ON59582853e-35
KLTH0H14894g5.353ON59582811e-34
SAKL0G08800g5.353ON59582774e-34
TPHA0D020805.353ON59582766e-34
Kpol_1051.65.353ON58582767e-34
NCAS0H016305.353ON58582767e-34
KAFR0C018405.353ON58582759e-34
ZYRO0D10208g5.353ON64572742e-33
TDEL0E027405.353ON58582705e-33
TBLA0H019605.353ON58582698e-33
Ecym_81795.353ON58582672e-32
AGR354W5.353ON69562621e-31
CAGL0J10802g5.353ON57562542e-30
KNAG0C054905.353ON56562532e-30
KLLA0C16753g5.353ON57572523e-30
Suva_16.4453.443ON249629630.53
Smik_16.3603.443ON249029630.58
SAKL0E04972g2.390ON61134582.2
Suva_15.1551.374ON45253582.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_8.149
         (58 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A ...   120   7e-38
YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}  NOP10Const...   119   2e-37
Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A ...   119   4e-37
Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-...   118   6e-37
Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON...   114   3e-35
KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly...   112   1e-34
SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON...   111   4e-34
TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353...   110   6e-34
Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON} (11927..12...   110   7e-34
NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}...   110   7e-34
KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}...   110   9e-34
ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly s...   110   2e-33
TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}...   108   5e-33
TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}...   108   8e-33
Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON} s...   107   2e-32
AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic ho...   105   1e-31
CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa] ...   102   2e-30
KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa] {O...   102   2e-30
KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly...   101   3e-30
Suva_16.445 Chr16 (767762..775252) [7491 bp, 2496 aa] {ON} YPR11...    29   0.53 
Smik_16.360 Chr16 (638042..645514) [7473 bp, 2490 aa] {ON} YPR11...    29   0.58 
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...    27   2.2  
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    27   2.8  

>Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  120 bits (302), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}
          NOP10Constituent of small nucleolar ribonucleoprotein
          particles containing H/ACA-type snoRNAs, which are
          required for pseudouridylation and processing of
          pre-18S rRNA
          Length = 58

 Score =  119 bits (299), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTLKKVTE+GEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  119 bits (297), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 57/58 (98%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTL KVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLDKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  118 bits (296), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 57/58 (98%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTLKK TETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON}
          YHR072W-A (NOP10) - Component of H/ACA-box snoRNPs
          [contig 272] FULL
          Length = 59

 Score =  114 bits (285), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 56/58 (96%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKR+ ++PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTESGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58

>KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA
          Length = 59

 Score =  112 bits (281), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ ++PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58

>SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON}
          highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072W-A NOP10 Constituent of small
          nucleolar ribonucleoprotein particles containing
          H/ACA-type snoRNAs, which are required for
          pseudouridylation and processing of pre-18S rRNA
          Length = 59

 Score =  111 bits (277), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKRIYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKRF ++PG+
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTEEGEITKSAHPARFSPDDKYSRQRVTLKKRFNMLPGK 58

>TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353
          YHR072W-A
          Length = 59

 Score =  110 bits (276), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLM+TLGPDGKRIYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKRF L+P Q
Sbjct: 1  MHLMFTLGPDGKRIYTLKKETEQGEITKSAHPARFSPDDKYSRQRVTLKKRFSLLPNQ 58

>Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON}
          (11927..12103) [177 nt, 59 aa]
          Length = 58

 Score =  110 bits (276), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKR+YTLKK TE GEITKSAHPARFSPDDK+SRQRVTLKKRFGL+P Q
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKHSRQRVTLKKRFGLLPTQ 58

>NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  110 bits (276), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 55/58 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLG DGKRIYTLKKVTE GEITKSAHPARFSPDDKYSRQRVTLKKR+GL+P Q
Sbjct: 1  MHLMYTLGQDGKRIYTLKKVTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPTQ 58

>KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  110 bits (275), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTL  DGKR+YTLKKVTE GEITKSAHPARFSPDDKYSRQRVTLKKR+GL+PGQ
Sbjct: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58

>ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10
          Length = 64

 Score =  110 bits (274), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPG 57
          MHLMYTLGPDGKR YTL+KVTE GEITKSAHPARFSPDDKYSRQRVTLK+R+GL+PG
Sbjct: 1  MHLMYTLGPDGKRAYTLQKVTEEGEITKSAHPARFSPDDKYSRQRVTLKRRYGLLPG 57

>TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  108 bits (270), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTLGPDGKR+YTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+P +
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58

>TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  108 bits (269), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLMYTL  DGKR+YTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+PGQ
Sbjct: 1  MHLMYTLSQDGKRVYTLKKETESGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPGQ 58

>Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON}
          similar to Ashbya gossypii AGR354W
          Length = 58

 Score =  107 bits (267), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58
          MHLM+TLGPDGKRIYTLKK TE GEITK AHPARFSPDDKYSRQRVTLKKRF ++P Q
Sbjct: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58

>AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YHR072W-A (NOP10)
          Length = 69

 Score =  105 bits (262), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 48/56 (85%), Positives = 54/56 (96%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVP 56
          MHLMYTLGPDGKR+YTL+KVT +GEITKSAHPARFSPDDKYSRQRVTLK+RF ++P
Sbjct: 13 MHLMYTLGPDGKRVYTLEKVTPSGEITKSAHPARFSPDDKYSRQRVTLKRRFDMLP 68

>CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa]
          {ON} highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072wa NOP10
          Length = 57

 Score =  102 bits (254), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 47/56 (83%), Positives = 52/56 (92%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVP 56
          MHLMYTL  +GKR+YTLKK+TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ L+P
Sbjct: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56

>KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa]
          {ON} Anc_5.353 YHR072W-A
          Length = 56

 Score =  102 bits (253), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 48/56 (85%), Positives = 51/56 (91%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVP 56
          MHLMYTL  +GKRIYTLKK T  GEITKSAHPARFSPDDKYSRQRVTLKKRFG++P
Sbjct: 1  MHLMYTLDNEGKRIYTLKKATADGEITKSAHPARFSPDDKYSRQRVTLKKRFGMLP 56

>KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA,
          Length = 57

 Score =  101 bits (252), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (87%)

Query: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPG 57
          MHLMYTL   GKRIYTLKK+TE  EITKSAHPARFSPDDKYSRQRVTLKKR+ L+P 
Sbjct: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57

>Suva_16.445 Chr16 (767762..775252) [7491 bp, 2496 aa] {ON} YPR117W
            (REAL)
          Length = 2496

 Score = 28.9 bits (63), Expect = 0.53,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 10   DGKRIYTLKKVTETGEITKSAHPARFSPD 38
            DG  I+TL  + E G+I+K+    RF PD
Sbjct: 1291 DGNVIWTLGLLFEQGDISKAGDEERFLPD 1319

>Smik_16.360 Chr16 (638042..645514) [7473 bp, 2490 aa] {ON} YPR117W
            (REAL)
          Length = 2490

 Score = 28.9 bits (63), Expect = 0.58,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 10   DGKRIYTLKKVTETGEITKSAHPARFSPD 38
            DGK I+TL  + E G+I K+    RF P+
Sbjct: 1291 DGKVIWTLGLIFEQGDICKAGDEERFLPN 1319

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score = 26.9 bits (58), Expect = 2.2,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 15  YTLKKVTETGEITKSAHPARFSPDDKYSRQRVTL 48
           Y  +KVT  G+  K  H  +F+ DDK     V L
Sbjct: 518 YDARKVTTVGDFLKLVHDPQFAIDDKLKMIEVVL 551

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score = 26.9 bits (58), Expect = 2.8,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 9/53 (16%)

Query: 4   MYTLGPDGKRIYTLKKVTETGE----ITKSAHPARFSPDDK---YSRQRVTLK 49
           MY LG DG     +++ + TG     IT+S H  RF P  K    S++++ LK
Sbjct: 352 MYLLGDDGDN--DIEENSPTGSCLDGITRSLHDLRFQPQKKVVELSKEQMKLK 402

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,068,818
Number of extensions: 175459
Number of successful extensions: 468
Number of sequences better than 10.0: 23
Number of HSP's gapped: 468
Number of HSP's successfully gapped: 23
Length of query: 58
Length of database: 53,481,399
Length adjustment: 31
Effective length of query: 27
Effective length of database: 49,926,753
Effective search space: 1348022331
Effective search space used: 1348022331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)