Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_8.1485.351ON73173138460.0
YHR072W (ERG7)5.351ON73173136260.0
Suva_15.2625.351ON73173135760.0
Skud_8.1315.351ON73173135700.0
Kpol_339.125.351ON73373331920.0
TPHA0E011205.351ON73373031000.0
KNAG0B045805.351ON72972530590.0
CAGL0J10824g5.351ON73372330330.0
KAFR0D046705.351ON73173130220.0
TDEL0E027605.351ON73173130170.0
NCAS0H016405.351ON72872829790.0
TBLA0A031205.351ON74372829730.0
NDAI0C019705.351ON73173029650.0
SAKL0G08844g5.351ON74673129450.0
ZYRO0D10164g5.351ON73273229350.0
KLLA0B10175g5.351ON73173128190.0
KLTH0H14850g5.351ON72672527800.0
Kwal_34.159795.351ON72872527770.0
Ecym_81825.351ON73273225890.0
AGR351W5.351ON72972825830.0
NCAS0A116003.451ON41588716.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_8.148
         (731 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W ...  1486   0.0  
YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}  ERG7Lanost...  1401   0.0  
Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072...  1382   0.0  
Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W ...  1379   0.0  
Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON} (18976..2...  1234   0.0  
TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {O...  1198   0.0  
KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {O...  1182   0.0  
CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa...  1172   0.0  
KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.3...  1168   0.0  
TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {O...  1166   0.0  
NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {O...  1152   0.0  
TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.3...  1149   0.0  
NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {O...  1146   0.0  
SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {...  1139   0.0  
ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly...  1135   0.0  
KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly...  1090   0.0  
KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} high...  1075   0.0  
Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {...  1074   0.0  
Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}...  1001   0.0  
AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic ...   999   0.0  
NCAS0A11600 Chr1 (2302437..2303684) [1248 bp, 415 aa] {ON} Anc_3...    32   6.6  

>Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1486 bits (3846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/731 (97%), Positives = 713/731 (97%)

Query: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60
           MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP
Sbjct: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60

Query: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120
           QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI
Sbjct: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180
           PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180

Query: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240
           TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI
Sbjct: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240

Query: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300
           PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN
Sbjct: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360
           FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA
Sbjct: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420
           FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF
Sbjct: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420

Query: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480
           LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM
Sbjct: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480

Query: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540
           ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC
Sbjct: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALE 600
           TDSSVLGLTYFHKYFDY                  SQLPNGSWYGSWGICFTYAGMFALE
Sbjct: 541 TDSSVLGLTYFHKYFDYKKEEIRARIRIAIEFIKKSQLPNGSWYGSWGICFTYAGMFALE 600

Query: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660
           ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI
Sbjct: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660

Query: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYSKAYEQHAL 731
           MYSKAYEQHAL
Sbjct: 721 MYSKAYEQHAL 731

>YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}
           ERG7Lanosterol synthase, an essential enzyme that
           catalyzes the cyclization of squalene 2,3-epoxide, a
           step in ergosterol biosynthesis
          Length = 731

 Score = 1401 bits (3626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/731 (90%), Positives = 692/731 (94%)

Query: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60
           MTEFYS+TIGLPKTDPRLWRLRTDE+GRESWEYLT +QAAN+PPSTFTQWLLQDP+FP P
Sbjct: 1   MTEFYSDTIGLPKTDPRLWRLRTDELGRESWEYLTPQQAANDPPSTFTQWLLQDPKFPQP 60

Query: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120
            PERNKHSP+FSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGI+I
Sbjct: 61  HPERNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180
           PEHERIE+IRYIVNTAHPVDGGWGLHSVDKSTVFGT LNYVILRLLGLPKDHPVC K+R+
Sbjct: 121 PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCAKARS 180

Query: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240
           TLLRLGGA+GSPHWGKIWLSALNLY+WEGVNPAPPETWLLPYSLPMHPGRWWVHTR VYI
Sbjct: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240

Query: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300
           PVSYLSLVKF+CPMTPLLEELR EIYTKPFDKI FSK+RNTVCGVDLYYPHS TLNIAN+
Sbjct: 241 PVSYLSLVKFSCPMTPLLEELRNEIYTKPFDKINFSKNRNTVCGVDLYYPHSTTLNIANS 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360
            VVFYEKYLRNRFIYSLSK+KVYDL++ E+QNTDSLCIAPVNQAFCALVTLIEEGVDS+A
Sbjct: 301 LVVFYEKYLRNRFIYSLSKKKVYDLIKTELQNTDSLCIAPVNQAFCALVTLIEEGVDSEA 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420
           F++ QYRFKDALFHGPQGMTIMGTNGVQ+WDCAFAIQY F+AGLAER EFYNTIVSAYKF
Sbjct: 361 FQRLQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAERPEFYNTIVSAYKF 420

Query: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480
           LC AQFDTECVPGS+RDKRKGAWGFSTKTQGY V+DCTAEAIKAIIMVKNSPVF+EVH+M
Sbjct: 421 LCHAQFDTECVPGSYRDKRKGAWGFSTKTQGYTVADCTAEAIKAIIMVKNSPVFSEVHHM 480

Query: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540
           IS+ERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC
Sbjct: 481 ISSERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALE 600
           TDSSVLGLTYFHKYFDY                  SQLP+GSWYGSWGICFTYAGMFALE
Sbjct: 541 TDSSVLGLTYFHKYFDYRKEEIRTRIRIAIEFIKKSQLPDGSWYGSWGICFTYAGMFALE 600

Query: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660
           ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAW LI
Sbjct: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWALI 660

Query: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALLFAEYP K+VIDRGI+LLKNRQEESGEWKFE VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLFAEYPNKEVIDRGIDLLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYSKAYEQHAL 731
           MYS+AYE H L
Sbjct: 721 MYSRAYETHTL 731

>Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1382 bits (3576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/731 (88%), Positives = 688/731 (94%)

Query: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60
           MTEFYSE IGLPKTDPR WRLRTD++GRESWEYLT EQAAN+PPSTFTQWLLQDP+FP P
Sbjct: 1   MTEFYSEKIGLPKTDPRRWRLRTDKLGRESWEYLTPEQAANDPPSTFTQWLLQDPDFPQP 60

Query: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120
            P +NKHSP+FSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAV+YIAGIQI
Sbjct: 61  HPAKNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVSYIAGIQI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180
           PEHERIE+IRYIVNTAHPVDGGWGLHSVDKSTVFGT LNYVILRLLGL KDHPVCVK+R+
Sbjct: 121 PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLSKDHPVCVKARD 180

Query: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240
           TLLRLGGA+G+PHWGK+WLSALNLY+WEGVNPAPPETWLLPYSLP+HPGRWWVHTR VYI
Sbjct: 181 TLLRLGGAIGAPHWGKVWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYI 240

Query: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300
           PVSYLSLVKF CPMTPLLEELR EIYTKPFDKI FS HRNTVCGVDLYYPHSK LNIANN
Sbjct: 241 PVSYLSLVKFVCPMTPLLEELRGEIYTKPFDKINFSNHRNTVCGVDLYYPHSKILNIANN 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360
           FVVFYEKYLRNRFIYSLSKRKVYDLV+KEI+NTDSLCIAPVNQAFCALVTLIEEGVDSQA
Sbjct: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVKKEIENTDSLCIAPVNQAFCALVTLIEEGVDSQA 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420
           FK FQYRFKDALFHGPQGMTIMGTNGVQ+WDCAFAIQY F AGLAER EF++TIVSAYKF
Sbjct: 361 FKDFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFTAGLAERPEFHDTIVSAYKF 420

Query: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480
           LCR+QFDTECVPGSFRDKRKGAWGFSTKTQGY VSDCTAE+IKAIIMV+NSPVF++VH++
Sbjct: 421 LCRSQFDTECVPGSFRDKRKGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFSDVHHL 480

Query: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540
           I+NERLFEGIDVLLNLQN+GSFEYGSFATYEKIKAPLAME LNPAEVFGNIMVEYPYVEC
Sbjct: 481 ITNERLFEGIDVLLNLQNVGSFEYGSFATYEKIKAPLAMENLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALE 600
           TDSSVLGLTYFHK+FDY                  SQLP+G WYGSWGICFTYAGMFALE
Sbjct: 541 TDSSVLGLTYFHKFFDYKKEEISTCIRIAIEYIKKSQLPDGGWYGSWGICFTYAGMFALE 600

Query: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660
           ALHTVGETYENSSTVRKGCDFLVSKQM+DGGWGESMKSSELHSYVDSE+SLVVQTAW LI
Sbjct: 601 ALHTVGETYENSSTVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEESLVVQTAWALI 660

Query: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALLFAEYP ++VIDRGIELLK+RQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLFAEYPRREVIDRGIELLKHRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYSKAYEQHAL 731
           MY+KAYE  +L
Sbjct: 721 MYTKAYEPESL 731

>Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1379 bits (3570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/731 (88%), Positives = 685/731 (93%)

Query: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60
           MTEFYSE IGLPKTDPRLWRLRTDE+GRESWEYLT EQAANEPPSTFTQWLLQDP F  P
Sbjct: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60

Query: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120
           QP RNKHSP+FSAFDACHNGASFF+LLQ+P SGIFPCQYKGPMF+TIGYVAVNYIAG+QI
Sbjct: 61  QPGRNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180
           PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGT LNYVILRLLGLPKDHPVC K+R 
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARG 180

Query: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240
           TLLRLGGA+GSPHWGKIWLSALNLY+WEGVNPAPPETWLLPYSLPMHPGRWWVHTR VYI
Sbjct: 181 TLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYI 240

Query: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300
           PVSYLSLVKF+CPMTPLLEE+R+EIYTKPFDKI FS HRNTVCGVDLYYPHS+TL+IANN
Sbjct: 241 PVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANN 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360
           FVVFYEKYLRNRFIYSLSKRKVYDL++ EI+NTDSLCIAPVNQAFCALVT IEEGVDSQA
Sbjct: 301 FVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQA 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420
           FKKFQYRFKDALFHGPQGMTIMGTNGVQ+WDCAFAIQY FIAGLAER EFYNTIVSAYKF
Sbjct: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKF 420

Query: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480
           LCRAQFDTECVPGSFR+KRKG+WGFSTKTQGY V+DCTAE+IKAIIMVKNSPVF+EVH++
Sbjct: 421 LCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHL 480

Query: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540
           I++ERLFEGIDVLL+LQN+GSFEYGSFATYEKIKAPLAME LNPAEVFGNIMVEYPYVEC
Sbjct: 481 ITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALE 600
           TDSSVLGLTYFHK+FDY                  +Q P+GSWYGSWGICFTYAGMFA+E
Sbjct: 541 TDSSVLGLTYFHKFFDYKKEEIRRRIRIAIEYIKRAQSPDGSWYGSWGICFTYAGMFAME 600

Query: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660
           ALHTVGE YENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDS KSLVVQ+AW LI
Sbjct: 601 ALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALI 660

Query: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720
           AL FAEYP K+VIDRGIELLKNRQEESGEWKFE VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYSKAYEQHAL 731
           MY+KAYEQ  L
Sbjct: 721 MYAKAYEQPGL 731

>Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON}
           (18976..21177) [2202 nt, 734 aa]
          Length = 733

 Score = 1234 bits (3192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/733 (78%), Positives = 647/733 (88%), Gaps = 2/733 (0%)

Query: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60
           M EFYSE IGL KTDP+LWRLRTD++GRESWEYLT E A  +P S++TQWLLQ PEFP P
Sbjct: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60

Query: 61  QPERN--KHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGI 118
            P +N    + N++A+DACHNGASFFKLLQ+ +SGIFPCQYKGPMFMTIGY+AVNYIAG+
Sbjct: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120

Query: 119 QIPEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKS 178
           +IP+HERIE+IRYIVNTAHPVDGGWGLHSVDKSTVFGT LNYV LRLLGL KDHPVCVK+
Sbjct: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180

Query: 179 RNTLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAV 238
           R+TL++LGGA+G+PHWGK WLS LNLY+WEGVNPAPPETWLLPYSL +HPGRWWVHTR V
Sbjct: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240

Query: 239 YIPVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIA 298
           Y+P+SYLSLV+++C +TPLL ELREEIYTKPFD I FS+HRNTVCGVDLYYPHSK L++A
Sbjct: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300

Query: 299 NNFVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDS 358
           N+ +VFYEKYLR ++++  SK  VYDL++KEI+NTD LCIAPVNQAFCALVTLIEEG DS
Sbjct: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360

Query: 359 QAFKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAY 418
           QAFK+F++RFKDALFHGPQGMT+MGTNGVQ WDCAFAIQY F+AGLAE+ EFY+TIV AY
Sbjct: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420

Query: 419 KFLCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVH 478
           +FLCR+QFDTECVPGSFRDKR GAWGFSTKTQGY VSDCTAEAIKAIIMV+NS VF  VH
Sbjct: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480

Query: 479 NMISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYV 538
           + IS+ERL +GIDVL++LQN+GSFEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYV
Sbjct: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540

Query: 539 ECTDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFA 598
           ECTDSSVLGLT+FHK+  Y                   Q  +GSWYG WGICFTYAGMFA
Sbjct: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600

Query: 599 LEALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWV 658
           +EAL+TVGE Y NS TVRKGCDFLVSKQM+DGGWGESMKSSELHSYVDSEKSLVVQTAWV
Sbjct: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660

Query: 659 LIALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKA 718
           L+ALL AEYP KDVIDRGI+LLK+RQ  SGEWKFE VEGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720

Query: 719 LGMYSKAYEQHAL 731
           LG+Y+KAY  + +
Sbjct: 721 LGLYTKAYSDNGI 733

>TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {ON}
           Anc_5.351 YHR072W
          Length = 733

 Score = 1198 bits (3100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/730 (76%), Positives = 631/730 (86%), Gaps = 1/730 (0%)

Query: 3   EFYSETIGLPKTDPRLWRLRTDEIGRESWEYLT-SEQAANEPPSTFTQWLLQDPEFPHPQ 61
           EFYSE IGLPKTDP+ WRLRTDE+GRESWEYL   E   N+  ST+T+WLLQ P+FP P 
Sbjct: 4   EFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPN 63

Query: 62  PERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQIP 121
           P  N  S NF A +ACHNGASF+KLLQ+P SG+FPCQYKGPMFM IGY+AVNYIAGI+IP
Sbjct: 64  PAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIP 123

Query: 122 EHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRNT 181
           +HERIE+IRYIVNT+HPVDGGWGLHSVDKSTVFGTALNYV LRLLGL KDHPVCVK+R+T
Sbjct: 124 DHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDT 183

Query: 182 LLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYIP 241
           L+RLGGA+G+PHWGKIWLSALNLY+WEGVNPAPPETWLLPYSLP+HPGRWWVHTR VYIP
Sbjct: 184 LMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIP 243

Query: 242 VSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANNF 301
           VSYLSL K+TC +TPLL E+R EIYTK F+ I FSKHRNTVCGVDLYYPHSK L++AN+ 
Sbjct: 244 VSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDC 303

Query: 302 VVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQAF 361
           +VFYE YLR  ++Y  S++ VY+L++KEI+NTD LCIAPVNQAFCALVTLIEEG +S+ F
Sbjct: 304 LVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQF 363

Query: 362 KKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKFL 421
           ++FQYR KDALFHGPQGMT+MGTNG Q WDCAF IQY F+AGLAE+ EFY+ I +AYKFL
Sbjct: 364 ERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFL 423

Query: 422 CRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNMI 481
           CR+QFDTEC PGSFRDKR GAWGFSTKTQGY VSDCTAE+IKAIIMV+NSP F ++HN  
Sbjct: 424 CRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEF 483

Query: 482 SNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECT 541
           S+ERL++GID+L++LQN+GSFEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYVECT
Sbjct: 484 SDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543

Query: 542 DSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALEA 601
           DSSVLGLTYFHK++DY                   Q  +GSWYG WGICFTYAGMFA+EA
Sbjct: 544 DSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEA 603

Query: 602 LHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLIA 661
           L TVGE Y+NS  VRKGCDFLV KQM+DGGW ESMKSSELH+YV SE+SLVVQTAWVLIA
Sbjct: 604 LETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIA 663

Query: 662 LLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGM 721
           LL A+YP KDVIDRGI+LLK+RQ+ SGEWKFE VEGVFNHSCAIEY SYRFLFPIKALG+
Sbjct: 664 LLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGL 723

Query: 722 YSKAYEQHAL 731
           Y K Y   ++
Sbjct: 724 YVKNYGNDSI 733

>KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {ON}
           Anc_5.351 YHR072W
          Length = 729

 Score = 1182 bits (3059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/725 (76%), Positives = 628/725 (86%), Gaps = 9/725 (1%)

Query: 4   FYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQ--DPEFPHPQ 61
            YSE +GLP+TDP+ WRLRTDE+GRE+W+Y+  +Q   +P S+FTQWLLQ  D E   P+
Sbjct: 6   LYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSAPK 65

Query: 62  PERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQIP 121
                     +AFD+C NGA+FFK LQ+P SG+FPCQYKGPMFMTIGY+AVNYIAGI+IP
Sbjct: 66  EP-------VTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIP 118

Query: 122 EHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRNT 181
           +HER+EIIRYIVNT+HPVDGGWGLHSVDKSTVFGT LNYVILRLLGL +DHPVC+K+R+T
Sbjct: 119 KHERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDT 178

Query: 182 LLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYIP 241
           LLRLGGA+G+PHWGKIWLS LNLY+WEGVNPAPPETWLLPY LP+HPG+WWVHTR VY+P
Sbjct: 179 LLRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLP 238

Query: 242 VSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANNF 301
           +SYLSLV ++C +TPLLEE+R EIYTKPFD I FSKHRNTVCGVDLYYPHSK L++ANN 
Sbjct: 239 ISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNA 298

Query: 302 VVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQAF 361
           ++FYEKYLR  +IY  SK KVY L++KEIQNTD LCIAPVNQAFCALVTLIEEGVDS+AF
Sbjct: 299 IIFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAF 358

Query: 362 KKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKFL 421
            KF+ RFKDALFHGPQGMT+MGTNGVQ+WDCAFA+QY F+AGLAER EFYN IV+AY+FL
Sbjct: 359 TKFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFL 418

Query: 422 CRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNMI 481
            R+QFDTECVPGSFRDKRKG+WGFSTKTQGY VSDCTAEAIKAIIMVKN+P F++VH+ I
Sbjct: 419 IRSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEI 478

Query: 482 SNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECT 541
            + RL+EGIDVLL+LQN GSFEYGSFATYEKIKAPL ME LNPAEVFGNIM+EYPYVECT
Sbjct: 479 EDSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECT 538

Query: 542 DSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALEA 601
           DSSVLGLT+FHKY+ Y                  +Q P+GSWYG WGIC+TYAGMFALEA
Sbjct: 539 DSSVLGLTFFHKYYKYRTEEISERIRIAIEYLKRAQEPDGSWYGCWGICYTYAGMFALEA 598

Query: 602 LHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLIA 661
           LH+V E Y NS+ VRKGCDFLVSKQ+ DGGWGESMKSSELHSYV + +SLVVQTAW +IA
Sbjct: 599 LHSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIA 658

Query: 662 LLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGM 721
           LL AEYP K VI+RGIELL++RQ  SGEWKFE VEGVFNHSCAIEYPSYRFLFPIKALG+
Sbjct: 659 LLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGL 718

Query: 722 YSKAY 726
           Y+K Y
Sbjct: 719 YNKTY 723

>CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa]
           {ON} highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072w ERG7 lanosterol synthase
          Length = 733

 Score = 1172 bits (3033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/723 (76%), Positives = 628/723 (86%), Gaps = 2/723 (0%)

Query: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60
           MT+FYS+T+G+P+TDP+ WRLRT E+GRE+WEY+  ++   +P STF QWLLQD EFP P
Sbjct: 1   MTQFYSDTVGIPRTDPKRWRLRTTELGREAWEYIEQDKVDADPQSTFVQWLLQDEEFPTP 60

Query: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120
            P   K   + S+  AC+ GASF+KLLQ+  SGIFPCQYKGPMFMTIGYVAVNYIAG+++
Sbjct: 61  SPR--KEGDDLSSEQACYYGASFYKLLQDQKSGIFPCQYKGPMFMTIGYVAVNYIAGVKL 118

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180
           PEHERIE+IRYIVNTAHPVDGGWGLHSVDKSTVFGT LNYV LRLLGLPKDH VCV++R+
Sbjct: 119 PEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVCLRLLGLPKDHIVCVRARH 178

Query: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240
           TL RLGGA G+PHWGKIWLS LNLY+WEGVNPAPPETWLLPYSLP+HPGRWWVHTRAVY+
Sbjct: 179 TLHRLGGATGAPHWGKIWLSILNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRAVYL 238

Query: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300
           PVSYLSL+K++CP+T LL E+R+EIYTK FDKI FS+HRNTVCGVDLYYPHSK L+ AN+
Sbjct: 239 PVSYLSLIKYSCPLTDLLSEIRQEIYTKSFDKINFSQHRNTVCGVDLYYPHSKILDTAND 298

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360
            +VFYEKYLR R +   SK+ VY+L++KEIQNTDSLCIAPVNQAFCALVT +EEG DS+A
Sbjct: 299 VIVFYEKYLRPRLVSMASKKVVYNLIKKEIQNTDSLCIAPVNQAFCALVTYLEEGKDSKA 358

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420
           F++FQYRFKD LFHGPQGMT+MGTNGVQ+WDCAF IQY F+AGLAE+ EF   I++AYKF
Sbjct: 359 FERFQYRFKDGLFHGPQGMTVMGTNGVQTWDCAFMIQYFFVAGLAEKPEFREMIINAYKF 418

Query: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480
           LCR+QFDTECV GSFRDKR GAWGFSTKTQGY VSDCTAEAIKAIIMV+NSPVF+ VH+ 
Sbjct: 419 LCRSQFDTECVEGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSPVFSSVHDE 478

Query: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540
           I++ERL +GIDVLL+LQNIG FEYGSFATYEKIKAPL+ME LNPAEVFGNIMVEYPYVEC
Sbjct: 479 ITDERLCKGIDVLLSLQNIGKFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEYPYVEC 538

Query: 541 TDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALE 600
           TDSSVLGLTYFHKY+DY                  +Q  +G WYG WGICFTYAGMFA+E
Sbjct: 539 TDSSVLGLTYFHKYYDYRKDEISHRIRIAIDYIKQAQQDDGGWYGCWGICFTYAGMFAME 598

Query: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660
           ALH+VGETY+NS TVRKGCDFL+SKQM DGGWGESMKSSELH YVDS KSLVVQTAW LI
Sbjct: 599 ALHSVGETYDNSLTVRKGCDFLLSKQMPDGGWGESMKSSELHDYVDSPKSLVVQTAWALI 658

Query: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALL A+ P +D I+RGI LLK+RQ+ SGEWKFE  EGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 659 ALLLAKCPNEDAIERGINLLKSRQQPSGEWKFESAEGVFNHSCAIEYPSYRFLFPIKALG 718

Query: 721 MYS 723
           +Y+
Sbjct: 719 LYN 721

>KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.351
           YHR072W
          Length = 731

 Score = 1168 bits (3022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/731 (73%), Positives = 624/731 (85%)

Query: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60
           MT FYS+ +GL KTDPRLWRLRTD++GR++W+Y+    A ++P +TF QWLLQ P FP P
Sbjct: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60

Query: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120
            P+      +F+A DAC+NGA+FFKLLQ+ +SGIFPCQYKGPMFMTIGYVAVNYIAGI+I
Sbjct: 61  NPDIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180
           PEHE+IE+IRYIVNTAHPVDGGWGLHSVDKST FGTA+NYVILRLLGL K H VCV++R+
Sbjct: 121 PEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARD 180

Query: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240
           TLLRLGGA+G PHWGKIWLS LNLY WEGVNPAPPETWLLPY LP+HPGRWWVHTR VY+
Sbjct: 181 TLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYL 240

Query: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300
           P+SYLSLV+++   TPLLEE+R+EIY KPFD I FS+HRNTVCGVDLYYPHS  L+ AN 
Sbjct: 241 PISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANK 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360
            +V YEK+LR  ++   S++ +Y+L+ KE QNTD LCIAPVNQAFCAL TLIEEGV+S+ 
Sbjct: 301 AIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKP 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420
           F+K+Q RFKDALFHGPQGMT+ GTNGVQ+WDCAFAIQYLFIAGLAE+ EFY+ + +A+KF
Sbjct: 361 FRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKF 420

Query: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480
           LCR+QFDTECVPGSFRDKR GAWGFSTKTQGY VSDCTAE+IKAIIMV+NSPVF ++H+ 
Sbjct: 421 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDE 480

Query: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540
           I++ERL +GID+LL+LQN+GSFE+GSFATYEKIKAPL +E LNPAEVFGNIMVEYPYVEC
Sbjct: 481 ITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALE 600
           TDSSVLGLTYFH+++ Y                  +Q  +GSWYGSWGICFTYAGMFA+E
Sbjct: 541 TDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAME 600

Query: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660
           AL +VGE YENS  V KGCDFLVSKQM DGGW ESMKSSELH+YV +++SLVVQTAWVLI
Sbjct: 601 ALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLI 660

Query: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALL A+YP K VIDRGI LLK+RQE SGEWKFE VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYSKAYEQHAL 731
           +Y K Y    +
Sbjct: 721 LYVKEYGAQGI 731

>TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1166 bits (3017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/731 (73%), Positives = 617/731 (84%)

Query: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60
           M +FYSE +GL +TDP LWRLRTDE+GRE+W YLT EQA N+   TFTQWLLQ  +FP P
Sbjct: 1   MVQFYSEELGLERTDPDLWRLRTDELGRETWVYLTPEQAKNDEQCTFTQWLLQSEKFPKP 60

Query: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120
            P R+  + +F A DAC NGASFFKLLQ+P SGIFPCQYKGPMF+TIGYVAV+YI+G  I
Sbjct: 61  SPNRHSGTTDFKAADACENGASFFKLLQDPRSGIFPCQYKGPMFLTIGYVAVHYISGTTI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180
           PEHERIEIIRYIVNTAHPVDGGWGLHSVDKST FGT +NYVILRLLGLPKDHPVC+K+R 
Sbjct: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTAFGTVVNYVILRLLGLPKDHPVCLKARA 180

Query: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240
            L++LGGA+G+PHWGKIWLS LNLY+WEGVNPAPPE WLLPY+LP+HPGRWWVHTRA+Y+
Sbjct: 181 LLMKLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPEMWLLPYALPIHPGRWWVHTRAIYL 240

Query: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300
           PVSYLSL++++CP+  LL ELR EIY KPFD I FS +RNTVCG+DLYYPH+  LN+ANN
Sbjct: 241 PVSYLSLIRYSCPLNDLLRELRSEIYVKPFDSINFSSNRNTVCGIDLYYPHTTVLNMANN 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360
            +VFYEK+LR  ++   +K +VY L++KEI NTD LCIAPVNQAFCALVT IEEG +S A
Sbjct: 301 VMVFYEKHLRPNWLGKKAKDRVYGLIKKEIANTDYLCIAPVNQAFCALVTYIEEGKESSA 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420
           FKKF+ R KDALFHGPQGMTIMGTNGVQ+WDCAFAIQY F+AGLAE+ E+Y+TI +AYKF
Sbjct: 361 FKKFEDRLKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAEKPEYYDTICAAYKF 420

Query: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480
           LCR QFDTECV GSFRDKR GAW FSTK QGY VSDCTAEAIKAIIMV+NSP F  + N 
Sbjct: 421 LCRTQFDTECVEGSFRDKRVGAWPFSTKAQGYTVSDCTAEAIKAIIMVRNSPKFASIRNE 480

Query: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540
           I++ERL +GIDVLL+LQNI SFEYGSFATYEKIKAPL+ME LNPAEVFGNIMVE+PYVEC
Sbjct: 481 ITDERLCKGIDVLLSLQNITSFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEFPYVEC 540

Query: 541 TDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALE 600
           TDSSVLGLTYFH ++DY                   Q  +GSWYG WG+C++YAGMFA+E
Sbjct: 541 TDSSVLGLTYFHTFYDYRKEEISKRIKLAIDYIKRDQDEDGSWYGCWGVCYSYAGMFAME 600

Query: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660
           ALH+VGE Y NS  VRKGCDFLVS+Q+ DGGWGESMKSSELHSYV + +SLVVQTAWVLI
Sbjct: 601 ALHSVGENYSNSEYVRKGCDFLVSRQISDGGWGESMKSSELHSYVSTRESLVVQTAWVLI 660

Query: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALL  +YP K VID GI+LLK RQ E+GEWKFEG+EGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 ALLLGKYPNKSVIDAGIKLLKKRQLETGEWKFEGIEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYSKAYEQHAL 731
           +Y+  Y   ++
Sbjct: 721 LYTATYGDDSI 731

>NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {ON}
           Anc_5.351 YHR072W
          Length = 728

 Score = 1152 bits (2979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/728 (73%), Positives = 626/728 (85%), Gaps = 4/728 (0%)

Query: 2   TEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHPQ 61
            + YS+ +GL KTDP  WRLRT+ +GR +WEY+ SEQ  N+P STFT+WLLQ P+FP P 
Sbjct: 3   AKLYSDELGLQKTDPTRWRLRTNPLGRHTWEYINSEQKTNDPQSTFTKWLLQLPDFPAPT 62

Query: 62  PERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQIP 121
           P   +     +A +AC++GASFF+LLQ+ +SG FPCQYKGPMFMTIGYVAVNYIAG++IP
Sbjct: 63  PTTEEPR---TAREACYDGASFFRLLQDKESGTFPCQYKGPMFMTIGYVAVNYIAGLEIP 119

Query: 122 EHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRNT 181
            HERIEIIRY+VNTAHPVDGGWGLHS DKSTVFGT +NYVILRLLG+ KDH VC ++R T
Sbjct: 120 NHERIEIIRYLVNTAHPVDGGWGLHSTDKSTVFGTVINYVILRLLGMSKDHIVCRRARKT 179

Query: 182 LLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYIP 241
           LL LGGA+G+PHWGK+WLS LNLY+WEGVNPAPPETWLLPY LP+HPGRWWVHTR VY+P
Sbjct: 180 LLSLGGAIGAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYCLPIHPGRWWVHTRGVYLP 239

Query: 242 VSYLSLVKFTCPMTPLLEELREEIYT-KPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300
           +SYLSLV F+C +TPLL+E+REEIYT +PF+ IKF+++RN VCGVDLYYPHS+ L++AN 
Sbjct: 240 ISYLSLVHFSCELTPLLKEIREEIYTAQPFEAIKFAQNRNNVCGVDLYYPHSQVLDVANA 299

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360
            +V YE+YLR  ++  LSKRKVY+L++KEI NTD LCIAPVNQAFCALVTLIEEGVDS A
Sbjct: 300 CIVKYEEYLRPTWLKKLSKRKVYELIKKEISNTDYLCIAPVNQAFCALVTLIEEGVDSNA 359

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420
           F+KF YRFKD+LFHGPQGMT+MGTNGVQ WDCAFAIQY F+AGLAE+SEFY+TI SAY F
Sbjct: 360 FQKFSYRFKDSLFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKSEFYDTIASAYAF 419

Query: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480
           LCR+QFDTECV GSFRDKR G+WGFSTKTQGY VSDCTAE+IKAIIMVKNSPVF  +H++
Sbjct: 420 LCRSQFDTECVRGSFRDKRVGSWGFSTKTQGYTVSDCTAESIKAIIMVKNSPVFKAIHHL 479

Query: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540
           I++E++++GIDVLL+LQN+GSFEYGSFATYEKIKAPL +E LNPAEVFGNIMVEYPYVEC
Sbjct: 480 ITDEKIYQGIDVLLSLQNVGSFEYGSFATYEKIKAPLFLEKLNPAEVFGNIMVEYPYVEC 539

Query: 541 TDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALE 600
           TDSSVLGLTYFH Y++Y                   Q  +GSWYGSWGIC+TYAGMFA+E
Sbjct: 540 TDSSVLGLTYFHNYYNYRGNEISQRIKVAVDYIKHLQASDGSWYGSWGICYTYAGMFAME 599

Query: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660
           ALH+VGE Y NS  V+KGCDFLV++QM DGGWGE MKSSELH+YV+SE+S VVQTAWV+I
Sbjct: 600 ALHSVGECYANSIVVKKGCDFLVNRQMTDGGWGEPMKSSELHTYVNSERSQVVQTAWVVI 659

Query: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALL A+YP KDVI +G+ELLK+RQE SGEWKFE  EGVFNHSCAIEYPSYR LFPIKALG
Sbjct: 660 ALLLAKYPRKDVIIKGVELLKSRQEPSGEWKFESPEGVFNHSCAIEYPSYRHLFPIKALG 719

Query: 721 MYSKAYEQ 728
           +Y++ Y++
Sbjct: 720 LYAEIYDK 727

>TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.351
           YHR072W
          Length = 743

 Score = 1149 bits (2973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/728 (73%), Positives = 615/728 (84%), Gaps = 3/728 (0%)

Query: 4   FYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHPQPE 63
            YS+ + LPKTDPR WRL TD++GRESWEYL+ E +   P STF +WLLQ P+FP P+P+
Sbjct: 14  LYSDELKLPKTDPRRWRLITDKLGRESWEYLSEEDSKKIPQSTFVKWLLQIPDFPTPKPK 73

Query: 64  RNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQIPEH 123
             +   NF+  DA  NGA+FFKLLQ+P+SGIFPCQYKGPMF+TIGYVAV YIAGI+IPEH
Sbjct: 74  IKQGDKNFTTHDALLNGANFFKLLQDPESGIFPCQYKGPMFLTIGYVAVQYIAGIKIPEH 133

Query: 124 ERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRNTLL 183
           ER+EIIRYIVNTAHPVDGGWGLHSVDKSTVFGT LNYVILRLLGLPK HPVCVK+R TL+
Sbjct: 134 ERLEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKTHPVCVKARKTLI 193

Query: 184 RLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYIPVS 243
           RLGGA+GSPHWGKIWLS LNLY+WEGVNPAPPETWLLPYSLP+HPGRWWVHTR VY+PVS
Sbjct: 194 RLGGAIGSPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYLPVS 253

Query: 244 YLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANNFVV 303
           YL L KF CP TPL+EE+R+EIY   +D I FSKHRNTVCGVDLYYPHSK L++ANN +V
Sbjct: 254 YLGLTKFACPPTPLIEEIRKEIYATEYDTIDFSKHRNTVCGVDLYYPHSKILDVANNILV 313

Query: 304 FYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQAFKK 363
           FYEK++R  FIY+ SK KV DL+ KEI NTD LCIAPVNQAFC+LV L+E+GV+S+ F++
Sbjct: 314 FYEKWIRPNFIYNKSKEKVLDLIEKEIANTDYLCIAPVNQAFCSLVILVEKGVNSKEFER 373

Query: 364 FQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKFLCR 423
            QYRFKDALFHGPQGMT+MGTNGVQ+WDCAFA+QY F+AGLAER EF + I+ +YKFLCR
Sbjct: 374 CQYRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFMAGLAERPEFKDLIIRSYKFLCR 433

Query: 424 AQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNMISN 483
           +QFDTECVPGSFRDKR G WGFSTKTQGY VSDCTAE+IKAIIMV+NSP F EVH+ IS+
Sbjct: 434 SQFDTECVPGSFRDKRIGGWGFSTKTQGYTVSDCTAESIKAIIMVRNSPAFKEVHDEISD 493

Query: 484 ERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECTDS 543
           ERL++GI++L++LQN+G FEYGSFATYEKIKAPL+ME LNPAEVF NIMVEYPYVECTDS
Sbjct: 494 ERLYQGIEILMSLQNLGKFEYGSFATYEKIKAPLSMELLNPAEVFCNIMVEYPYVECTDS 553

Query: 544 SVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALEALH 603
           SVLGLTYFHK++DY                  +Q  +GSWYGSWGICFTYA MFALEAL 
Sbjct: 554 SVLGLTYFHKHYDYKYDEIGKRIRLAIDYIKRAQNNDGSWYGSWGICFTYASMFALEALE 613

Query: 604 TVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDS---EKSLVVQTAWVLI 660
           T+GE Y NS TV+KGCDF+VSKQ KDGGW E+MKSSE+H YVDS   E S VVQT+W +I
Sbjct: 614 TIGEDYNNSETVKKGCDFIVSKQNKDGGWSETMKSSEIHYYVDSGDLEGSYVVQTSWSVI 673

Query: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L+ A YP KDV+ RGIE +K++Q  SGEW+F+ VEGVFNHSC IEYPSYRFLFPIKALG
Sbjct: 674 GLILANYPDKDVVYRGIEYIKSQQLPSGEWEFQNVEGVFNHSCGIEYPSYRFLFPIKALG 733

Query: 721 MYSKAYEQ 728
           +Y   Y Q
Sbjct: 734 LYRTRYCQ 741

>NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1146 bits (2965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/730 (72%), Positives = 623/730 (85%), Gaps = 4/730 (0%)

Query: 2   TEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHPQ 61
            + YSE +GL KTDP LWRLRT+  GR+SWEY+T +Q+ N+P S FT+WLLQ P+FP PQ
Sbjct: 3   NKLYSEELGLEKTDPLLWRLRTNIDGRQSWEYITKDQSPNDPQSNFTKWLLQLPDFPTPQ 62

Query: 62  -PERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120
            P+  K   + SA   C  GA FF+LLQ+  SG FPCQYKGPMFMTIGYVAVNY+A I+I
Sbjct: 63  YPDNIK---DVSAEAICLKGAKFFRLLQDETSGTFPCQYKGPMFMTIGYVAVNYVADIKI 119

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180
           PE ERIEIIRYIVNTAHPVDGGWGLHS DKSTVFGT LNY+ILRLLGL  +HPVC+K+R+
Sbjct: 120 PESERIEIIRYIVNTAHPVDGGWGLHSEDKSTVFGTVLNYIILRLLGLDANHPVCMKARD 179

Query: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240
           TLLRLGGA+ +PHWGK+WLS LNLY+WEGVNPAPPETWLLPY +P+HPGRWWVHTR VY+
Sbjct: 180 TLLRLGGAISAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYWMPIHPGRWWVHTRGVYL 239

Query: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300
           P+SYLSLV + C +T LL+E+R EIY KPFD I FSKHRNTVCGVDLYYPHSKTL+ AN+
Sbjct: 240 PISYLSLVHYQCELTDLLKEIRSEIYVKPFDSIDFSKHRNTVCGVDLYYPHSKTLDFANS 299

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360
            +V YEKYLR   +   SK KVYDL++KEI+NTD LCIAPVNQAFCALVTL+EEG DS+A
Sbjct: 300 LIVPYEKYLRPNALRDYSKHKVYDLIKKEIENTDYLCIAPVNQAFCALVTLLEEGADSKA 359

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420
           F++FQYRFKDALF GPQGMT+MGTNGVQ+WDCAFAIQYLF+AGLA+R EFYNTI +AYKF
Sbjct: 360 FERFQYRFKDALFLGPQGMTVMGTNGVQTWDCAFAIQYLFVAGLAKRPEFYNTISNAYKF 419

Query: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480
           LCR+QFDT+CV GSFRDKR GAWGFSTKTQGY VSDCTAE+IKAIIMV+NS +F ++H+ 
Sbjct: 420 LCRSQFDTDCVTGSFRDKRDGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSVIFKDIHDE 479

Query: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540
           IS+ERL++ +D+LL+LQN GSFE+GSFATYEKIKAPL +E LNPAEVFGNIMVEYPYVEC
Sbjct: 480 ISDERLYKAVDILLDLQNTGSFEFGSFATYEKIKAPLFLEALNPAEVFGNIMVEYPYVEC 539

Query: 541 TDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALE 600
           TDSSVLGLT FHK+++Y                   Q  +GSWYGSWGIC+TYAGMFA+E
Sbjct: 540 TDSSVLGLTSFHKHYNYRKDEISKRINIAIEYIKKVQEDDGSWYGSWGICYTYAGMFAME 599

Query: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660
           ALH+VGETY NS  V+KGCDFLV++Q++DGGWGESMKSSELH+YV +++SLVVQTAWV++
Sbjct: 600 ALHSVGETYGNSFVVKKGCDFLVARQLEDGGWGESMKSSELHTYVSTKESLVVQTAWVVL 659

Query: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720
           ALL A+YP K++ID+GI LLK RQ+ SGEWKFE  EGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 660 ALLLAQYPNKNIIDKGIALLKKRQQVSGEWKFESPEGVFNHSCAIEYPSYRFLFPIKALG 719

Query: 721 MYSKAYEQHA 730
           +YS+ YE +A
Sbjct: 720 LYSQIYEHNA 729

>SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {ON}
           highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072W ERG7 Lanosterol synthase an essential
           enzyme that catalyzes the cyclization of squalene 2 3-
           epoxide a step in ergosterol biosynthesis
          Length = 746

 Score = 1139 bits (2945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/731 (72%), Positives = 612/731 (83%), Gaps = 1/731 (0%)

Query: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60
           MT+ YS+ +GLPKTDP  WRL TDE+GRE+WEYL++EQAA EP S++ ++LLQ P+FP P
Sbjct: 17  MTKLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAP 76

Query: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120
           +PER    P F+A+DA +NGA F +LLQE +SGIFPCQYKGPMF+TIGYVA  Y AGI+I
Sbjct: 77  KPERTSEDPEFTAYDAAYNGAQFLQLLQE-ESGIFPCQYKGPMFITIGYVATCYAAGIEI 135

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180
           PEHER EI+RYIVN AHPVDGGWGLHS DKST FGT++NYVILRLLGLP DH VC ++R+
Sbjct: 136 PEHERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARS 195

Query: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240
           TLL+LGGA+G+PHWGKIWLS LNLY WEGVNPAPPE WLLPY+LP+HPGRWWVHTRAVY+
Sbjct: 196 TLLKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYM 255

Query: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300
           PV YLS  KF C +TPLL+E+R EIYTK +D I FSKHRNTVCG+DLYYPH+K L++AN 
Sbjct: 256 PVGYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANW 315

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360
            +VFYEKYLR  +  + + +KVY+L++KEI NTD LCIAPVN AFCA+VTLIEEGVDS  
Sbjct: 316 GMVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHE 375

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420
           F +F+ RFKD LFHGPQGMT+MGTNGVQ WDCAFA+QYLF+A LAE  EF   IV AYKF
Sbjct: 376 FNRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYLFLAELAELPEFRGIIVKAYKF 435

Query: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480
           LCR+QFDTEC PGSFRDKR G W FSTKTQGY VSDCTAEA+KAIIMV+NSP F E  N 
Sbjct: 436 LCRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNE 495

Query: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540
           IS+ERL++ +D+LLNLQN+GSFEYGSFA+YEKIKA   +E LNPAEVFGNIMVE+PYVEC
Sbjct: 496 ISDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVEC 555

Query: 541 TDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALE 600
           TDSSVLGLTYFHK++DY                  SQ  NGSWYGSWG+CFTYAGMFALE
Sbjct: 556 TDSSVLGLTYFHKHYDYRKDDIAHAIKIAIDYIKRSQAKNGSWYGSWGVCFTYAGMFALE 615

Query: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660
           AL+TVGE YENS  VRKGCDFLVS+QM+DGGWGES KSSELH+YV SE+SLVVQTAW +I
Sbjct: 616 ALYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVI 675

Query: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720
            LL AEYP K VIDRGI+LLK+RQ  SGEWKFE +EGVFNHSC IEYPSY+FLFPIKALG
Sbjct: 676 GLLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALG 735

Query: 721 MYSKAYEQHAL 731
           +Y+K Y   A+
Sbjct: 736 LYAKRYGNDAI 746

>ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 732

 Score = 1135 bits (2935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/732 (70%), Positives = 618/732 (84%), Gaps = 1/732 (0%)

Query: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60
           MT+ YSE + L +TDP LWRLR D++GRESWEY++ E A N+P S + QWLLQ P FP P
Sbjct: 1   MTKLYSEELQLERTDPNLWRLRVDKLGRESWEYISKEDAKNDPQSKYVQWLLQLPSFPKP 60

Query: 61  QPE-RNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQ 119
            P+  + ++  F+A +AC NGASF++LLQ+PDSGIFPCQYKGPMFMTIGYV V+Y+AGI+
Sbjct: 61  SPKIHSGNAKKFNALEACKNGASFYQLLQDPDSGIFPCQYKGPMFMTIGYVVVHYVAGIE 120

Query: 120 IPEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSR 179
           IP+ +R+E+IRYIVNT+HPVDGGWGLHS DKSTVFGTA+NYV LRLLGLP+DHPVCVK+R
Sbjct: 121 IPKPKRLEMIRYIVNTSHPVDGGWGLHSTDKSTVFGTAINYVNLRLLGLPRDHPVCVKAR 180

Query: 180 NTLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVY 239
            TL +LGGALG+PHWGKIWLS LNLY+WEGVNPAPPETWLLPY LP+HPGRWWVHTRA+Y
Sbjct: 181 RTLHKLGGALGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYFLPIHPGRWWVHTRAIY 240

Query: 240 IPVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIAN 299
           +PVSYLSL+++ CP+TPLL+ELREE+Y KPF+ I F  +RNTVCGVDLYYPHSK L++ N
Sbjct: 241 LPVSYLSLIRYQCPLTPLLQELREELYVKPFNSIDFGSNRNTVCGVDLYYPHSKVLDLMN 300

Query: 300 NFVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQ 359
           + +VFYEK+LR  +I +++K +VY L++KEI NTD LCIAPVNQAFCALVTLIEEGV+S 
Sbjct: 301 SVLVFYEKHLRFNWINTMAKNRVYGLIKKEIANTDYLCIAPVNQAFCALVTLIEEGVNSP 360

Query: 360 AFKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYK 419
            FK+FQ+RF DALFHGPQGMT+MGTNGVQ+WDCAF IQ LF AGLAE+ ++Y T+V AY+
Sbjct: 361 QFKRFQFRFNDALFHGPQGMTMMGTNGVQTWDCAFTIQSLFTAGLAEKEQYYETVVRAYE 420

Query: 420 FLCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHN 479
           FL RAQF  ECVPGSFRD RKGAWGFSTKTQGY VSDCTAE+IKAIIMVK SP + +VH+
Sbjct: 421 FLNRAQFQDECVPGSFRDLRKGAWGFSTKTQGYTVSDCTAESIKAIIMVKKSPFYAKVHS 480

Query: 480 MISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVE 539
           +I +ERL + IDVLL+LQN+G FEYGSFATYE IKAPL ME LNPAEVFGNIMVEYPYVE
Sbjct: 481 LIDDERLCQAIDVLLSLQNVGPFEYGSFATYEMIKAPLLMEKLNPAEVFGNIMVEYPYVE 540

Query: 540 CTDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFAL 599
           CTDS+VLGLT FH Y DY                   Q  +GSWYG WG+CFTYAGMFAL
Sbjct: 541 CTDSAVLGLTSFHDYCDYRRDEISDRINIAVDYIKKCQNEDGSWYGCWGVCFTYAGMFAL 600

Query: 600 EALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVL 659
           EALH+VGE Y NS  V+KGCDFLV +QM DGGWGE+MKS ELH+YV+S++S+VVQT+WV+
Sbjct: 601 EALHSVGEDYHNSKIVQKGCDFLVDRQMADGGWGETMKSCELHTYVESQESMVVQTSWVI 660

Query: 660 IALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKAL 719
           IALL ++YP K VIDR ++ L+ RQE SGEWKF+GVEGVFNHSCAIEYP+YRF+FPIKAL
Sbjct: 661 IALLLSKYPNKSVIDRAVKFLETRQERSGEWKFDGVEGVFNHSCAIEYPNYRFIFPIKAL 720

Query: 720 GMYSKAYEQHAL 731
           G+Y  A+ + A+
Sbjct: 721 GLYVNAFGKEAI 732

>KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 731

 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/731 (68%), Positives = 588/731 (80%)

Query: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60
           M E YSETIGLP+TDP+ WRL TD++GR++WEYL+   +   P STF +WLL+  +FP P
Sbjct: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60

Query: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120
            PE N  +  F+A++A HNGA FF+LLQ+PDSG FPCQYKGPMFMTIGYV   YIA I+I
Sbjct: 61  HPEINSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180
           PEHE+ E+IRY+ N AHPVDGGWGLH VDKSTV GT LNYV++RLLGLPKDH VCV++R+
Sbjct: 121 PEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARD 180

Query: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240
           TLLRLGGA+ SPHW KIWLS LNLY+WEGVNPAPPE W+LPY L +HP RWWVHTR +Y+
Sbjct: 181 TLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYL 240

Query: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300
           PVSYLS  +++C + PLLEE+R EIYT+PF+ I F KHRNTVCGVDLYYPH+K L+  N 
Sbjct: 241 PVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNY 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360
           F+  YE+Y+R  ++   S  +VY+LV+KEI NTD LCIAPVN AFCA+VTLIEEG DS+ 
Sbjct: 301 FISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEE 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420
           F +F YRFKD LFHGPQG+T+MGTNGVQ WDCAF IQY+F+AGLAE  EF+ TIV ++KF
Sbjct: 361 FGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKF 420

Query: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480
           LCR+QF  +CV GSFRDKR GAW FSTKTQGY VSDCTAEAIKAIIMV NS  + +V  +
Sbjct: 421 LCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGV 480

Query: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540
              E+L  GIDVLL LQN+ SFEYGSFATYEKIKAPL ME LNPAEVFGNIMVE+PYVEC
Sbjct: 481 YDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVEC 540

Query: 541 TDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALE 600
           TDSSVLGLTYF +YF+Y                  SQ PNGSWYG WGIC+TYAGMFALE
Sbjct: 541 TDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALE 600

Query: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLI 660
           AL+T+GETYENS  VRKGCDF V+KQ+ DGGW E MKSSELH+YV  ++S VVQTAWVLI
Sbjct: 601 ALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLI 660

Query: 661 ALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALG 720
            L+ A++P K VIDR I LLK RQ+ SGEWK+E VEGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 661 GLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALG 720

Query: 721 MYSKAYEQHAL 731
           +Y K Y   A+
Sbjct: 721 LYVKEYGHSAI 731

>KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 726

 Score = 1075 bits (2780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/725 (69%), Positives = 584/725 (80%), Gaps = 1/725 (0%)

Query: 3   EFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHPQP 62
           + Y++ +GLP TD  LWRLRTDE+G E WEYL+ E+A  +P S++ ++LLQ+P+F  P+P
Sbjct: 2   KLYADELGLPTTDKTLWRLRTDELGSEKWEYLSEEEAKADPQSSYVKYLLQNPDFEAPEP 61

Query: 63  ERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQIPE 122
            R+     F+A DA  NGA FF LLQE D+GIFPCQYKGPMF+TIGYVA  Y A I +PE
Sbjct: 62  LRSSKCDEFTAGDAAFNGAQFFSLLQE-DTGIFPCQYKGPMFLTIGYVATLYCARIPVPE 120

Query: 123 HERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRNTL 182
           H +IEIIRYIVN+AHPVDGGWGLH VDKST FGTA+NYVILRLLGL  DH VC ++R TL
Sbjct: 121 HIKIEIIRYIVNSAHPVDGGWGLHEVDKSTTFGTAINYVILRLLGLEADHIVCQRARKTL 180

Query: 183 LRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYIPV 242
            RLGGA+G+PHWGK WLS LNLYRWEGVNPAPPE WLLPY+LP+HPGRWWVHTRAVY  +
Sbjct: 181 HRLGGAIGAPHWGKAWLSILNLYRWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYQAL 240

Query: 243 SYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANNFV 302
            YLS  K+ C +TPLL+E+R+EIY KPF+ I FSKH+NTV GVDLYYPH+K LNIAN  +
Sbjct: 241 GYLSAAKYCCELTPLLQEIRKEIYVKPFESIDFSKHKNTVGGVDLYYPHTKLLNIANVAL 300

Query: 303 VFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQAFK 362
             YE YL+  +    S RKVY+L++KEI+NTD LCIAPV+ AFCA+VTLIEEG DS  FK
Sbjct: 301 TLYENYLKPNWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAVVTLIEEGRDSYEFK 360

Query: 363 KFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKFLC 422
           +F   F++ LF GPQGMT+MGTNGVQ WDCAFAIQY F+AGLAE  EF +TI  AYKFLC
Sbjct: 361 RFVDGFQEVLFMGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFRDTIEKAYKFLC 420

Query: 423 RAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNMIS 482
           R+QFDTEC PGSFRDKR GAW FSTKTQGY VSDCTAEA+KAIIMV+NSP FT +   IS
Sbjct: 421 RSQFDTECEPGSFRDKRVGAWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPKFTYLRGEIS 480

Query: 483 NERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECTD 542
           +ERL++ +D+LL LQN GSFEYGSFATYEKIKA  A+E LNPAEVFGNIMVE+PYVECTD
Sbjct: 481 DERLYKAVDILLGLQNTGSFEYGSFATYEKIKATTALEKLNPAEVFGNIMVEFPYVECTD 540

Query: 543 SSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALEAL 602
           SSVLGLTYF KY++Y                   Q P+GSWYG WG+CFTYAGMFALEAL
Sbjct: 541 SSVLGLTYFAKYYNYRKDEITKAIEIAIQYIKRVQNPDGSWYGCWGVCFTYAGMFALEAL 600

Query: 603 HTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLIAL 662
           +TVGE YENS  VRKGCDF  S+Q  DGGW ESMKSSELH+YV+++ S VVQTAW LI L
Sbjct: 601 YTVGENYENSEVVRKGCDFFASRQRSDGGWSESMKSSELHTYVEADNSQVVQTAWALIGL 660

Query: 663 LFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGMY 722
           L A+YP +DVIDRGI LLK RQ  SGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALG+Y
Sbjct: 661 LLAKYPNRDVIDRGIALLKKRQLPSGEWKFEDVEGVFNHSCAIEYPSYKFLFPIKALGLY 720

Query: 723 SKAYE 727
           SK YE
Sbjct: 721 SKRYE 725

>Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {ON}
           YHR072W (ERG7) - 2,3-oxidosqualene-lanosterol cyclase
           [contig 272] FULL
          Length = 728

 Score = 1074 bits (2777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/725 (69%), Positives = 584/725 (80%), Gaps = 1/725 (0%)

Query: 4   FYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHPQPE 63
            YSE +GLPKTD + WRL+TD +G E WEYL+  +A  +P S + ++LLQ P+F  P+P 
Sbjct: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61

Query: 64  RNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQIPEH 123
            NK+S +F+A DA  NGA FF LLQE DSGIFPCQYKGPMFMTIGYVA  Y A + IP  
Sbjct: 62  VNKNSAHFTAKDAAFNGAQFFSLLQE-DSGIFPCQYKGPMFMTIGYVAALYCAEVPIPTP 120

Query: 124 ERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRNTLL 183
            + EIIRYIVN++HPVDGGWGLH VDKST FGT +NYVILRLLGL  D+ VC ++R TL 
Sbjct: 121 VKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTLH 180

Query: 184 RLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYIPVS 243
           RLGGA+G+PHWGK WLS LNLY+WEGVNPAPPE WLLPY+LP+HPGRWWVHTRA+Y  + 
Sbjct: 181 RLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQALG 240

Query: 244 YLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANNFVV 303
           YLS  K++CP+TPLLEE+R EIYT+PF+ I FSK +N VCGVDLYYPH++ LNIAN  ++
Sbjct: 241 YLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASMI 300

Query: 304 FYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQAFKK 363
           FYEKYL+  +    S RKVY+L++KEI+NTD LCIAPV+ AFCA+VTLIEEG DS  FK+
Sbjct: 301 FYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFKR 360

Query: 364 FQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKFLCR 423
           F  RF+D LF GPQGMT+MGTNGVQ WDCAFAIQY F+AGLAE  EF+ TI  AYKFLCR
Sbjct: 361 FLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLCR 420

Query: 424 AQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNMISN 483
           +QFDTEC PGSFRDKR GAW FSTKTQGY VSDCTAE++KAIIMV+NSP F  + + IS+
Sbjct: 421 SQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEISD 480

Query: 484 ERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECTDS 543
           ERL++ +DVLL LQN GSFEYGSFATYEKIKA   +E LNPAEVFGNIMVE+PYVECTDS
Sbjct: 481 ERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTDS 540

Query: 544 SVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALEALH 603
           SVLGLTYF K++ Y                  +Q P+GSWYG WGICFTYAGMFALEALH
Sbjct: 541 SVLGLTYFSKHYTYRQEEIKKAIEIAIQYIKNAQKPDGSWYGCWGICFTYAGMFALEALH 600

Query: 604 TVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLIALL 663
           TV ETYENS  V+KGCDFLVSKQ  DGGW ESMKSSELHSYV+S  S  VQTAW LI LL
Sbjct: 601 TVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGLL 660

Query: 664 FAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGMYS 723
            AEYP K++ID+GI LLK RQ ESGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALG+Y+
Sbjct: 661 LAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLYA 720

Query: 724 KAYEQ 728
           K YE 
Sbjct: 721 KKYEH 725

>Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}
           similar to Ashbya gossypii AGR351W
          Length = 732

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/732 (63%), Positives = 563/732 (76%), Gaps = 1/732 (0%)

Query: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60
           M E YS+ +GLP TDP  WRL    +G  SW+Y++   +   P    T+WLL    F  P
Sbjct: 1   MVELYSDYLGLPSTDPSRWRLNCTSLGETSWKYISEADSKKIPQCNCTKWLLNADNFSTP 60

Query: 61  QPERNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQI 120
           +P+      NF A++A +NGASF KLLQ  DSG FP QYKGPMFMTI YV   Y+   +I
Sbjct: 61  EPDVGNGDANFKAYNAAYNGASFLKLLQNQDSGTFPNQYKGPMFMTICYVGSMYVGRKEI 120

Query: 121 PEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRN 180
           PE E+IEIIRYIVNTAHPVDGGWGLH+  KSTVFGT LNY++LRLLG+ KDH VC ++R+
Sbjct: 121 PECEKIEIIRYIVNTAHPVDGGWGLHTTGKSTVFGTVLNYIVLRLLGMSKDHVVCRRARS 180

Query: 181 TLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYI 240
           TL RLGGA+G+PHWGKIWLS LNLY+WEGVNPAP E W LPY +P+HP RWW+HTRA+Y+
Sbjct: 181 TLHRLGGAIGAPHWGKIWLSILNLYKWEGVNPAPAEFWTLPYIVPIHPARWWIHTRAIYL 240

Query: 241 PVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANN 300
           P+SYL  + + C +TPLL+E+R EIYT  FD+I+FSKHRNTVC VDLY+PHS  LN+ N+
Sbjct: 241 PMSYLCGISYACELTPLLQEIRNEIYTTNFDEIQFSKHRNTVCQVDLYFPHSTILNVINS 300

Query: 301 FVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQA 360
            +V+Y+ YLR  ++   S +KVY+L+RKEI NT+ LC+APV+ AFC++VT IEEG DS  
Sbjct: 301 AIVWYQNYLRPDWLVKYSNKKVYELIRKEIVNTEYLCVAPVSAAFCSIVTCIEEGADSPE 360

Query: 361 FKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKF 420
           F++    F   +FHGPQGMT+MGTNG Q WDC+F +QYLF+A LAE  EF + + +AYKF
Sbjct: 361 FERLMEAFAGNVFHGPQGMTVMGTNGSQVWDCSFFVQYLFMANLAELPEFQDAVTNAYKF 420

Query: 421 LCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNM 480
           LCR+QF  ECV GS+RDKR G W FSTKTQGY VSDCTAEA+KA+IMVK SPVF  +H+ 
Sbjct: 421 LCRSQFTHECVSGSYRDKRVGGWPFSTKTQGYTVSDCTAEALKAVIMVKRSPVFAAIHDE 480

Query: 481 ISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVEC 540
           IS E L + IDVLL+LQN+GS EYGSFATYEKI+APL ME LNPAEVF NIMVEYPYVEC
Sbjct: 481 ISEEALQKAIDVLLSLQNVGSIEYGSFATYEKIRAPLIMEKLNPAEVFENIMVEYPYVEC 540

Query: 541 TDSSVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALE 600
           TDS +LGLTYF +Y+DY                   Q  +GSWYG WGIC+TYAGMFALE
Sbjct: 541 TDSCILGLTYFSEYYDYRKDDIDHSVKIAADYIKKVQGKDGSWYGCWGICYTYAGMFALE 600

Query: 601 ALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEK-SLVVQTAWVL 659
           AL+T+GE YENS  VR+GCDFLV KQ+ DGGW ES+KS+EL  Y++ +K SLVV T+W L
Sbjct: 601 ALYTIGENYENSEVVRRGCDFLVKKQLSDGGWSESIKSAELMCYINDDKGSLVVPTSWAL 660

Query: 660 IALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKAL 719
           I LL A+YP K+VIDRGI+LLK+RQ  SGEWKFE +EG+FNHSCAIEYP+YRFLFPIKAL
Sbjct: 661 IGLLLADYPDKEVIDRGIQLLKSRQLRSGEWKFEQIEGIFNHSCAIEYPTYRFLFPIKAL 720

Query: 720 GMYSKAYEQHAL 731
           G+Y+K Y + A+
Sbjct: 721 GIYAKKYGKRAI 732

>AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR072W (ERG7)
          Length = 729

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/728 (62%), Positives = 564/728 (77%)

Query: 4   FYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHPQPE 63
            YS+ +GLP TD R WRL  DE+G E WEY+  ++ +  P +T  QWLL  P FP P+PE
Sbjct: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61

Query: 64  RNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQIPEH 123
            +     F+A +A +NGA F  LLQ+  SG FPC Y+GPMFMTIGYV   ++ G+ IPE 
Sbjct: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121

Query: 124 ERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRNTLL 183
           +R E++RY+VNTAHPVDGGWGLHS DKSTV GTALNYV+LRLLG+ ++H V  ++R TLL
Sbjct: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181

Query: 184 RLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYIPVS 243
           R+GGA+GSP+WGK+WLS LNLY+WEGVNPAPPE WLLPY  P HP RWWVHTRA+++P+S
Sbjct: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241

Query: 244 YLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANNFVV 303
           YL+ V++ C +TPLLEE+R EI+T+PF++I F+ +RN VCG+DLYYPH+  LN  N  +V
Sbjct: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301

Query: 304 FYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQAFKK 363
            YEKYLR  ++   S  ++Y+L++ EIQNTD LCIAPVN A  A+VT IEEG DS  F +
Sbjct: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361

Query: 364 FQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKFLCR 423
           F  RFK+ LF GPQGM +MGTNGVQ WDCAF IQ +F A L ++ EFY  IV AY+FLCR
Sbjct: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421

Query: 424 AQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNMISN 483
           +Q   +CVPGS+RD R GAW FSTKTQGY VSDCTAEA K++++V+NSPVF EV + IS+
Sbjct: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481

Query: 484 ERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECTDS 543
           E+L + ID LL LQN+GSF+YGSFA+YEKI+APL++E+LN AEVF NIMVE+PYVECTDS
Sbjct: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541

Query: 544 SVLGLTYFHKYFDYXXXXXXXXXXXXXXXXXXSQLPNGSWYGSWGICFTYAGMFALEALH 603
           SVLGL+++ KY DY                  +Q  +GSWYG WGIC+TYAGMFALEALH
Sbjct: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601

Query: 604 TVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLIALL 663
             GE+Y +S  V+KGC+FLVSKQ+ DGGW E+MKSSELH+YV  ++S VVQTAW LI LL
Sbjct: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661

Query: 664 FAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGMYS 723
            A+YP + VIDRGI+LLK RQ  SGEWK+E +EGVFNHSCAIEYPSYRF+FPIKALG+YS
Sbjct: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721

Query: 724 KAYEQHAL 731
           K Y + AL
Sbjct: 722 KKYAKDAL 729

>NCAS0A11600 Chr1 (2302437..2303684) [1248 bp, 415 aa] {ON}
           Anc_3.451 YPR118W
          Length = 415

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 10/88 (11%)

Query: 306 EKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAP------VNQAFCALVTLIEEGVDSQ 359
           E + RN++ Y LS    Y  V+  +Q      ++       ++ A   + TL+EE  D +
Sbjct: 74  EAFTRNQWYYDLSD---YTSVKSRLQERLKFLLSSRPTAVNLSNALVVITTLLEESTDLK 130

Query: 360 AFKKFQYRFKDALFHGPQGMTI-MGTNG 386
            F    ++F  AL        I MG NG
Sbjct: 131 GFSLAVFKFVTALIEEDLANNIKMGANG 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,356,492
Number of extensions: 3400507
Number of successful extensions: 7210
Number of sequences better than 10.0: 22
Number of HSP's gapped: 7295
Number of HSP's successfully gapped: 22
Length of query: 731
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 614
Effective length of database: 40,065,477
Effective search space: 24600202878
Effective search space used: 24600202878
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)