Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_7.203.564ON1004100448030.0
YGL241W (KAP114)3.564ON1004100439100.0
Skud_7.263.564ON1015100637670.0
Suva_7.203.564ON1008100835060.0
NCAS0F039503.564ON1012102225040.0
NDAI0B062603.564ON1013102024460.0
ZYRO0E09460g3.564ON1009100421600.0
KAFR0J001903.564ON1012103421510.0
KNAG0D029403.564ON1009102021380.0
TDEL0D063203.564ON1018101921160.0
Kpol_380.63.564ON1002100820700.0
CAGL0H07777g3.564ON1021102120490.0
TPHA0G036303.564ON1022102619750.0
SAKL0F00880g3.564ON1009102119640.0
TBLA0E002403.564ON1010102319540.0
Ecym_25943.564ON1019101218430.0
AFR269W3.564ON1017101017030.0
Kwal_47.192583.564ON1011101716990.0
KLTH0G00792g3.564ON1021101016560.0
KLLA0A00803g3.564ON9529147954e-90
NDAI0E021708.624ON10291291085e-04
KAFR0H027008.624ON10411471067e-04
KNAG0J014208.624ON10531261040.001
TPHA0H010105.111ON10721261030.002
NCAS0C014308.624ON10291401010.003
TDEL0A057008.624ON10311381000.004
Kpol_1050.495.111ON108394970.008
SAKL0G15180g5.111ON1084165950.016
Suva_7.5135.111ON1084202950.017
Skud_7.5555.111ON1084202940.021
TPHA0A049705.111ON1085130940.023
KLLA0E16061g5.111ON1086132930.026
SAKL0H07876g8.624ON1032141920.031
Kwal_26.85958.624ON1034152920.036
TDEL0G013605.111ON1089165910.042
YGR218W (CRM1)5.111ON1084130910.046
Ecym_20685.111ON1082132910.048
Kwal_27.98705.111ON1084165910.049
ADL128C5.111ON1082132900.056
SAKL0B04312g4.180ON861128890.071
Ecym_25903.561ON955236890.077
CAGL0G01144g4.180ON861128880.094
Smik_16.865.111ON1084130880.100
KLTH0D10010g8.624ON1034123880.10
KLTH0G17600g4.180ON864138870.12
KLLA0B05665g4.180ON861137870.12
Smik_6.3248.624ON1032136870.13
TBLA0G013504.180ON865150870.13
CAGL0B02189g5.111ON1087140870.14
ACR159C8.624ON1025158870.14
NCAS0A035304.180ON860125860.16
Skud_16.1558.624ON1032136860.18
NCAS0A074505.111ON1084163850.22
KLTH0C02024g5.111ON1084168850.23
CAGL0J06776g8.624ON1027147840.27
TBLA0J004708.624ON1036124830.36
YPL125W (KAP120)8.624ON1032113830.37
ZYRO0F06160g8.624ON1029144830.38
Suva_16.1858.624ON1032129810.68
ACL187W4.180ON861137800.85
Kpol_460.183.561ON956179791.0
Kpol_530.128.624ON1030124791.1
TDEL0D027004.180ON862137791.2
Kwal_27.12100singletonOFF108470781.4
Kwal_YGOB_27.120978.555ON154670781.6
ZYRO0A12672g4.180ON860148772.1
KAFR0B041705.111ON108494772.1
ZYRO0B15466g5.111ON1089140762.4
Ecym_83098.624ON1027122762.5
CAGL0G03443g7.408ON1113100762.6
KNAG0M013305.143ON612119762.6
CAGL0I01782g5.111ON105188762.8
KNAG0A016605.111ON108494753.1
NDAI0D024205.111ON1084140744.2
KAFR0A063504.180ON861127735.4
Smik_7.223.561ON960122736.0
Skud_7.283.561ON960122726.9
KLLA0D06633g8.624ON1023129726.9
TPHA0I002508.840ON62990727.0
TBLA0B074905.111ON1091126727.3
Kwal_55.204793.452ON48951719.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_7.20
         (1004 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (R...  1854   0.0  
YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}  KAP114Karyo...  1510   0.0  
Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (R...  1455   0.0  
Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (R...  1355   0.0  
NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {...   969   0.0  
NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa]...   946   0.0  
ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...   836   0.0  
KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.5...   833   0.0  
KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {...   828   0.0  
TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa]...   819   0.0  
Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON} ...   801   0.0  
CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} simil...   793   0.0  
TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {...   765   0.0  
SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar...   761   0.0  
TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.56...   757   0.0  
Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {...   714   0.0  
AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic h...   660   0.0  
Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa...   659   0.0  
KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar...   642   0.0  
KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar ...   310   4e-90
NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {...    46   5e-04
KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8....    45   7e-04
KNAG0J01420 Chr10 complement(260385..263546) [3162 bp, 1053 aa] ...    45   0.001
TPHA0H01010 Chr8 (213903..217121) [3219 bp, 1072 aa] {ON} Anc_5....    44   0.002
NCAS0C01430 Chr3 complement(262823..265912) [3090 bp, 1029 aa] {...    44   0.003
TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]...    43   0.004
Kpol_1050.49 s1050 (111270..114521) [3252 bp, 1083 aa] {ON} (111...    42   0.008
SAKL0G15180g Chr7 (1306761..1310015) [3255 bp, 1084 aa] {ON} hig...    41   0.016
Suva_7.513 Chr7 (888432..891683) [3252 bp, 1084 aa] {ON} YGR218W...    41   0.017
Skud_7.555 Chr7 (907277..910531) [3255 bp, 1084 aa] {ON} YGR218W...    41   0.021
TPHA0A04970 Chr1 (1123879..1127136) [3258 bp, 1085 aa] {ON} Anc_...    41   0.023
KLLA0E16061g Chr5 complement(1428731..1431991) [3261 bp, 1086 aa...    40   0.026
SAKL0H07876g Chr8 (674192..677290) [3099 bp, 1032 aa] {ON} highl...    40   0.031
Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {...    40   0.036
TDEL0G01360 Chr7 complement(270498..273767) [3270 bp, 1089 aa] {...    40   0.042
YGR218W Chr7 (932541..935795) [3255 bp, 1084 aa] {ON}  CRM1Major...    40   0.046
Ecym_2068 Chr2 (114936..118184) [3249 bp, 1082 aa] {ON} similar ...    40   0.048
Kwal_27.9870 s27 complement(93662..96916) [3255 bp, 1084 aa] {ON...    40   0.049
ADL128C Chr4 complement(464142..467390) [3249 bp, 1082 aa] {ON} ...    39   0.056
SAKL0B04312g Chr2 complement(385051..387636) [2586 bp, 861 aa] {...    39   0.071
Ecym_2590 Chr2 complement(1149034..1151901) [2868 bp, 955 aa] {O...    39   0.077
CAGL0G01144g Chr7 complement(108004..110589) [2586 bp, 861 aa] {...    39   0.094
Smik_16.86 Chr16 complement(160938..164192) [3255 bp, 1084 aa] {...    39   0.100
KLTH0D10010g Chr4 complement(830376..833480) [3105 bp, 1034 aa] ...    39   0.10 
KLTH0G17600g Chr7 (1523631..1526225) [2595 bp, 864 aa] {ON} high...    38   0.12 
KLLA0B05665g Chr2 (510167..512752) [2586 bp, 861 aa] {ON} highly...    38   0.12 
Smik_6.324 Chr6 complement(507726..510824) [3099 bp, 1032 aa] {O...    38   0.13 
TBLA0G01350 Chr7 complement(361561..364158) [2598 bp, 865 aa] {O...    38   0.13 
CAGL0B02189g Chr2 complement(202354..205617) [3264 bp, 1087 aa] ...    38   0.14 
ACR159C Chr3 complement(631643..634720) [3078 bp, 1025 aa] {ON} ...    38   0.14 
NCAS0A03530 Chr1 complement(698730..701312) [2583 bp, 860 aa] {O...    38   0.16 
Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL12...    38   0.18 
NCAS0A07450 Chr1 (1477489..1480743) [3255 bp, 1084 aa] {ON} Anc_...    37   0.22 
KLTH0C02024g Chr3 complement(176824..180078) [3255 bp, 1084 aa] ...    37   0.23 
CAGL0J06776g Chr10 (651309..654392) [3084 bp, 1027 aa] {ON} high...    37   0.27 
TBLA0J00470 Chr10 (85713..88823) [3111 bp, 1036 aa] {ON} Anc_8.6...    37   0.36 
YPL125W Chr16 (313388..316486) [3099 bp, 1032 aa] {ON}  KAP120Ka...    37   0.37 
ZYRO0F06160g Chr6 complement(509916..513005) [3090 bp, 1029 aa] ...    37   0.38 
Suva_16.185 Chr16 (322908..326006) [3099 bp, 1032 aa] {ON} YPL12...    36   0.68 
ACL187W Chr3 (30322..32907) [2586 bp, 861 aa] {ON} Syntenic homo...    35   0.85 
Kpol_460.18 s460 complement(33770..36640) [2871 bp, 956 aa] {ON}...    35   1.0  
Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON} (33954.....    35   1.1  
TDEL0D02700 Chr4 (511059..513647) [2589 bp, 862 aa] {ON} Anc_4.1...    35   1.2  
Kwal_27.12100 s27 (1084460..1087714) [3255 bp, 1084 aa] {OFF} YP...    35   1.4  
Kwal_YGOB_27.12097 s27 (1082859..1083947,1084163..1087714) [4641...    35   1.6  
ZYRO0A12672g Chr1 complement(1006921..1009503) [2583 bp, 860 aa]...    34   2.1  
KAFR0B04170 Chr2 (866794..870048) [3255 bp, 1084 aa] {ON} Anc_5....    34   2.1  
ZYRO0B15466g Chr2 complement(1256964..1260233) [3270 bp, 1089 aa...    34   2.4  
Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON...    34   2.5  
CAGL0G03443g Chr7 complement(331868..335209) [3342 bp, 1113 aa] ...    34   2.6  
KNAG0M01330 Chr13 (239645..241483) [1839 bp, 612 aa] {ON} Anc_5....    34   2.6  
CAGL0I01782g Chr9 (146481..149636) [3156 bp, 1051 aa] {ON} weakl...    34   2.8  
KNAG0A01660 Chr1 complement(92179..95433) [3255 bp, 1084 aa] {ON...    33   3.1  
NDAI0D02420 Chr4 (560987..564241) [3255 bp, 1084 aa] {ON} Anc_5....    33   4.2  
KAFR0A06350 Chr1 (1280152..1282737) [2586 bp, 861 aa] {ON} Anc_4...    33   5.4  
Smik_7.22 Chr7 (44367..47249) [2883 bp, 960 aa] {ON} YGL238W (REAL)    33   6.0  
Skud_7.28 Chr7 (53753..56635) [2883 bp, 960 aa] {ON} YGL238W (REAL)    32   6.9  
KLLA0D06633g Chr4 complement(568539..571610) [3072 bp, 1023 aa] ...    32   6.9  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    32   7.0  
TBLA0B07490 Chr2 complement(1779793..1783068) [3276 bp, 1091 aa]...    32   7.3  
Kwal_55.20479 s55 complement(422679..424148) [1470 bp, 489 aa] {...    32   9.9  

>Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (REAL)
          Length = 1004

 Score = 1854 bits (4803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 927/1004 (92%), Positives = 927/1004 (92%)

Query: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60
            MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS
Sbjct: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60

Query: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120
            LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA
Sbjct: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120

Query: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180
            VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL
Sbjct: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180

Query: 181  ATDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240
            ATDTSTLV              QMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS
Sbjct: 181  ATDTSTLVAKFAALKLFKACLLQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240

Query: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEY 300
            ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEY
Sbjct: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEY 300

Query: 301  ESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFV 360
            ESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFV
Sbjct: 301  ESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFV 360

Query: 361  SKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISKDIERNTYDNQIXXXXXXXXXXXX 420
            SKETGLAASYNVRDQSSE               VISKDIERNTYDNQI            
Sbjct: 361  SKETGLAASYNVRDQSSEFLISLSNPLLSLIFSVISKDIERNTYDNQILESLLYLLQSVL 420

Query: 421  XNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDIKSL 480
             NDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDIKSL
Sbjct: 421  LNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDIKSL 480

Query: 481  TSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQIINDI 540
            TSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQIINDI
Sbjct: 481  TSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQIINDI 540

Query: 541  NSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQSQE 600
            NSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQSQE
Sbjct: 541  NSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQSQE 600

Query: 601  CLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKKPID 660
            CLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKKPID
Sbjct: 601  CLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKKPID 660

Query: 661  GFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKVLER 720
            GFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKVLER
Sbjct: 661  GFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKVLER 720

Query: 721  LLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLLSVL 780
            LLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLLSVL
Sbjct: 721  LLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLLSVL 780

Query: 781  CFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRGEKRIKENIVALSNLFFLD 840
            CFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRGEKRIKENIVALSNLFFLD
Sbjct: 781  CFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRGEKRIKENIVALSNLFFLD 840

Query: 841  DARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQNKQPDP 900
            DARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQNKQPDP
Sbjct: 841  DARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQNKQPDP 900

Query: 901  KQLITSNMQHXXXXXXXXXXXXXXXXXXXXXXYEKLKEYINXXXXXXXXXXXXXITGLMD 960
            KQLITSNMQH                      YEKLKEYIN             ITGLMD
Sbjct: 901  KQLITSNMQHDAANLNNDEDNDDWEDVDDVLDYEKLKEYINDDVDGEDEDDSEDITGLMD 960

Query: 961  VKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004
            VKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL
Sbjct: 961  VKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004

>YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}
            KAP114Karyopherin, responsible for nuclear import of
            specific proteins; cargoes include Spt15p, Sua7p,
            histones H2A and H2B, and Nap1p; amino terminus shows
            similarity to those of other importins, particularly
            Cse1p; localization is primarily nuclear; function is
            regulated by sumoylation
          Length = 1004

 Score = 1510 bits (3910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 749/1004 (74%), Positives = 845/1004 (84%)

Query: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60
            M+I+EL+  AQSADK TRE AETQLLQWCDS+ASQ+F ALANVALQH++ LESRQFALLS
Sbjct: 1    MDINELIIGAQSADKHTREVAETQLLQWCDSDASQVFKALANVALQHEASLESRQFALLS 60

Query: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120
            LRKLITMYWSPGFESYRSTS VE++VKDFIREVLLKLCLNDNENTKI NGASYCIVQISA
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCIVQISA 120

Query: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180
            VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGL T++I+FKVL
Sbjct: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEIVFKVL 180

Query: 181  ATDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240
             T+TSTL+              QMSSHN YDE SRKSF+SQCL+TSLQ LGQLLT+ F +
Sbjct: 181  NTETSTLIAKIAALKLLKACLLQMSSHNEYDEASRKSFVSQCLATSLQILGQLLTLNFGN 240

Query: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEY 300
             +V+SQLK KSIIYENLV IKNDFS+ HFS +LQKQFKI+ +QDL N+ H++ N  + E 
Sbjct: 241  VDVISQLKFKSIIYENLVFIKNDFSRKHFSSELQKQFKIMAIQDLENVTHINANVETTES 300

Query: 301  ESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFV 360
            E + E VHD SIYIVEFLTSVCT+ F  EE++ II SLT LCQ++SE  E+W SDFNTFV
Sbjct: 301  EPLLETVHDCSIYIVEFLTSVCTLQFSVEEMNKIITSLTILCQLSSETREIWTSDFNTFV 360

Query: 361  SKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISKDIERNTYDNQIXXXXXXXXXXXX 420
            SKETGLAASYNVRDQ++E               V+S DIE +T +               
Sbjct: 361  SKETGLAASYNVRDQANEFFTSLPNPQLSLIFKVVSNDIEHSTCNYSTLESLLYLLQCIL 420

Query: 421  XNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDIKSL 480
             NDDEIT +N+D+SLQ LIKT +N+LVS E+ EL LARAIL IP+VLDKFID LPDIK L
Sbjct: 421  LNDDEITGENIDQSLQILIKTLENILVSQEIPELILARAILTIPRVLDKFIDALPDIKPL 480

Query: 481  TSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQIINDI 540
            TS FL KSL+LALK D ELIKSA LIAFTYYCYFAELDSVLGP+VCSE Q KVI+IIN +
Sbjct: 481  TSAFLAKSLNLALKSDKELIKSATLIAFTYYCYFAELDSVLGPEVCSETQEKVIRIINQV 540

Query: 541  NSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQSQE 600
            +SD+EEDTNGA+MEVLSQVISYNPK   S++EILQAEFHLVFTISS+DPANVQVVVQSQE
Sbjct: 541  SSDAEEDTNGALMEVLSQVISYNPKEPHSRKEILQAEFHLVFTISSEDPANVQVVVQSQE 600

Query: 601  CLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKKPID 660
            CLEKLLD INMDNYKNYIELCLPSFINVLDSN+ NNYRYSPLLSLVLEFITVFLKKKP D
Sbjct: 601  CLEKLLDNINMDNYKNYIELCLPSFINVLDSNNANNYRYSPLLSLVLEFITVFLKKKPND 660

Query: 661  GFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKVLER 720
            GFLPDEI QYLFEPLAKVL +S+E+ETLQLATE+FSYLIFNTDT+ MEPRLMDIMKVLER
Sbjct: 661  GFLPDEINQYLFEPLAKVLAFSTEDETLQLATEAFSYLIFNTDTRAMEPRLMDIMKVLER 720

Query: 721  LLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLLSVL 780
            LLSLEVSDSAAMNVGPLVV IFT+FSK+IQPL+GRILEAV+VRL+K QNIST+QNLLSVL
Sbjct: 721  LLSLEVSDSAAMNVGPLVVAIFTRFSKEIQPLIGRILEAVVVRLIKTQNISTEQNLLSVL 780

Query: 781  CFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRGEKRIKENIVALSNLFFLD 840
            CFLTCND +QTV+FLS+F+ID+ +AL+LVM+KW+EAFEVIRGEKRIKENIVALSNLFFL+
Sbjct: 781  CFLTCNDPKQTVDFLSSFQIDNTDALTLVMRKWIEAFEVIRGEKRIKENIVALSNLFFLN 840

Query: 841  DARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQNKQPDP 900
            D RL+KV+VNG+LIPYE D+IITRSMAK+MPDRYVQVPLYTKIIKLFVSEL FQ+KQP+P
Sbjct: 841  DKRLQKVVVNGNLIPYEGDLIITRSMAKKMPDRYVQVPLYTKIIKLFVSELSFQSKQPNP 900

Query: 901  KQLITSNMQHXXXXXXXXXXXXXXXXXXXXXXYEKLKEYINXXXXXXXXXXXXXITGLMD 960
            +QLITS+++                       Y+KLKEYI+             ITGLMD
Sbjct: 901  EQLITSDIKQEVVNANKDDDNDDWEDVDDVLDYDKLKEYIDDDVDEEADDDSDDITGLMD 960

Query: 961  VKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004
            VKESVVQ+LVRFFKEVA+KDVSGF+ IYETLSDS+RKVLSEALL
Sbjct: 961  VKESVVQLLVRFFKEVASKDVSGFHCIYETLSDSERKVLSEALL 1004

>Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (REAL)
          Length = 1015

 Score = 1455 bits (3767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 727/1006 (72%), Positives = 829/1006 (82%), Gaps = 3/1006 (0%)

Query: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60
            M+I++L+ +AQSAD  TRE AE QLLQWCDS+ASQMFTAL N ALQ QS L+SRQFALLS
Sbjct: 11   MDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTALVNAALQQQSALQSRQFALLS 70

Query: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120
            LRKLITMYWSPGFESYRSTS V+V VK+FIRE LLKLCLNDNENT+I NGASYCIVQISA
Sbjct: 71   LRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISA 130

Query: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180
            VDFPDQWPQLL+VIYD IS QHSLNAM LLNEIYDDVVSEEMFFEGGIGLET +IIFKVL
Sbjct: 131  VDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVL 190

Query: 181  ATDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240
              +TS+LV              QMSSHNG+ EESRK F+SQC+STSLQRLGQLLT+ F +
Sbjct: 191  VAETSSLVAKIAALKLLKACLLQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDN 250

Query: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTN--GNSI 298
            E+V+SQLKLKSIIYENLV IKNDFSK HF+  LQ  FK+V ++DL NI+ +DTN  G+  
Sbjct: 251  EDVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDYP 310

Query: 299  EYESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNT 358
            E E+  + VHD S+YIVEFLTSVCT+ F  EE+ +II +LTTLC+V S+  ELWISDFN 
Sbjct: 311  ESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDFNE 370

Query: 359  FVSKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISKDIERNTYDNQIXXXXXXXXXX 418
            FVSKETGLAASYN+RDQ+ E               V+SK+I+ NT ++Q           
Sbjct: 371  FVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDLNTSNHQTFESLLYLLQC 430

Query: 419  XXXNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDIK 478
               NDDEI+ QN+++SLQ L+   QN L S E+ ELTLAR ILVIPK+LDKFIDVLPDIK
Sbjct: 431  ILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDVLPDIK 490

Query: 479  SLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQIIN 538
            S+TS+FL KSLDLALK D ELIKSAALIAF YYCYFAELDSVLGP +C+E+Q KVIQIIN
Sbjct: 491  SVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKVIQIIN 550

Query: 539  DINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQS 598
            +I++D+EEDTNG IMEVL+QVISYN KG  SK+E+LQAE HLVFTISSKDPANVQVVVQS
Sbjct: 551  EISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVVVQS 610

Query: 599  QECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKKP 658
            QECLEKLLD+INMDNYKNYIELCLPSFINVL++N  NNY+YSPLLSLVLEFI VFLKK+P
Sbjct: 611  QECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLKKRP 670

Query: 659  IDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKVL 718
             DG+LPDEI QYLFEPLAKVLVYS+E+ETLQLATE+FSYLIFNTDTQ M+ RLMDIMK+L
Sbjct: 671  NDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMDIMKIL 730

Query: 719  ERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLLS 778
            ERLLSLEVSDSAAMNVG LVV IFT+FSK++QPLVGRIL+AV+VRLVKAQNISTQQNLLS
Sbjct: 731  ERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNLLS 790

Query: 779  VLCFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRGEKRIKENIVALSNLFF 838
            VLCFLTCND++QTV+FLS+FRIDDK ALSLVM KWMEAFEVIRGE++IKE+IVALS  FF
Sbjct: 791  VLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKIKESIVALSKFFF 850

Query: 839  LDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQNKQP 898
            L+D RL K+MVNGD+IPYE D+IITRSMAK+MPD+YVQVPLYTKIIKLF+SELGFQ KQ 
Sbjct: 851  LNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISELGFQAKQL 910

Query: 899  DPKQLITSNMQHXXXXXXXXXXXXXXXXXXXXXXYEKLKEYINXXXXXXXXXXXXXITGL 958
            DP+QL+ S++Q                       YEKLKEYI+             ITGL
Sbjct: 911  DPEQLVASSIQE-SANANNDDETGDWEDVDDVLDYEKLKEYIDDDVDGEEEDDRDDITGL 969

Query: 959  MDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004
             DVKESVVQILV FF+EVATK+VS F+ IYETLSDS+RK LSEALL
Sbjct: 970  TDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015

>Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (REAL)
          Length = 1008

 Score = 1355 bits (3506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1008 (69%), Positives = 809/1008 (80%), Gaps = 4/1008 (0%)

Query: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60
            M+I  L+T AQSAD  TREAAE QLLQWCDS+ASQ+FT+LA+VAL HQ+ L+SRQFALLS
Sbjct: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60

Query: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120
            LRKLITMYWSPGFESYRSTS V++NVK+ IRE LL LCLN NENTKI NGASYCIVQISA
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIREALLNLCLNANENTKIKNGASYCIVQISA 120

Query: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180
            VDFPDQWPQLLTVIYDAIS  HS+NAMSLLNEIYDDVVSEEMFFEGGIGLETV+IIFKVL
Sbjct: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180

Query: 181  ATDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240
             T+ S LV              QMSSH+ +++ESR +FI+QCLSTSLQ LGQLLT+   +
Sbjct: 181  TTEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCLSTSLQTLGQLLTLDLVN 240

Query: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEY 300
            E+V  Q K +SIIYENLV IKN+FSK HF  + Q QFK+V ++DL NIA ++ N    E 
Sbjct: 241  EDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTEN 300

Query: 301  ESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFV 360
            E   E V   S+YIVEFLT+VC++PF  EE+ +II+SLT LC+V+S+  +LWI DFN FV
Sbjct: 301  EDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYFV 360

Query: 361  SKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISKDIERNTYDNQIXXXXXXXXXXXX 420
            SKETGLAASYNVRDQ SE               ++S+DI +NT ++Q             
Sbjct: 361  SKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTSNHQTLESLLYLLQCIL 420

Query: 421  XNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDIKSL 480
             NDDEIT QN+ +S Q+LI+  ++ LVS E+ E+TLAR IL+IPKVLDKFIDVLPDIKSL
Sbjct: 421  LNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIKSL 480

Query: 481  TSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQIINDI 540
            TS FL  SLDLALK+  EL++SA LIAFTYYCYFAELDSVLGP+ C+E+Q  +IQIIN+I
Sbjct: 481  TSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVQQNIIQIINEI 540

Query: 541  NSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQSQE 600
            + D+EEDTNG IMEVL++VIS N KG    EE+LQAEFHLVF+ISSKDPANVQVVVQSQE
Sbjct: 541  SDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVVQSQE 600

Query: 601  CLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKKPID 660
            CLEKLLD I M NY +YIELCLPSFINVL++N  NNY+Y+PLLSLVLEFITVFLKKKP  
Sbjct: 601  CLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKPSS 660

Query: 661  GFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKVLER 720
             FLP EI Q+LFEPLAKVL YS+E+ETLQLATE+FSYLIFNTDTQVMEPRLMDIMKVLER
Sbjct: 661  EFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMKVLER 720

Query: 721  LLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLLSVL 780
            LLSLEVSDSAAMNVG LVVTIFT+FS +IQPLV RIL+AV++RLVKAQNISTQQNL SVL
Sbjct: 721  LLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFSVL 780

Query: 781  CFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRGEKRIKENIVALSNLFFLD 840
            CFLTCND +QTV+FL +F+ID+ +ALSLVM KWME+FEV+RGE+RIKENI+AL  LF LD
Sbjct: 781  CFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGERRIKENIIALIKLFLLD 840

Query: 841  DARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQNKQPDP 900
            DARL K+MVNGDLIPY+ D+IITRSMAK+MPD+YVQVPLYTKIIKLFVSELGFQNKQP+P
Sbjct: 841  DARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGFQNKQPNP 900

Query: 901  KQLITSNMQH----XXXXXXXXXXXXXXXXXXXXXXYEKLKEYINXXXXXXXXXXXXXIT 956
            +QLIT+++                            YEKLK+YI              IT
Sbjct: 901  EQLITTDIAKDAANNDNDDDNDADNDDWEDVDDVLDYEKLKDYIGDDVDGGEEDDSEDIT 960

Query: 957  GLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004
            GLMDVKESVVQILV FFKEVA+KDVSGF+RIYE+LS+++RKVLSEALL
Sbjct: 961  GLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008

>NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1012

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1022 (48%), Positives = 711/1022 (69%), Gaps = 28/1022 (2%)

Query: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60
            M+I +L+T+AQS+D  TREAAE QL   CD NASQ+FT+L +VAL  +SPL +RQF+LL+
Sbjct: 1    MDIYQLITQAQSSDTQTREAAENQLSSSCDQNASQIFTSLMSVALDPKSPLSTRQFSLLT 60

Query: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120
            +RK ITMYWSPGF+SYR+TS ++ N K++IR  LL+LCL+D ++TKI N ASYCIVQISA
Sbjct: 61   IRKFITMYWSPGFQSYRNTSTIQENTKEYIRNSLLQLCLDDAQDTKIKNSASYCIVQISA 120

Query: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180
            VDFPDQWPQLL+ IY AI   HSLNA+SLLNEIYDDV+SEEMFFEG IG+ET+QIIF++L
Sbjct: 121  VDFPDQWPQLLSTIYMAIEQNHSLNALSLLNEIYDDVISEEMFFEGQIGMETLQIIFQLL 180

Query: 181  ATDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240
              + + L               QMS  +   + +RK F+ +C+  +L+ LGQLL + +  
Sbjct: 181  TNNNANLKAKIAGTKLFNACLLQMSVVDSSSKHNRKEFVKECIFKALEVLGQLLEL-YPV 239

Query: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIA--------HLD 292
             N    L L++ IYEN+VLI N+FS+  F+   +  +K+ + +DL   +        +L 
Sbjct: 240  SNDSLILNLRTKIYENVVLISNEFSRKLFTQAFKGLYKLQSFRDLEACSNQFNAFLENLS 299

Query: 293  TNGNSIEYESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELW 352
               N I  ES++E V    I++++FLTS+    F  +E+++I++SLT LC ++S+ +E W
Sbjct: 300  QADNDI-LESMNECV----IHVLDFLTSISDSDFTMQEINLIVQSLTFLCCLDSDTLEQW 354

Query: 353  ISDFNTFVSKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISKDI----ERNTYDNQI 408
              DFN FVSKETGL AS+ +RDQ++E                I   +      +  DN  
Sbjct: 355  SEDFNDFVSKETGLLASFTIRDQAAEFMSGLSNPNYSNFFNSIYAQVIYSLTGDVNDNLR 414

Query: 409  XXXXXXXXXXXXXNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLD 468
                          +D   D N++ S+  ++K F +V  +   K   L+R IL+ PK+L+
Sbjct: 415  ESLLYLLQTLLTNEEDNDHDINIEPSV--ILKQFSSVFENGLQKTFLLSRIILLTPKLLE 472

Query: 469  KFIDVLPDIKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSE 528
            KF+D L D+K LT  +L ++LDLAL+  NE+IKS+++IAFTYY YFAEL SVLGP++CS 
Sbjct: 473  KFMDQLQDVKQLTGNYLRRTLDLALETHNEIIKSSSIIAFTYYSYFAELPSVLGPELCSI 532

Query: 529  IQGKVIQIINDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKD 588
            +Q   ++II++++ ++EEDTNG +ME L+Q+IS N    +   EILQ EF+LV +ISSKD
Sbjct: 533  VQENTLKIISELSKEAEEDTNGLLMETLNQIISCNVHE-NLSPEILQTEFNLVLSISSKD 591

Query: 589  PANVQVVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLE 648
            PANVQV V++Q+CLE LL+ +N + Y +Y+++CLPSFI+ +D++++N YRY+P+LSL+LE
Sbjct: 592  PANVQVTVEAQDCLEHLLEGMNTETYLHYVDICLPSFIHTIDASAINQYRYTPVLSLILE 651

Query: 649  FITVFLKKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVME 708
            F+T+F+KKKP+DGFLP  I+ + F+ L  +L  S+E+ETLQLAT++FSY+++NT+   M 
Sbjct: 652  FLTIFMKKKPVDGFLPTSISDFSFKSLCNLLSLSTEDETLQLATDAFSYMVYNTEPSAMV 711

Query: 709  PRLMDIMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQ 768
            P+L DI+ VL+RLLS+ VSD+AAMNVG LVVT+F+KFS +IQPL+  IL A + RL++AQ
Sbjct: 712  PKLQDIINVLDRLLSINVSDTAAMNVGTLVVTLFSKFSNEIQPLIPTILRAAVGRLIQAQ 771

Query: 769  NISTQQNLLSVLCFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRGEKRIKE 828
            NISTQQNL+S+LCFLTC+D +Q ++ L NF   D +  + VM KW E+FE IRGEK+IKE
Sbjct: 772  NISTQQNLVSLLCFLTCSDPKQVIDLLYNFD-SDHSTFTKVMNKWFESFETIRGEKKIKE 830

Query: 829  NIVALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFV 888
            NIVALS L+F  D RL K++VNGDLIPY+ D+IITRSMAK+MPD+Y Q+P +TKI+KLF 
Sbjct: 831  NIVALSKLYFTGDERLGKLIVNGDLIPYDGDLIITRSMAKKMPDKYTQIPAFTKIVKLFT 890

Query: 889  SELGFQNKQPDPKQLITSNMQHXXXXXXXXXXXXXXXXXXXXXX-----YEKLKEYINXX 943
            +ELGFQNKQPD K L+ S++++                           YEKL+E+++  
Sbjct: 891  TELGFQNKQPDSKILLESDIKNVDTSNNKTSEEAAGDDDEWEDVDDVLDYEKLREFVDDE 950

Query: 944  XXXX-XXXXXXXITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEA 1002
                        ITGL  +KE++ ++LV FFK+VA +D++GF+ IY TLS++++++L+E 
Sbjct: 951  DPADFGENDSDEITGLDTLKETIPELLVEFFKDVAARDLNGFHNIYNTLSENEKRILTEN 1010

Query: 1003 LL 1004
            L+
Sbjct: 1011 LV 1012

>NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1013

 Score =  946 bits (2446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1020 (48%), Positives = 695/1020 (68%), Gaps = 23/1020 (2%)

Query: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60
            M+I++L+ +AQS+D   R+AAE+QLLQ CD+NA+Q+FT+L   A    + + SRQFALLS
Sbjct: 1    MDINQLIVQAQSSDNAVRDAAESQLLQACDTNAAQIFTSLMKGACDGNTDIASRQFALLS 60

Query: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120
            LRKLITMYWSPGFESYR+TS +    K++IRE LL +CL+D +++KI   A+YC+VQISA
Sbjct: 61   LRKLITMYWSPGFESYRNTSTINDQTKEYIRESLLNICLDDLQDSKITKSAAYCVVQISA 120

Query: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180
            VDFPDQWPQLL ++YD IS  HSLNAMSLLNEIYDDVVSEEMFFEG IG+ET+QIIF+VL
Sbjct: 121  VDFPDQWPQLLVILYDTISQSHSLNAMSLLNEIYDDVVSEEMFFEGQIGMETLQIIFQVL 180

Query: 181  ATDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLT----- 235
            + +   +               QMS  +      RK    +C+  S+Q LGQLL      
Sbjct: 181  SNNEGKIEAKIAATKLFNACILQMSVLDPSSSLKRKKLAEECIPKSIQVLGQLLEYYTID 240

Query: 236  MGFHSENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLD--- 292
                S+ + S L+L+S IYEN+VLIKN+  K  F  +L   FK  T++DL++   L    
Sbjct: 241  TTVDSKMLTSILELRSKIYENVVLIKNELPKRLFQRNLMASFKFQTLKDLSSSCTLYETY 300

Query: 293  --TNGNSIEYESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIME 350
               N   +  +++ +A+ + SI++++FLT+ C++ F + EV  I++ LT LC ++++  E
Sbjct: 301  CLNNIEVVNSDNLHDALSECSIHMLDFLTATCSLKFDNSEVSTIVQDLTVLCCLDNDSQE 360

Query: 351  LWISDFNTFVSKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISKD----IERNTYDN 406
               +DFN FVSKETGL  SY +RDQ+SE                I       + + + ++
Sbjct: 361  ELAADFNAFVSKETGLLPSYTIRDQASEFLNSLSDPNYATILQAIINTFISTMNQPSRND 420

Query: 407  QIXXXXXXXXXXXXXNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKV 466
            +I             N+D++T+ N +  L+ L   F     +P +     +R IL+IPK+
Sbjct: 421  RILESILYLLQSLMTNEDDVTNINPNILLEPLSSLFDYETENPFLH----SRLILLIPKI 476

Query: 467  LDKFIDVLPDIKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVC 526
            L+KF+D +P++K +T  FLTKSL  +L+ ++ L K +ALI +TYY YFAEL SVLG DVC
Sbjct: 477  LEKFMDEIPNVKVVTKDFLTKSLKYSLQMNDGLNKISALIGYTYYAYFAELPSVLGRDVC 536

Query: 527  SEIQGKVIQIINDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISS 586
            +++Q  ++ +I  +  +SEEDT+G ++EVL+ VI  NP+ + + + IL+ EF++V +ISS
Sbjct: 537  TQVQENILLLITQVVHESEEDTHGLLVEVLNHVIDCNPEDI-AVQGILETEFYMVLSISS 595

Query: 587  KDPANVQVVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLV 646
            KDPAN+QV + S+ECLEKLL+ +N   Y +YI++CLPSFINV+  +SV  Y+YSPLLSL+
Sbjct: 596  KDPANIQVAIGSEECLEKLLEGVNTRTYTHYIDMCLPSFINVIKGHSVTEYKYSPLLSLI 655

Query: 647  LEFITVFLKKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQV 706
            LEF+TVF+KKKP DG LP  I +++F+PL  VL +S+E+ETLQLAT++FSYL++NTD+ +
Sbjct: 656  LEFVTVFMKKKPTDGPLPAIIFEHIFQPLLNVLNHSTEDETLQLATDAFSYLLYNTDSTL 715

Query: 707  MEPRLMDIMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVK 766
            M P L +I+ VL+RLLS+ VSD+AAMNVG L+VTIF+KFS ++Q L+  IL A + +LV+
Sbjct: 716  MIPHLEEIVAVLDRLLSINVSDTAAMNVGTLIVTIFSKFSNELQSLIPTILRAAVTKLVQ 775

Query: 767  AQNISTQQNLLSVLCFLTCNDSRQTVEFLSNFRIDDKNA-LSLVMQKWMEAFEVIRGEKR 825
            A+NISTQQNL+S+LCFLTC D  QT+EFL  + +D+ ++  + VM KW EAFEVIRGEK+
Sbjct: 776  AKNISTQQNLISLLCFLTCTDPLQTIEFL--YGLDETHSTFAAVMNKWFEAFEVIRGEKK 833

Query: 826  IKENIVALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIK 885
            IKENI+ALS L+F  D RL  ++VNGDLIPYE D+IITRSMAK MPD+Y Q+P YTKIIK
Sbjct: 834  IKENILALSKLYFTCDPRLGSLLVNGDLIPYEGDLIITRSMAKTMPDKYTQIPAYTKIIK 893

Query: 886  LFVSELGFQNKQPDPKQLITSNMQHXXXXXXXXXXXXXXXXXXXXXXYEKLKEYINXXXX 945
            LFVSEL FQ +Q     ++ ++++                       Y+KLKEY++    
Sbjct: 894  LFVSELSFQTQQTGEPTVLNADLKGIEKEEEEVGDDDEWEDVDDVLDYDKLKEYVDDEDP 953

Query: 946  XX-XXXXXXXITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004
                      ITGL DVKE+V ++L+ FFKEV +KD + F+ IY TLSD+ +K+LSE LL
Sbjct: 954  AEFGEDDKDEITGLADVKETVTELLLEFFKEVTSKDTNNFHAIYNTLSDNGKKILSENLL 1013

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] {ON}
            similar to uniprot|P53067 Saccharomyces cerevisiae
            YGL241W
          Length = 1009

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1004 (44%), Positives = 629/1004 (62%), Gaps = 6/1004 (0%)

Query: 6    LVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLI 65
            L+  AQS     R+++E +LLQ CD ++SQ+F     VA   Q  L SRQFALL+LRKL+
Sbjct: 7    LILEAQSPLDNVRKSSEERLLQMCDEDSSQVFVQFVQVAADTQQELPSRQFALLTLRKLV 66

Query: 66   TMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPD 125
            TMYW+PGFES+R TS V++  +  IR+VLL+LCL++++ +KI NGASY +VQISAVDFPD
Sbjct: 67   TMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAVDFPD 126

Query: 126  QWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVLATDTS 185
            QWP+LL ++Y+AI   HSL AM LLNEIYDDV+SEEMFFE GIG ET++I+F V+ +  +
Sbjct: 127  QWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISEEMFFEEGIGFETLKIVFHVMNSYDA 186

Query: 186  TLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHSENVVS 245
                             QMS+ NG     RK    +     LQ     LT    + +   
Sbjct: 187  NWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTISETL 246

Query: 246  QLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEYESISE 305
            QL   + IY+ L L+KN+FSK   + D+  QF+ + ++DL N + +         +   +
Sbjct: 247  QLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQDQLD 306

Query: 306  AVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFVSKETG 365
            A+++ ++ I+EFL+S+C V F  EE+  ++R L+ LC +N + ++ W +DFN+FVSKETG
Sbjct: 307  AINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVSKETG 366

Query: 366  LAASYNVRDQSSEXXXXXXXXXXXXXXXVISKDIER-NTYDNQIXXXXXXXXXXXXXNDD 424
            L AS+ +RDQ++E               ++  +I + + + +                 +
Sbjct: 367  LVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFNESLLYLLQSLLLN 426

Query: 425  EITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDIKSLTSKF 484
            E       +++  +    Q++L           R IL+IPK+L+K +D  P+++ L   F
Sbjct: 427  EANSLEFMDAVTRIFTKLQSILEKSLSCVFVNCRIILLIPKLLEKIMDSFPNVRDLVQNF 486

Query: 485  LTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQIINDINSDS 544
            L  SLD AL  DNELIKSA LI+FTYY YFAEL SVLGPD C ++Q K +++I  +  ++
Sbjct: 487  LFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIAQLYPEA 546

Query: 545  EEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQSQECLEK 604
            E+DT+G +MEVL  VI  N + +D    I+Q EFHLVFTISSKDP+N+Q  ++ QECL K
Sbjct: 547  EDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIELQECLGK 606

Query: 605  LLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKKPIDGFLP 664
            LL  +++  +  + E+C P  +NV+  ++ +++ YSPLLSL L+ + V +K+KP+D  L 
Sbjct: 607  LLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPLLSLTLQVLGVLMKRKPLDPTLS 666

Query: 665  DEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKVLERLLSL 724
              I   +FEPL  +L  S +EE LQ ATE+  YLI+NT+ +V+ P L  I+ +L+ LLS 
Sbjct: 667  ITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNILDALLSP 726

Query: 725  EVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLLSVLCFLT 784
             V D AA +VG L VTIF+KFS +IQ L+  IL+A   RL +A NI+T QNLLSV CF+T
Sbjct: 727  GVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLSVFCFVT 786

Query: 785  CNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRGEKRIKENIVALSNLFFLDDARL 844
              D++QTV+FL N  I ++N L+LVM KW+E+F+V+RGEKR KENI+ LS LFFL+D RL
Sbjct: 787  SADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFFLNDQRL 846

Query: 845  RKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQNKQPDPKQLI 904
              + VNGDLIPYESD+IITRSMAK MPDRY QV +Y KIIKLF SEL FQ K  DP+ L+
Sbjct: 847  NSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQDPQLLM 906

Query: 905  --TSNMQHXXXXXXXXXXXXXXXXXXXXXXYEKLKEYI--NXXXXXXXXXXXXXITGLMD 960
              T  ++                       YE+L+ Y+  +             +   +D
Sbjct: 907  AGTYGIETNTEENQDDDDNDDWEDVEGPLEYERLQHYVEEDETDDRGEELDEQCLADNLD 966

Query: 961  VKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004
             + SV Q+LV FFKEVA K++SGF  IYE LSD+++++LSE LL
Sbjct: 967  SR-SVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009

>KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.564
            YGL241W
          Length = 1012

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/1034 (44%), Positives = 664/1034 (64%), Gaps = 56/1034 (5%)

Query: 2    NIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSL 61
            +I +L+++AQS D   RE AE QLLQ CDSNAS +F AL +VA+ + + L +RQFALLSL
Sbjct: 4    DISQLISQAQSPDNSLREHAEQQLLQSCDSNASLIFQALTDVAINNSNKLAARQFALLSL 63

Query: 62   RKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAV 121
            RKLIT YWSPGFESYR+TS ++++ K  +R  L++L L+DN+++KI + ASYC+ QISAV
Sbjct: 64   RKLITFYWSPGFESYRNTSQIDLDTKSSLRNYLIQLALDDNQDSKIKSSASYCVTQISAV 123

Query: 122  DFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL- 180
            DFPDQWP+LL+++Y  I+  +SL+A+ LLNEIYDD+VSEEMFFEG IGLET+ I++++L 
Sbjct: 124  DFPDQWPELLSILYGCITQHYSLSAIKLLNEIYDDIVSEEMFFEGNIGLETLSIVYQLLE 183

Query: 181  ATDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240
            + D  ++               QM++ +    E RK  +S+ +  +L  L  +L M  H 
Sbjct: 184  SGDNVSIQARIALVDLLNATITQMTNVDSNLTEKRKQLLSESIPRALGLLSNILEMS-HR 242

Query: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDL----NNIAHLDTNGN 296
            +     L     IYE LVLIKN+  K  FS   +  +K +T+  L    N  A + T   
Sbjct: 243  DISTDSLTFIGKIYEILVLIKNELPKKFFSAQTRDAYKRITLNTLSLLQNKYASM-TEPA 301

Query: 297  SIEYESISEAVHDGSIYIVEFLTSVC-TVPFGSEEVDIIIRSLTTLCQVNSEIMELWISD 355
              E ES SE     +I+ +EFLTS+     F  EE  II+ SL  LC ++    E W++D
Sbjct: 302  ETELESFSEC----AIHTLEFLTSLSYNTNFTEEERTIILNSLLVLCSLDPVTKETWLAD 357

Query: 356  FNTFVSKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVI----------------SKDI 399
            FN FVSKETGL  SY +RDQS E                I                   +
Sbjct: 358  FNHFVSKETGLLPSYTIRDQSFEFLTSLIDQNFQLILKSIFQYFFTLISSSSPSVDPSQL 417

Query: 400  ERNTYDNQIXXXXXXXXXXXXXNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARA 459
            E   Y  Q              NDD+I + N +E + ++++   ++L +     L ++R 
Sbjct: 418  ETTFYLLQ----------SILSNDDDIENVN-NEEITSVLRVLPSLLTNVH-DSLMVSRI 465

Query: 460  ILVIPKVLDKFIDVLPDIKSLTSKFLTKSLDLALKHDNE-LIKSAALIAFTYYCYFAELD 518
            IL +PK+L+KF+D LPD+K++   FL +S +LAL+   + +IKS+ LI+FT YCYFAEL 
Sbjct: 466  ILALPKILEKFMDDLPDVKAMVQTFLVQSTELALRLSGDYIIKSSVLISFTSYCYFAELP 525

Query: 519  SVLGPDVCSEIQGKVIQIINDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEF 578
            SVLGP++C+ IQ  ++ ++  ++++SE+DTNG + EVL+ +I  N    ++ +EILQ EF
Sbjct: 526  SVLGPELCASIQKSILTLMKQVSNESEDDTNGLLTEVLNNIIECN--STNTSQEILQTEF 583

Query: 579  HLVFTISSKDPANVQVVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYR 638
             L+F+ISSKDP+NVQ+VV+SQE LEKLL  +    Y  YI++ LP FIN++ +NS  +YR
Sbjct: 584  SLLFSISSKDPSNVQIVVESQESLEKLLTNVTEKVYLEYIQIYLPPFINIIHANSTTSYR 643

Query: 639  YSPLLSLVLEFITVFLKKKPIDG-FLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSY 697
            YSPLLSLVLEFIT+F+KKKP D   LP+ I   LF+PL  +L  S+E+ETLQL T++F+Y
Sbjct: 644  YSPLLSLVLEFITIFMKKKPSDSKILPESIIANLFQPLVDILTTSTEDETLQLTTDAFTY 703

Query: 698  LIFNTDTQVMEPRLMDIMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRIL 757
            +I+NTD++ + P L  ++ +L+RLLSL+V+D+AAMNVG L+VTIFTKFS  I  L+  IL
Sbjct: 704  IIYNTDSEKVMPYLETVVNILDRLLSLDVTDTAAMNVGTLIVTIFTKFSAQISSLIPTIL 763

Query: 758  EAVIVRLVKAQNISTQQNLLSVLCFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAF 817
             A + RL+  +NISTQQNL+S+LCFL  +++++TV+FL  F +  +N +  V+ KW E+F
Sbjct: 764  NAAVNRLIDCKNISTQQNLVSLLCFLFYSNTQETVDFL--FNLPQQNIVRDVLIKWFESF 821

Query: 818  EVIRGEKRIKENIVALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQV 877
            E+IRGEK+IKENI+AL  L+ L D +L  + VNGD+IPYE D+IITRS AK +PD+Y Q+
Sbjct: 822  EIIRGEKKIKENIIALGKLYCLHDEKLFSIKVNGDIIPYEGDLIITRSRAKSLPDKYTQI 881

Query: 878  PLYTKIIKLFVSELGFQNKQPDPKQLITSNMQHXXXXXXXXXXXXXXXXXXXXXXYEKLK 937
             ++ KIIKLF++ELGFQNKQP  + L+T+                          Y+KLK
Sbjct: 882  TIFEKIIKLFIAELGFQNKQPAIENLMTN---ETTALGDSNENDDEWEDVDDVLDYDKLK 938

Query: 938  EYIN-------XXXXXXXXXXXXXITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYET 990
            EY+N                    ITGL DV ++V ++++ FFK+V +K+V+ F  IY+T
Sbjct: 939  EYVNDEDELDGEDSREYGEGDEEEITGLGDVSQTVTELIIGFFKDVTSKNVNNFQSIYDT 998

Query: 991  LSDSDRKVLSEALL 1004
            LS++++ +L++ L+
Sbjct: 999  LSENEKMILTQYLV 1012

>KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1009

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1020 (44%), Positives = 649/1020 (63%), Gaps = 27/1020 (2%)

Query: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQH-QSPLESRQFALL 59
            MN+DEL+   QS D   R  AE+ L+   D +AS +  +L NVAL   + PL  RQFALL
Sbjct: 1    MNMDELIALLQSPDNSVRTQAESNLMTVSDEDASHVLQSLINVALNSAEKPLTERQFALL 60

Query: 60   SLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQIS 119
            S+RKLIT YWSP FESYR+T+ +++  K ++R+ LL+L LND+++TKI   ASYCIVQIS
Sbjct: 61   SMRKLITFYWSPAFESYRNTATLDLLTKQYVRDSLLQLSLNDSQDTKIKKSASYCIVQIS 120

Query: 120  AVDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKV 179
            AVDFPD+WP+LL  +Y AI++ HSL+A+SLLNEIYDDV+SEEMFFEGGIGLET+QIIF++
Sbjct: 121  AVDFPDEWPKLLEELYGAITNFHSLSAISLLNEIYDDVISEEMFFEGGIGLETLQIIFQL 180

Query: 180  LATDTSTLVXXXXXXXXXXXXXXQMSSHNGYD-EESRKSFISQCLSTSLQRLGQLLTMGF 238
            L++D ST+               QMS+ + +  +E RK  +  C+   L  L  LL  G 
Sbjct: 181  LSSDASTIEAKLAAINLFHATLLQMSTVDSHTTQEKRKEMVRNCVPICLDTLRTLLE-GL 239

Query: 239  HSENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSI 298
               N    L+LK  IY++L  IKN F    F     + FKI  V+DL     L  N +S 
Sbjct: 240  ADINSALPLQLKGSIYKSLEFIKNKFPTQLFPSQFVEYFKIQAVRDL---VALQINQDSF 296

Query: 299  EYESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNT 358
              +++ EA ++ +I+++E ++S+    +G+E+   I+++L +L ++++   E W +DFN 
Sbjct: 297  ADDTVVEAFNECAIHVIELISSIEITEYGTEDQHAILKALLSLSRLDANTKESWTTDFND 356

Query: 359  FVSKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISK---DIERNTYDNQIXXXXXXX 415
            FVSKETGLAAS+ +RDQ ++                I +   DI  +  D          
Sbjct: 357  FVSKETGLAASFTIRDQVADYLGTPTGAQSQTMFENILQLVSDILSSNADPTTIESSLFL 416

Query: 416  XXXXXXNDDEITDQNLDESLQTLIKTFQNVLVSPEV-----KELTLARAILVIPKVLDKF 470
                   D + +      S QTL++   + L+ P+        +  +R IL IPK+LD F
Sbjct: 417  LQSVLAEDTDFSVS----SPQTLVQLI-SALIGPQTINTHNDSILRSRIILTIPKILDVF 471

Query: 471  IDVLPDIKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQ 530
            +D LP+IK LT   L K+L  AL   +ELI  + LIAFTYY YFAEL SVLG + C E+Q
Sbjct: 472  MDSLPNIKQLTKDLLLKTLQDALSSTDELIFCSTLIAFTYYVYFAELPSVLGSESCRELQ 531

Query: 531  GKVIQIINDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPA 590
              V+ I+N + S++EEDTNG ++EVL+ VIS N    D K  +LQ E   + +ISSKDP+
Sbjct: 532  EAVLGIVNHVASEAEEDTNGLLIEVLNHVISCNVASTDFK--LLQKELTAMLSISSKDPS 589

Query: 591  NVQVVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFI 650
            N++V V+SQECLEKLLD IN + Y  +I +CLPSF+N++  N    Y+Y+PLLSL+LEF+
Sbjct: 590  NIEVSVESQECLEKLLDNINTERYNKFISICLPSFVNIIKGNQPLKYKYNPLLSLILEFV 649

Query: 651  TVFLKKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPR 710
             +F+KKKP +G LP   ++ +   L  +L  S E+ETLQLAT +FS+L+ NTD  ++   
Sbjct: 650  RIFMKKKPTNGMLPRNFSEGIIALLVDILERSEEDETLQLATAAFSHLLNNTDPTIVIQH 709

Query: 711  LMDIMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNI 770
            L  ++KVL+RLLS+ VSD+AA NVG L+VT+F K+SK++  L+  ILE+ I RL+ A+N+
Sbjct: 710  LTVVIKVLKRLLSMFVSDTAAQNVGTLIVTLFNKYSKELTNLIPDILESAIYRLIDAKNV 769

Query: 771  STQQNLLSVLCFLTCNDSRQTVEFLSNFRIDDKNAL-SLVMQKWMEAFEVIRGEKRIKEN 829
            +TQ+NL+S++C++TC D  Q V FL  F   ++  + SL+  KW E FE++RGE++IK+N
Sbjct: 770  TTQENLISLICYVTCCDPLQMVNFLFKFSESERRDIPSLMFNKWFETFEIVRGERKIKDN 829

Query: 830  IVALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVS 889
            I+ALS +FFL D RL  V VNGDL+PYE D IITRSMAK MPDRY Q+ +Y+KI+K+FV+
Sbjct: 830  IIALSKIFFLSDFRLTYVKVNGDLLPYEGDRIITRSMAKEMPDRYTQIDVYSKIVKVFVT 889

Query: 890  ELGFQNKQPDPKQLITSNMQHX-XXXXXXXXXXXXXXXXXXXXXYEKLKEYINXXXXXXX 948
            EL F+NKQPD ++LITS+++H                       YEKLKE+++       
Sbjct: 890  ELQFRNKQPDAERLITSDIKHSDELAAAEGNDDDGWEDVDDVLDYEKLKEFVDDDDDRED 949

Query: 949  XXX----XXXITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004
                      ITG+  V +S  Q+L  FFKE  T +V+GF  +Y  LS+S+R +LS+ LL
Sbjct: 950  SVGLGNDADEITGIDAVPQSATQLLTAFFKEAMTNNVNGFQEMYNALSESERTILSQCLL 1009

>TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1018

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/1019 (44%), Positives = 649/1019 (63%), Gaps = 30/1019 (2%)

Query: 5    ELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKL 64
            +L+  AQSAD + R +AE QLL+  D +AS +F +   VA   Q  L SRQFAL+SLRKL
Sbjct: 11   QLIKEAQSADDVVRRSAEAQLLELSDRDASLVFLSFMKVASDSQELLSSRQFALVSLRKL 70

Query: 65   ITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFP 124
            ITMYWSPGFESYRS S ++   K+ +R+ LLKLCLND E +K+I+ A+YC+VQISAVDFP
Sbjct: 71   ITMYWSPGFESYRSCSNLKEEAKETVRDYLLKLCLNDQEISKVISAAAYCVVQISAVDFP 130

Query: 125  DQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVLATDT 184
            DQWP+LLTV+YD I ++HSL+AMSLL EIYDDV+SEEMFFE GIGLET++I+F+++    
Sbjct: 131  DQWPKLLTVLYDGILNKHSLSAMSLLTEIYDDVMSEEMFFEEGIGLETIRIVFQIVRDPN 190

Query: 185  STLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHSENVV 244
            + L               Q+ + +      RK    +C   +L   G+ L     +E+ +
Sbjct: 191  TNLEAKLAGFNLFHACLQQILTVDLNSAPKRKEMTVECAKEALTVWGEHLQSHSITEHSL 250

Query: 245  SQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEYESIS 304
             QL++K  IYE+L L+KN+ SK      L   FK + + DL     +        Y SIS
Sbjct: 251  -QLQIKGRIYEDLSLMKNELSKKLIPDALYVPFKELVLIDLETAGKV--------YLSIS 301

Query: 305  EAVHDG---------SIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISD 355
            +   +G         +I+I+EFLT+ C     S EV+ II +L  LC ++++ + LW+ D
Sbjct: 302  QGFVEGYRLDDLNECAIHIIEFLTATCHFTMDSAEVERIITALGELCCLDNDTVTLWLED 361

Query: 356  FNTFVSKETGLAASYNVRDQSSEXXXXX-XXXXXXXXXXVISKDIERNTYDNQIXXXXXX 414
            FN+++S E+GL ASY+VRDQ+SE                ++ K    N +  +       
Sbjct: 362  FNSYISMESGLTASYSVRDQASELLTSMDGRNYSLVCQHILYKVSHLNEWKQEWKFQESF 421

Query: 415  XXXXXXXN-DDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDV 473
                     ++ +   N    ++ ++    ++L S +V     +R IL++PK+L+K++D+
Sbjct: 422  LFLVQAAALNESLPSGNFINEIREVLSFLGSMLCSEDVVSFVSSRIILLLPKILEKYMDL 481

Query: 474  LPDIKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKV 533
            L D++ LTS  LTKS +LAL  ++++IK++ LIAFTY   FAEL SVLG +VC   Q +V
Sbjct: 482  LDDVRILTSHLLTKSAELALATNDDIIKASVLIAFTYCSNFAELSSVLGQEVCEITQKRV 541

Query: 534  IQIINDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQ 593
            + +I  I+ D+E+DT+G +MEVL+ VI  N  G+ + E I+Q EF LV  IS+KDPAN+Q
Sbjct: 542  LGLIARISEDAEDDTDGVLMEVLNNVIDCNTPGVPNNE-IVQTEFSLVLKISAKDPANIQ 600

Query: 594  VVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVF 653
            +VV+SQECLEKLL+ +++D+YKNY+E  LPSF+  ++ ++   Y YSPLLSLVL+F+T F
Sbjct: 601  IVVESQECLEKLLENLDIDHYKNYVETWLPSFMKSIEGSAQTKYAYSPLLSLVLQFLTTF 660

Query: 654  LKKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMD 713
            LKK P D  LP  +    FEPL ++L+ S ++ET+QLATE+FSY ++NTD  V+ P L  
Sbjct: 661  LKK-PTDYQLPTVMCNLTFEPLRQILLNSEDDETIQLATEAFSYFLYNTDPTVVAPHLEA 719

Query: 714  IMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQ 773
            I+ +L+RLLS +VSD+AAM VG L+VT+FT+FS +I+ ++  IL A   RL++A+++ST 
Sbjct: 720  IVAILDRLLSFDVSDAAAMYVGSLIVTVFTRFSTEIENMMPIILRAAANRLIQAKHLSTS 779

Query: 774  QNLLSVLCFLTCNDSRQTVEFLSNFRID--DKNALSLVMQKWMEAFEVIRGEKRIKENIV 831
            QNLLSV CFLT  D RQTV+FL    +D  + NAL  ++  W+E+FE IRGE+R KEN++
Sbjct: 780  QNLLSVFCFLTSVDPRQTVDFLFGLHLDNTEHNALYSIVSIWLESFESIRGERRTKENVI 839

Query: 832  ALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSEL 891
            AL  L+ L D RL ++ VN ++IPYE + IITRSMAK+MPDRY QV +YTKIIKLFV+EL
Sbjct: 840  ALIKLYLLHDKRLMEMQVNDEIIPYEGEQIITRSMAKKMPDRYSQVSVYTKIIKLFVAEL 899

Query: 892  GFQNKQPDPKQLITSNMQ---HXXXXXXXXXXXXXXXXXXXXXXYEKLKEYINXXXXXXX 948
             FQ+KQPDP++ ITS+M    +                      YEKL+EY++       
Sbjct: 900  NFQDKQPDPERFITSDMAKEGNNGNSDNDTDSDGEWEDVEDVLNYEKLQEYVDESDQDGE 959

Query: 949  XXXXXX-ITGLMD--VKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004
                       +D     SV  ILV FFKEVA  +  GF  IY +L++ ++K+LSE L+
Sbjct: 960  GSDSDDFFASAIDEYSNASVRDILVSFFKEVAANNTGGFRDIYNSLTEVEKKILSENLV 1018

>Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON}
            complement(8594..11602) [3009 nt, 1003 aa]
          Length = 1002

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1008 (44%), Positives = 637/1008 (63%), Gaps = 27/1008 (2%)

Query: 2    NIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSL 61
            +I +L+  AQS D   RE AE++LL  CD +A  +F ++  V       L SR FALL+L
Sbjct: 3    DIHQLINLAQSPDNSVREKAESELLAACDEDACIVFHSMIQVGSNGFEELSSRLFALLTL 62

Query: 62   RKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAV 121
            RKLITMYWSPGFESYR  S +   +K+  R+ LLK+CL+D+++TKI N ++YC+VQISAV
Sbjct: 63   RKLITMYWSPGFESYRLNSTLNEEIKNNFRDSLLKICLDDSQDTKIKNASAYCVVQISAV 122

Query: 122  DFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVLA 181
            DFPDQWP LL  +Y AI  +HSL+A+SLLNEIYDDV+SEEMFFE GIG ET++IIF VL 
Sbjct: 123  DFPDQWPTLLNEVYGAIMERHSLSAISLLNEIYDDVMSEEMFFEEGIGSETIRIIFSVLT 182

Query: 182  TDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHSE 241
             + + +               QMS  +      RK  +++C+S  L     LL      +
Sbjct: 183  DNNTGIAAKIASSKLFHSCLLQMSVLDPQSVHKRKQLVTECISQILTIWSGLL----QKQ 238

Query: 242  NVV---SQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSI 298
            NV    S+ +L+S IYE+L +IK++F +  FS +  + F+ + + DLN  A    N  S 
Sbjct: 239  NVTEMSSEFELRSKIYEDLAMIKSEFPRKLFSKENIEIFRRLVINDLNIAAKCYNNVLSS 298

Query: 299  EYESISEAVH--DGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDF 356
            E  S +E +H  +  I+I+EFLT++    F  E++  I +S  TL  ++    E W +DF
Sbjct: 299  E-NSDTEMIHINEFVIHIIEFLTAISDFKFSPEDIGTISKSFVTLSCIDRNTEESWTADF 357

Query: 357  NTFVSKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVI---SKDIERNTYDNQIXXXXX 413
            N+F+SKETGL AS+ +RDQ ++               +I     +I  +  D +      
Sbjct: 358  NSFISKETGLFASFTIRDQIADFISNVNEGVYSGFYSLILNEFNEIINSNSDWRTQESVL 417

Query: 414  XXXXXXXXNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDV 473
                    ++ EI +++L  + Q L+    N++ +P  +   L R+IL IPK+L+KF++ 
Sbjct: 418  YLLQCIATSETEI-NESLQCNTQILVTAIGNIISNPPTQSFVLMRSILTIPKLLEKFMET 476

Query: 474  LPDIKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKV 533
            LPD+K  T + L+ SLD+AL   +EL++S+ LIAFTYY  FAEL+SVLG   C   Q KV
Sbjct: 477  LPDVKEYTKQLLSISLDIALSSSDELVQSSGLIAFTYYTSFAELNSVLGDVACRVEQEKV 536

Query: 534  IQIINDINSDSEEDTNGAIMEVLSQVISYN-PKGLDSKEEILQAEFHLVFTISSKDPANV 592
            +++I ++++DSEEDTNG ++EVL+ VI  N P+ LD  E IL+ EF  + TIS KDP+N+
Sbjct: 537  LKLIQNLSNDSEEDTNGVLVEVLNNVIDCNSPQHLD--ETILEVEFDFLLTISVKDPSNI 594

Query: 593  QVVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITV 652
            Q++V++QECLEKL++ ++++ Y  Y    LP  INV++  +   Y YSPLLSL LEFI +
Sbjct: 595  QLIVEAQECLEKLIESMDINLYNKYAHKLLPFLINVINECNQTGYSYSPLLSLALEFINI 654

Query: 653  FLKKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLM 712
             ++ +P D  LP  I + LF PL  +L+ S E+ETLQLATE+FS+L+FN+ T V+ P L 
Sbjct: 655  LMRNRPDDISLPTYICEQLFSPLRHILMVSQEDETLQLATEAFSFLLFNSQTDVIFPYLE 714

Query: 713  DIMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNIST 772
            +I+ VL RLLS+++SD+AAMNVG LVVTIFTKFS+ +Q L+  IL A   + + A+NIST
Sbjct: 715  EIINVLSRLLSMDISDTAAMNVGSLVVTIFTKFSEQVQELIPGILRATTDKFINAKNIST 774

Query: 773  QQNLLSVLCFLTCNDSRQTVEFLSNFRID--DKNALSLVMQKWMEAFEVIRGEKRIKENI 830
             QNL+SV C L C D  +T++FL N  I    +++L LV+ KW+E+FE+IRGEK+IKENI
Sbjct: 775  SQNLVSVFCLLVCTDPARTIDFLYNLEIGTPPQSSLPLVLTKWLESFEIIRGEKKIKENI 834

Query: 831  VALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSE 890
            +ALS ++FL D+R+  + VNGD+IPY  D+IITRSMAK MPD+Y +V +Y KI+KLFV+E
Sbjct: 835  LALSKIYFLKDSRVSSIEVNGDIIPYTGDLIITRSMAKSMPDKYTRVSVYQKIVKLFVAE 894

Query: 891  LGFQNKQPDPKQLITSNMQ------HXXXXXXXXXXXXXXXXXXXXXXYEKLKEYINXXX 944
            LGFQ K+ DP  L+ S ++                             YEKL+EYI+   
Sbjct: 895  LGFQTKEQDPSDLVDSKLKQELGIPQQMGAAHGDDDDDDWEDVDDVLDYEKLQEYIDDDD 954

Query: 945  XXXXXX--XXXXITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYET 990
                        ITG+ +V ++  ++L+ FFKE A+KD++ F  IY T
Sbjct: 955  EEEYVGGPESQEITGIEEVTQTTKELLIEFFKEAASKDINSFQEIYNT 1002

>CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241w KAP114
          Length = 1021

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/1021 (43%), Positives = 645/1021 (63%), Gaps = 30/1021 (2%)

Query: 6    LVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLI 65
            L+ +AQS D   RE AETQLL  CD+NA ++F +L  +   +Q+PL SR F+LLSLRK I
Sbjct: 9    LIEQAQSPDNAVREGAETQLLNACDTNADEVFQSLIELGENNQTPLASRLFSLLSLRKFI 68

Query: 66   TMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPD 125
            TMYWSPGFESYR TS V++  K+ IR+VLLKL L+D ++ K+ N +SYC+VQISAVDFPD
Sbjct: 69   TMYWSPGFESYRGTSNVQLGTKERIRDVLLKLSLDDQQSNKVRNSSSYCVVQISAVDFPD 128

Query: 126  QWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVLATDTS 185
            +WPQLL+ +Y+AI+  HSLNAMSLLNEIYDDV+SEEMFFEGGIG ET+QIIF +L     
Sbjct: 129  EWPQLLSTLYNAITQNHSLNAMSLLNEIYDDVISEEMFFEGGIGYETLQIIFTLLTNAQV 188

Query: 186  TLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMG--FHSE-- 241
             L               QMS  +    + RK  +S+CL  +LQ +  LL       S+  
Sbjct: 189  RLASKTSALKLFGACISQMSVLDNNSSQKRKLLVSECLGQALQTIKLLLEQCEIIQSDLT 248

Query: 242  NVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEYE 301
            ++   L+ K  +Y+++  IK +F +  F  D+      + V+DL+ +A L        ++
Sbjct: 249  SINETLEFKDNLYDDINSIKENFPRKFFPEDVNLYVTNIAVRDLDQLAGLYQESFKDNFD 308

Query: 302  SISEAVHDGS-IYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFV 360
              S ++ +   I++++FL +  + P  +E +  I+ +  TLC+ ++   + W SDFN F 
Sbjct: 309  EQSMSIFENCVIHLLDFLANPIS-PLNNELISNILTASITLCEQSALTKDSWESDFNEFA 367

Query: 361  SKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISKDIERNTYD---NQIXXXXXXXXX 417
            SKETGL+AS+ +RD+ +E               +I   +  N+     ++I         
Sbjct: 368  SKETGLSASFTIRDEVAELVNAFEIPQLETSFELIVGYLSNNSSHLSADKIESALYLLQC 427

Query: 418  XXXXNDDEITDQNLDESLQTLIKTF---QNVLVSPEVKELTLARAILVIPKVLDKFIDVL 474
                 DD  ++ +L  SL   IK+    QN L      +++  R +L+IPK L KF+D+L
Sbjct: 428  LMNVEDD-FSNTSLVPSLIEFIKSMLSQQNNL-----DQMSQIRLLLLIPKTLAKFMDIL 481

Query: 475  PDIKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVI 534
            P++K LT++ L + L +A   ++ LI  +ALI+FTY+  +AE+ SVLG D    +Q K +
Sbjct: 482  PNVKQLTAETLNEILSMATNSNSHLIIISALISFTYFASYAEILSVLGNDQTLLVQNKTL 541

Query: 535  QIINDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQV 594
             +I +I+ +S EDTNG +MEVL+ VI  N K + +  E+ + EF L+  IS KDPAN+QV
Sbjct: 542  HLIQEISEESTEDTNGLLMEVLNCVIDCNDKNV-ANMELFKFEFKLILVISGKDPANIQV 600

Query: 595  VVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFL 654
             ++SQECLEKLL  +N ++Y +++++C+PSFIN++ S+ V NY YSPLLSLVLEFITVF+
Sbjct: 601  SIESQECLEKLLLNVNTNDYLSFVDICIPSFINIIKSSEVTNYSYSPLLSLVLEFITVFM 660

Query: 655  KKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDI 714
            K KP +  LP  +++Y+F+PL   L+ S+EEE LQ+ATE+FSY+I N+   V+ P+L  I
Sbjct: 661  KNKPQEALLPSSVSEYVFDPLVSCLLKSTEEELLQIATEAFSYMIHNSSKDVITPKLETI 720

Query: 715  MKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQ 774
            + +L+RLLS  +SDSAAMNVG L++ + T++S+ + PL+  I+ A + +LV + NI+TQQ
Sbjct: 721  VNILDRLLSSNISDSAAMNVGTLILALITEYSEPMNPLLPSIISAAVRKLVVSNNITTQQ 780

Query: 775  NLLSVLCFLTCNDSRQTVEFLSNFRI-DDKN---ALSLVMQKWMEAFEVIRGEKRIKENI 830
            NL+++LCFL C+D +QTV+FL    I +DK    AL +++QKW++ F V+RGE RIKENI
Sbjct: 781  NLVTLLCFLVCHDPKQTVDFLCELTIKNDKGEQVALPVIIQKWLDTFAVVRGENRIKENI 840

Query: 831  VALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSE 890
            VALS LF L D R+ +V VNG++IPY+ D+IITRSMAK MPDRY  V    KI+K+F+ E
Sbjct: 841  VALSQLFLLGDDRVNEVKVNGEIIPYDGDLIITRSMAKSMPDRYTTVSAPEKIVKMFLGE 900

Query: 891  LGFQNKQPDPKQLITS-NMQHXX----XXXXXXXXXXXXXXXXXXXXYEKLKEYINXXXX 945
            LGFQ +  +P++L+T+ +M+                           YEKL+EYI+    
Sbjct: 901  LGFQGRNKNPEELLTTDDMKGMGLKPNQQSNNDEGDDDWEDVDDVVDYEKLQEYIDDEDD 960

Query: 946  XXXXXXX--XXITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEAL 1003
                       ITG   + +S+ ++L  FF   A K+V+GF  IY  LS+ +RK +SE +
Sbjct: 961  LDDNSVGELETITGQQHIPQSIPELLKDFFNTAAQKNVAGFQEIYNNLSEEERKCISELI 1020

Query: 1004 L 1004
            L
Sbjct: 1021 L 1021

>TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1022

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1026 (41%), Positives = 638/1026 (62%), Gaps = 37/1026 (3%)

Query: 6    LVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLI 65
            L+  AQSAD   RE AE++LLQ CD NAS +F +L  +A     PL SRQF +LSL+KLI
Sbjct: 7    LIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSLKKLI 66

Query: 66   TMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPD 125
            TMYWSPGF+SYR TS V+   K+F+R+ LLKLCLN  +++KI + +SYCIVQISA+DFPD
Sbjct: 67   TMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAIDFPD 126

Query: 126  QWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVLATDTS 185
             WP LL VIY+AI   HS+ AMSLLNEIYDDV+SEEMFFEGG+G ET++ IF +  +  +
Sbjct: 127  LWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISEEMFFEGGVGEETIKTIFAIFTSPET 186

Query: 186  TLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHSENVVS 245
             +               QMS  +      RK F+SQC++   + L  LLT+  H +   S
Sbjct: 187  NIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCIT---KLLDILLTILPHLDVNQS 243

Query: 246  Q--LKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAH-----LDTNGNSI 298
            +  L+LK+  YE L  IK +F K  F   L   FK ++++DL  I       +D++ +  
Sbjct: 244  EDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDASGS 303

Query: 299  EYESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNT 358
            + + I+E      +++++F++S+    F   ++  I+ SL  LC +++   E W SDFNT
Sbjct: 304  QLQLINEY----GVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNT 359

Query: 359  FVSKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISKDIERN--TYDNQIXXXXXXXX 416
            F+SKE GL A+Y +RDQ+ +               +I +++ ++   Y+N          
Sbjct: 360  FISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLYT 419

Query: 417  XXXXXNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPD 476
                 + +E  +  L    + ++ +   +L+ P    +  +R +L+ PK L+KF++    
Sbjct: 420  LQSIISSEEEFNSELLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYTA 479

Query: 477  IKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQI 536
            +K +T + L+ SL+L+L   +E++KS+ LIAF+YY  +A+L SVLG   C  IQ  +++I
Sbjct: 480  VKPMTKELLSTSLNLSLNTSSEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLKI 539

Query: 537  INDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVV 596
            I DI +D+EEDT    +E +S VI  N  G  S +E+   EF+++  IS KDP N+Q+ V
Sbjct: 540  IKDIANDAEEDTYAICVETISNVIDNNSSGTGS-DEVRDNEFNILLEISFKDPGNIQLSV 598

Query: 597  QSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKK 656
            +SQECLEKLLD +++  Y  Y E  +P  I ++  ++  NY YSPLLSL L+F+  F+KK
Sbjct: 599  ESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMKK 658

Query: 657  KPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMK 716
            KP+D  LP EI++ +F P+ +VL+ S+EEET+QLATE+FS+L+FN+D  +M+  L +I+ 
Sbjct: 659  KPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIVN 718

Query: 717  VLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNL 776
            VL +LLSL +SD+AAMNVG L++TIF+KFS+ IQ L+  IL+A   + V A+NI T QNL
Sbjct: 719  VLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQNL 778

Query: 777  LSVLCFLTCNDSRQTVEFLSNFRIDDK---NALSLVMQKWMEAFEVIRGEKRIKENIVAL 833
            L V CFL C+D +QTV+FL N  ++D+   N L+LV++KW+E F++IRGEKRIKENI+AL
Sbjct: 779  LMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIAL 838

Query: 834  SNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGF 893
            S ++ L D R+  V+VNGD+IPY  D IITRSMAK +PD++ Q+P+Y KI+KLF+ EL  
Sbjct: 839  SKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELAS 898

Query: 894  QNKQPDPKQLITSNMQ-------HXXXXXXXXXXXXXXXXXXXXXXYEKLKEYI------ 940
            Q+K      L + ++Q       +                      YEKL+EY+      
Sbjct: 899  QSKNISDANLHSIDIQKLARAEENQVEQKLDSSEDDDWEDVEDVLDYEKLQEYVDDDDDE 958

Query: 941  --NXXXXXXXXXXXXXITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKV 998
              N             I G  D+ +SV ++++ FFKEV +K+++ F  IY +LS+ ++K+
Sbjct: 959  LANYTSDEDNDTPTGQIIG--DINQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKKL 1016

Query: 999  LSEALL 1004
            L+ AL+
Sbjct: 1017 LANALV 1022

>SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1009

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1021 (41%), Positives = 635/1021 (62%), Gaps = 33/1021 (3%)

Query: 2    NIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSL 61
            N+ +LV +AQSADK  REAAE+ LLQ+       MF +L ++A  +  PL SRQF+LL L
Sbjct: 4    NVAQLVIQAQSADKKEREAAESSLLQFSAQEPESMFLSLIDIAC-NSYPLTSRQFSLLFL 62

Query: 62   RKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAV 121
            R+L+TMYWS GFESY     V    K  +RE LL+L L+D+++ K  N +SYC+VQISAV
Sbjct: 63   RRLVTMYWSAGFESYVGPPGVGSRGKSIVRESLLRLSLDDSQDIKTKNSSSYCVVQISAV 122

Query: 122  DFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVLA 181
            DFPD+WP LL  IY+AI   +SL+AMSLL EI+DDVVSEEMFF+GGIG +T+QI+ +VL 
Sbjct: 123  DFPDEWPDLLIRIYEAIVEHYSLSAMSLLTEIFDDVVSEEMFFQGGIGWQTIQIVSQVLT 182

Query: 182  TDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHSE 241
            + TS++               Q+ S        RK  I++ +   L    QLL     S+
Sbjct: 183  SSTSSVESKSAALDLYHACVLQLQSPQATSTIERKHAIAEHIKQMLGLFIQLLQFYQSSQ 242

Query: 242  NVV--SQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIE 299
            + +  + LKLK+ IYENL ++K++FSK  F  + +   K + ++DLN I++       I 
Sbjct: 243  DEIQPTLLKLKASIYENLGMLKSNFSKQFFPEEEKNILKGLVLKDLNAISN-------IY 295

Query: 300  YESIS-------EAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELW 352
            Y S++       +++ + +I+I+ FL+S+  + F   E  +++ SLT +C +       W
Sbjct: 296  YRSLNNTDDKDIDSLDECAIHIIVFLSSLHELVFSPTETPVLLDSLTKVCCLTDTQTSDW 355

Query: 353  ISDFNTFVSKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISKDIERNTYDNQIXXXX 412
             + FN FV+KETGLAASY+ RD+S +                +++++  +  ++      
Sbjct: 356  DNYFNIFVTKETGLAASYSARDESFQFFSNLTGTNYTNLLAFLTQNVHASGIEDWKYQES 415

Query: 413  XXXXXXXXXNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFID 472
                     N+DE    +    LQTL   F  +L S E  E    R IL++PK+L+KF+D
Sbjct: 416  LMYLMEAAVNNDEEITNDFQPVLQTL-DAFSELLASCETNEFVKVRVILILPKILEKFMD 474

Query: 473  VLPDIKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGK 532
             L DIK L  KFL ++  L      +++K A+LI+FTYY  FAELDSVLG +   +++  
Sbjct: 475  SLEDIKLLVKKFLFQTFTLVSAPTKDILKVASLISFTYYSSFAELDSVLGTETYQQLKEA 534

Query: 533  VIQIINDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQA----EFHLVFTISSKD 588
            V++IIN+I  D+E+DT   ++E L+Q+I     G  S  E++ +    E  L+  IS+KD
Sbjct: 535  VLKIINEIYEDAEDDTPALLLETLNQII-----GSTSNAEVIASVRFDELQLILKISAKD 589

Query: 589  PANVQVVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLE 648
            P+N+QVV+++QECL+ LL  I+++ Y  Y E+ +PSF+NVL+ ++ + + YSP+LSL LE
Sbjct: 590  PSNIQVVLEAQECLQNLLKNISLEIYLKYAEMAIPSFVNVLEGSNSSGFEYSPILSLSLE 649

Query: 649  FITVFLKKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVME 708
             +TVF+KKKP +G LP  IT ++F+PL++ LV S ++E LQL T+ +S+LI N++   + 
Sbjct: 650  LLTVFMKKKPTNGTLPPRITDFVFQPLSETLVGSQDDEVLQLTTDIYSFLINNSENSQIA 709

Query: 709  PRLMDIMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQ 768
            P L  I+ VLE+LLS+  SDSAAMNVG L++ IF K S  +Q  +  ILEA   RLV+  
Sbjct: 710  PHLNTILSVLEKLLSINTSDSAAMNVGSLIIAIFCKLSDQLQETIPTILEAAAKRLVQVH 769

Query: 769  NISTQQNLLSVLCFLTCNDSRQTVEFLSNFRIDDK--NALSLVMQKWMEAFEVIRGEKRI 826
            NI+T +NL+ V C+LT  +  QTV+FLS+  +D +  +AL L++ KW+E+FE+IRGEKRI
Sbjct: 770  NIATAENLIFVFCYLTSTNPNQTVDFLSSLVLDSEGNSALKLILPKWLESFEIIRGEKRI 829

Query: 827  KENIVALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKL 886
            KENI+ALS LFFL+D R+  ++VNGD IPY+ D++ITRSM+K MP++Y Q+  Y KI+KL
Sbjct: 830  KENILALSKLFFLNDERISSIIVNGDSIPYDGDLVITRSMSKIMPEKYTQISAYEKIVKL 889

Query: 887  FVSELGFQNKQPDPKQLITSNMQH---XXXXXXXXXXXXXXXXXXXXXXYEKLKEYINXX 943
            FV+EL FQ  QP  ++ I  +++                          YEKL+EY++  
Sbjct: 890  FVAELSFQGNQPGLEKYIPHDLKKYDDQAIKAANDANDDDWEDVDDVLEYEKLQEYVDDE 949

Query: 944  XXXXXXXXXXXITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEAL 1003
                       I G+ ++ +S  ++L++FF+E A K+VSGF  IY  L+D++++VL+E L
Sbjct: 950  SDLEDDEEGDVI-GVQELHQSTRELLIQFFREAAAKNVSGFQEIYNHLNDNEKRVLTENL 1008

Query: 1004 L 1004
            +
Sbjct: 1009 V 1009

>TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.564
            YGL241W
          Length = 1010

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/1023 (42%), Positives = 638/1023 (62%), Gaps = 34/1023 (3%)

Query: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60
            ++ID L+ +AQS +   RE AE  LL+WC+ +A   F ALANVA  +   L SRQ++LL+
Sbjct: 3    IDIDSLIKQAQSPETSLREHAENSLLEWCEHDACSAFAALANVAANNTEILSSRQYSLLA 62

Query: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120
            LRKLITMYWSPGFESY  TS +   VK  +R  +L+L L+ N+++KI    SYCIVQ+SA
Sbjct: 63   LRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSA 122

Query: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180
            VDFPD WP+LL  +Y +I   HSL A+S+LNEIYDD++SEEMFFE GIGLET+++IF +L
Sbjct: 123  VDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNIL 182

Query: 181  ATDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFH- 239
               T+ +               QMS  +      R + +   L   + +  Q+L      
Sbjct: 183  DDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLED 242

Query: 240  -----SENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTN 294
                  E  + + K +  IYE L  + ++FSK    ++    F+  ++QDL   + L  N
Sbjct: 243  ALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYIN 302

Query: 295  ---GNSIEYESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMEL 351
               G++I + ++++ +    I+I E+L+++    +  EE+ +I+ S+  LC +++ I+E 
Sbjct: 303  MISGDNIAFNALNKYI----IHIFEYLSNISRANYEREELILILESIYKLCCLDNLIVET 358

Query: 352  WISDFNTFVSKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISKDIERN------TYD 405
            W S+FN FVSKE GL ASY++RDQ S+               +I K+   N        D
Sbjct: 359  WNSNFNEFVSKEFGLMASYSLRDQISD----FLISLSSNNFNIIFKEFITNLNNCLIIED 414

Query: 406  NQIXXXXXXXXXXXXXNDDEI---TDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILV 462
             +              ND++I    + N++  L +L K F + + +     +  +R IL+
Sbjct: 415  WRQLESMLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNT----ILFSRLILL 470

Query: 463  IPKVLDKFIDVLPDIKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLG 522
            IPK+L+KF+D + +IK +T +FL +SL + L + N LIKS+ L+    YC FAEL +VLG
Sbjct: 471  IPKILEKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLG 530

Query: 523  PDVCSEIQGKVIQIINDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVF 582
               C E+Q   ++II  I  DSE+DT G IMEV++ +I  N    D   EI Q EF+L+ 
Sbjct: 531  DKTCQEVQQITLKIILQILDDSEDDTYGMIMEVINNLIDCNLPN-DKLGEIPQQEFNLIL 589

Query: 583  TISSKDPANVQVVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPL 642
            +I+S+DP+NVQ+ V+SQECL+KLL+ +N   Y +YIE+C PS + VL  +SV  Y+YS L
Sbjct: 590  SITSRDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSAL 649

Query: 643  LSLVLEFITVFLKKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNT 702
            LSL LEFIT+F+KKKP DG+LP EI +++F PL  VL+ S+E+ETLQL++++FSYLI+NT
Sbjct: 650  LSLALEFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNT 709

Query: 703  DTQVMEPRLMDIMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIV 762
            D  VM   L  I++V++RLLSL+V+DSAAMN G LVVT+FT F  +I+P + +IL     
Sbjct: 710  DPIVMVESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTK 769

Query: 763  RLVKAQNISTQQNLLSVLCFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRG 822
            RL++A+NIST QNL+SV+C+L C+++  T+  LS     + + L LV+ KW+  FE+IRG
Sbjct: 770  RLIQAKNISTIQNLISVICYLICSNTEDTINLLSRLGT-EGDILKLVLNKWISNFEIIRG 828

Query: 823  EKRIKENIVALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTK 882
            E+RIK+NI+AL+ L+ L+++ ++ +MV+ +LIPY+ D IITRSMAK MPDRY Q+P+Y+K
Sbjct: 829  ERRIKQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSK 888

Query: 883  IIKLFVSELGFQNKQPDPKQLITSNMQHXXXXXXXXXXXXXXXXXXXXXXYEKLKEYI-N 941
            IIKLF+ EL  Q KQP+    I   ++                       YEKL+EY+ +
Sbjct: 889  IIKLFIQELSEQMKQPEHNLKIEETVE-TIGDGNAAAADDDWEDVEDVLDYEKLQEYVDD 947

Query: 942  XXXXXXXXXXXXXITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSE 1001
                         I G MD++  V ++L+R  KE A+K+VS F++IY TLS+ ++++LSE
Sbjct: 948  EDDELHFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSE 1007

Query: 1002 ALL 1004
             L+
Sbjct: 1008 CLV 1010

>Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {ON}
            similar to Ashbya gossypii AFR269W
          Length = 1019

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/1012 (38%), Positives = 610/1012 (60%), Gaps = 21/1012 (2%)

Query: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60
            M++ EL+  AQS  K  RE+AET LL  C S+   +F +L N+A    + + S+QF L+S
Sbjct: 13   MDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVS 72

Query: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120
            +RKLITMYW+ GFESY     V    K+ +RE LLKL L D++N+KI++ +SYCIVQI+A
Sbjct: 73   IRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAA 132

Query: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180
            VDFPD+WP LL  +YDAI++ +S NA+SLL+EI+DDVVSEEMFF+GGIG +TVQI+F +L
Sbjct: 133  VDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLL 192

Query: 181  ATDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240
            +  +S+                Q+ S +  + +  +S I+Q ++ +L    QLL     +
Sbjct: 193  SNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNLA 252

Query: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEY 300
            +     L LK+  YENL L+K  F K  F  DL+  FK V ++DL+ +    +   +   
Sbjct: 253  DPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILASVD 312

Query: 301  ESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFV 360
            E++ ++V + +I I+ FL+S+        EV+ ++ SL  LC +     +   +D N+FV
Sbjct: 313  EALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNSFV 372

Query: 361  SKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVI---SKDIERNTYDNQIXXXXXXXXX 417
            SKETG++  Y +RD+  +                +   +  +    ++ Q          
Sbjct: 373  SKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWEKQESMLYLLQSC 432

Query: 418  XXXXNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDI 477
                 + E+  Q L E    L+   QN+L S  +  L  +R  + I K+L+KF+  L +I
Sbjct: 433  QGNTEEFEVNSQGLVE----LLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCKLENI 488

Query: 478  KSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQII 537
            K +  +F+ K+L +A    N  +K+ +LI++  Y  F  L SVLG + C +++ +V+ II
Sbjct: 489  KLIVKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDII 548

Query: 538  NDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQ 597
            NDI ++ ++DT G ++EVLS VI+ NP+   + + +  +E   V  +S+ DP +VQVVV+
Sbjct: 549  NDIYAEVDDDTPGFLLEVLSGVIASNPES--TNKSLKASELEFVLKLSTSDPYSVQVVVE 606

Query: 598  SQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKK 657
            +Q+CL  LL ++  D+Y  Y ELC+PSF++VL ++  + + Y+PL+SL LE +TVFLKK 
Sbjct: 607  AQDCLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKN 666

Query: 658  PIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKV 717
            P DGFLP  + +Y+FEPL  +++ S ++E LQL+TE+F++L+ N+    +   L   + +
Sbjct: 667  PSDGFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTAIMI 726

Query: 718  LERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLL 777
            LERLL+ + S SA+  VG L++++ TKF+  IQ ++ ++LEA   RLV+  NI T +NL+
Sbjct: 727  LERLLASDTSYSASSKVGSLLLSVLTKFADQIQDIMPKLLEAAARRLVQVNNIHTVENLI 786

Query: 778  SVLCFLTCNDSRQTVEFLSNFRI--DDKNALSLVMQKWMEAFEVIRGEKRIKENIVALSN 835
             V C LT  D +QTV+FLS+  +  D  +AL L++ KW+++FE+IRGEK+IKENIVALS 
Sbjct: 787  LVFCHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVALSK 846

Query: 836  LFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQN 895
            LFFL+D+R+  ++VNGDLIPY+ D+IITRSMAK +PD+Y ++  Y KIIKL V+EL FQ 
Sbjct: 847  LFFLNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELMFQY 906

Query: 896  KQPDPKQLITSNM-------QHXXXXXXXXXXXXXXXXXXXXXXYEKLKEYINXXXXXXX 948
             QPDP + ++S         Q                       YEKL+EYI        
Sbjct: 907  NQPDPDKYMSSQSEKLTKTNQDNKSNSGNADHDDDWEDIDDVLEYEKLQEYIEGSDIDDD 966

Query: 949  XXXXXXITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLS 1000
                  +    +++E+  ++L +FFKE   KD+SGF  IY  L++ +++ LS
Sbjct: 967  DDDLLIMN---NIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015

>AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGL241W (KAP114)
          Length = 1017

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/1010 (36%), Positives = 596/1010 (59%), Gaps = 17/1010 (1%)

Query: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60
            M++ +LV  AQSA K+ RE+AE  LL+ C ++ + +   L  +A Q  + L SRQF L +
Sbjct: 19   MDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYT 78

Query: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120
            LRKLITMYW+ GFESY     V  + K+ +R+ LL++ ++  +++KII+ ++YC+VQI+A
Sbjct: 79   LRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAA 138

Query: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180
             DFPD+WP LL  +Y++I+ + SL A+ LL+EI+DDVVSEEMFF+GG+G +T++IIF++L
Sbjct: 139  FDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELL 198

Query: 181  ATDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240
              D   +               Q+++    +E   ++ +   +  +L+   QLL      
Sbjct: 199  G-DDGPVALKDAAMKLYHSCLLQLAAPQALEEADTRAAVGAHVHEALELFAQLLEHCRSL 257

Query: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEY 300
            E     L+ ++  YENLVLIK    K  F   L++      ++DL  +        +   
Sbjct: 258  EPHADLLQFQAHTYENLVLIKTQLPKRFFPGALREALLDAVLRDLVLLGAYYEQHLAEGD 317

Query: 301  ESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFV 360
            E + +AV + +I++V FL+SV      +E + +++ SL  L  +++   E W  D+N+F+
Sbjct: 318  EELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSFI 377

Query: 361  SKETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISK---DIERNTYDNQIXXXXXXXXX 417
            SKETGL +SY  RD+  +               V+ +    +E   + +Q          
Sbjct: 378  SKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRSQESLLFLLQSC 437

Query: 418  XXXXNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDI 477
                   +  +Q    ++  L++  Q +L S +V  L   R  + +P++L+K++D LP++
Sbjct: 438  QLNSEGPQFDEQ----TVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLPNV 493

Query: 478  KSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQII 537
            K L  +F+  + +  +  +N+L+ ++ALIAFTYY  F +  SVLG     E++  V+  I
Sbjct: 494  KDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLSTI 553

Query: 538  NDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQ 597
             +I    +EDT G ++EVLS V   N +      E+   E  LV  +++ DP+N+QVVV+
Sbjct: 554  KNILDGIDEDTPGFLLEVLSGVTGCNKES--RNRELKLYELQLVQNVATADPSNIQVVVE 611

Query: 598  SQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKK 657
            +QECL+ LL + + +NY  Y ELC+PSF+ VL ++S + Y Y+PL+SL LE + VF++KK
Sbjct: 612  AQECLKNLL-QYDPENYLQYAELCIPSFLEVLRADSSHGYAYTPLVSLSLELLVVFMRKK 670

Query: 658  PIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKV 717
            P+D  LP  +  Y+F+PL+ +L+ + ++E LQL+TE+F+ L+ ++ T  +  R+  I+ +
Sbjct: 671  PVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFTALLASSLTDDLLGRIPVIITI 730

Query: 718  LERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLL 777
            LE+LLS   S SAA+N G L++ + TKF+  IQ ++ +ILEA   RLV+ +N+ T +NLL
Sbjct: 731  LEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENLL 790

Query: 778  SVLCFLTCNDSRQTVEFLSNFRIDD--KNALSLVMQKWMEAFEVIRGEKRIKENIVALSN 835
             V C+LT  D+RQTV+FLS+  ID+  + AL  ++ +W+EAFEV+RGE +IKENI++LS 
Sbjct: 791  FVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLSK 850

Query: 836  LFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQN 895
            LFFL+D R+  + VNGDLIP++ D+IITRSMAK+MPD+Y Q+    KI+KLFV+EL FQ 
Sbjct: 851  LFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQQ 910

Query: 896  KQPDPKQLIT-SNMQHXXXXXXXXXXXXXXXXXXXXXXYEKLKEYINXXXXXXXXXXXXX 954
             QPDP +     +                         YEKL+EY +             
Sbjct: 911  NQPDPGRYPKDGSGPADPHDSEGDSADEDWEDVDDILDYEKLQEYADDSDIDDTGDSLLF 970

Query: 955  ITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004
             +   +++E    +L +FFKE   ++ SGF  IY  L++ ++K LS  ++
Sbjct: 971  TS---NIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017

>Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa]
            {ON} YGL241W (KAP114) - Kap114p [contig 344] FULL
          Length = 1011

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/1017 (36%), Positives = 598/1017 (58%), Gaps = 25/1017 (2%)

Query: 3    IDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLR 62
            ++E +  AQS DK TRE  E  + + C  + S     L  +A +    +E+R F+LLSLR
Sbjct: 5    LEEAIASAQSPDKQTREQGEACIWKLCSEDPSFSCACLVQLACRQDYRIENRLFSLLSLR 64

Query: 63   KLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVD 122
            KLITMYWS GFESYR    V  + K+ IR  LL+L L+D ++T+I  G+SYCIVQI+AVD
Sbjct: 65   KLITMYWSAGFESYRGPPGVNEDCKELIRNSLLELGLDDAQDTRIQKGSSYCIVQIAAVD 124

Query: 123  FPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVLAT 182
            FPD+WP L+ ++Y+AI   HS++A+ +LNEI+DDVVSEEMFF  G+G +T+Q+I  +L  
Sbjct: 125  FPDEWPGLIEIVYNAILRSHSVSALYVLNEIFDDVVSEEMFFNQGVGWQTIQLISNILND 184

Query: 183  DTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFH-SE 241
               +++              Q+ S         +S ++  +  S + L  LL    +  +
Sbjct: 185  PGCSILAKHSAAKLYQACLLQLQSPAASSTPELRSALTNHIQESTKMLLNLLQAYSNIQD 244

Query: 242  NVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEYE 301
              +  L+L   + + L  I+  F K   S  + ++   V +++   +A L +N N+ E E
Sbjct: 245  EAIDLLRLHQTVLKCLTTIRTGFPKKLSSDTIGRELTTVLIENFTRVAAL-SNDNT-EEE 302

Query: 302  SISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFVS 361
              SE +++  I +V  L ++     G   +  ++        + +E  E W SDFN FVS
Sbjct: 303  KSSE-INEVGIQMVSLLATIPDRYLGGPALSKVVEDFVLASCLGTEEEEAWESDFNHFVS 361

Query: 362  KETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISKDIER-NTYDNQIXXXXXXXXXXXX 420
            KE GLA+SY +RD+ S+               ++   + + +  + ++            
Sbjct: 362  KEVGLASSYYIRDECSQFLQEISGARYQSIFEILVSALSKVDPLEWRLKEAVFYLIQSLC 421

Query: 421  XNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTL---ARAILVIPKVLDKFIDVLPDI 477
             N+DE+T  N +E    L +  QN+    E + L L    RAIL +PKV++KF+D L ++
Sbjct: 422  INEDEVTVFNNNEVFDLLNELRQNM----EGQNLQLHVRTRAILALPKVVEKFMDRLENV 477

Query: 478  KSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQII 537
            K +  + L  +L+ A + ++  +K++ALIAF+ Y  FAELDSVLG +   E +  V+ +I
Sbjct: 478  KDIVKELLFATLNGACEDNDPTLKASALIAFSSYASFAELDSVLGLEAFQEARCLVLNLI 537

Query: 538  NDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEIL--QAEFHLVFTISSKDPANVQVV 595
             D+  DSE+DT   ++E L+  ++   K  ++ ++ L  Q   +LV  IS+KDP+N+QVV
Sbjct: 538  QDVLEDSEDDTPAVLLEALNPALA---KQSNTTKDTLFYQQALNLVLKISAKDPSNLQVV 594

Query: 596  VQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLK 655
            +++Q+C+  LL   + ++Y    + C+P F+N+L +   NNY Y+P++SL LE +TVF+K
Sbjct: 595  LEAQDCISALLSGESTESYVELSKSCIPLFVNILGTMKANNYIYAPIVSLSLELLTVFMK 654

Query: 656  KKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIM 715
            KKP DGFLP  I+ Y+FEPL+ +L+ SS++E LQ+A+++ +YL+ N+    +EP L  ++
Sbjct: 655  KKPSDGFLPSNISSYVFEPLSDILINSSDDEILQVASDALTYLMSNSQASDLEPLLPTVL 714

Query: 716  KVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQN 775
             +LE+LLS+  SDS AMNVG LVV    K+S  +Q +  +ILEA   R V A+N++T +N
Sbjct: 715  SILEKLLSVNTSDSGAMNVGSLVVITLEKYSYQLQEVYPKILEAATKRFVSAKNVATTEN 774

Query: 776  LLSVLCFLTCNDSRQTVEFLSNFRIDDK--NALSLVMQKWMEAFEVIRGEKRIKENIVAL 833
            L+ V C+LT  +  + + FLS+F I++K  N+L+ V+ KW+E+FEV+RGE+RIKENIVAL
Sbjct: 775  LVFVFCYLTSINPAEAINFLSSFTINEKEGNSLNYVLPKWLESFEVLRGERRIKENIVAL 834

Query: 834  SNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGF 893
            S +FF  D R+  V+VNGD +PY+ D+I+TRSMAK+MP  Y ++  + KI+KLFV+EL F
Sbjct: 835  SKIFFQSDPRVGSVIVNGDPLPYKGDIIVTRSMAKKMPIEYTRITAHEKIVKLFVAELEF 894

Query: 894  QNKQPDPKQLITSNMQHXXXXXXXXXXXXXXXXXXX------XXXYEKLKEYINXXXXXX 947
            Q+ QP   + +  N +                             Y++L++++       
Sbjct: 895  QSSQPSLDKFLPVNARKFDTSSSFNNNAEDEQDDGEWEDVDDVLEYDQLQQFVVEDGERN 954

Query: 948  XXXXXXXITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004
                   +  + D+++S  ++L+ FFKE A K+++    +YE LS+ ++K+LSE L+
Sbjct: 955  DSDDEDSLANIQDIQQSTKELLIDFFKEAAAKNINNLRDLYENLSEHEKKILSENLM 1011

>KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1021

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/1010 (36%), Positives = 580/1010 (57%), Gaps = 12/1010 (1%)

Query: 3    IDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLR 62
            + E +  AQS +   RE +E  L   C  N S   T+L  +A   ++ +E R F+LLSLR
Sbjct: 16   LKEAIVGAQSTNGQVRENSENALWSLCSENPSATCTSLMQLACGIENAVEDRIFSLLSLR 75

Query: 63   KLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVD 122
            KLITMYWS GFESYR    +    K  IRE LL L L+D+++T++ N +SYCIVQI+AVD
Sbjct: 76   KLITMYWSAGFESYRGPPGIGDEGKRMIRESLLNLGLDDSQDTRLKNCSSYCIVQIAAVD 135

Query: 123  FPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVLAT 182
            FPD+WP L+  I+DAI  + SL+A+ +LNEI+DDVVSEEMFF  GIG +T+Q+IF++L+ 
Sbjct: 136  FPDEWPTLVDSIFDAILQRQSLSALYVLNEIFDDVVSEEMFFHRGIGWQTIQLIFRILSN 195

Query: 183  DTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHSEN 242
              S+                Q+ S      +  K  +S  +  S+  L ++L     ++ 
Sbjct: 196  SDSSTQAKTASAKLYQACLLQLQSPMATSTQDYKYALSNHIQESVLLLIKVLKEHHIAKG 255

Query: 243  V-VSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEYE 301
            +  S L L+ ++   L  IK  FSK  F+I+  ++      ++   IA L  +  +I+ +
Sbjct: 256  INTSALNLQQVLLSCLNTIKTGFSKKLFTIESAQELIEFLFENFRKIAELCIDV-TIDPD 314

Query: 302  SISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFVS 361
             +  A ++  I +V    ++      ++  + I+ S      ++ E  E W +DFN F S
Sbjct: 315  -MKLAANEVGIQMVSLFATLMDTLTENQNWNFIVESFVIAGMISDEDAECWDNDFNVFAS 373

Query: 362  KETGLAASYNVRDQSSEXXXXXXXXXXXXXXXVISKDIERNTYDN-QIXXXXXXXXXXXX 420
            KETGL+ S+ VRD+  +                ++  +  N   N ++            
Sbjct: 374  KETGLSTSFTVRDECEQFMQGLSGFAYNSVFNALTSALIYNESPNWKVQESILFFIQALC 433

Query: 421  XNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDIKSL 480
             N+D+    N +++ Q+L+ T + +L   +   L   R+++ +PKV+++F++ L  +K+L
Sbjct: 434  GNEDDEVSFNFEKT-QSLLNTLRQILELEDSHILVKTRSLIALPKVIERFMETLESVKAL 492

Query: 481  TSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQIINDI 540
                L  S  LA +  +  +K   LI+FTYY  FAELDSVLGP    E Q  V  II ++
Sbjct: 493  VKDSLFHSFSLARQTPSYTVKIGCLISFTYYASFAELDSVLGPGFYGEAQRSVSAIIQEL 552

Query: 541  NSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQSQE 600
              ++EEDT   ++E L+  +S N K  ++     Q    L+  ISSK P+N+QV +++Q+
Sbjct: 553  LEEAEEDTPSILLEALAPTLSSNHKTTETIS-FYQLALQLILKISSKHPSNIQVGLEAQD 611

Query: 601  CLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKKPID 660
            CL  LL   + + Y  Y + C+P F NVL+    N + Y+P++ L LE +TVF+K+KP D
Sbjct: 612  CLSNLLKSTSTEEYVTYSKTCIPLFANVLNGMIENKFAYAPIVCLSLEMLTVFIKRKPRD 671

Query: 661  GFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKVLER 720
            G LP +IT Y+F PL+ +L+ SS++E +QL +++  YLI N++   + P L  ++  LE+
Sbjct: 672  GCLPSDITSYVFNPLSDILINSSDDEIMQLTSDALVYLISNSEPHQLFPHLNVVLCDLEK 731

Query: 721  LLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLLSVL 780
            LLS E SDS A++VG LVV +  KFSK +Q +  RILEA   + + A N+ T +NL +V 
Sbjct: 732  LLSAETSDSGAIHVGNLVVVVLEKFSKQLQEIYPRILEAATKKFLGAHNVFTTENLANVF 791

Query: 781  CFLTCNDSRQTVEFLSNFRID--DKNALSLVMQKWMEAFEVIRGEKRIKENIVALSNLFF 838
            C+L   +  + + FLS+F ID  +++ L  V+ KW+E+FEV+RGEKRIKENI+ALS LFF
Sbjct: 792  CYLVSLNPAEVINFLSSFSIDQQEQSVLCPVLSKWLESFEVLRGEKRIKENIMALSKLFF 851

Query: 839  LDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQNKQP 898
              D+R+ K+ VNGD IPY  D+IITRSMAK MP++Y ++  Y KI+KLFV+EL FQ  Q 
Sbjct: 852  QADSRIDKIYVNGDPIPYSGDMIITRSMAKSMPEKYTRITAYQKIVKLFVAELDFQTSQT 911

Query: 899  DPKQLITSNMQHXXXXXXXXXXXXXXXXXXX----XXXYEKLKEYINXXXXXXXXXXXXX 954
            D ++ I  + +                           YE+L+ +++             
Sbjct: 912  DLEKYIPMSAKKTECSTIANAEAGQEESDWEDVDDVLEYEQLQHFVDQDTFSSDRDEEDV 971

Query: 955  ITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004
            I G+ +V++S  ++L+ FFKE A+++++ F  IY+ LS++++++LSE L+
Sbjct: 972  IPGIKNVQQSTRELLISFFKEAASQNINDFKTIYDNLSENEKRILSENLV 1021

>KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar to
           uniprot|P53067 Saccharomyces cerevisiae YGL241W KAP114
           Karyopherin, responsible for nuclear import of Spt15p,
           histones H2A and H2B, and Nap1p; amino terminus shows
           similarity to those of other importins, particularly
           Cse1p; localization is primarily nuclear
          Length = 952

 Score =  310 bits (795), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 250/914 (27%), Positives = 430/914 (47%), Gaps = 68/914 (7%)

Query: 1   MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60
           M+I  L+   QS  K  RE AE  LL+ C ++    F  L + A  + +   +RQ ALL 
Sbjct: 1   MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60

Query: 61  LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120
           LRK  TMYWS GF S+     V    KD +R  LL L  N++   K+I+  +YCIVQI A
Sbjct: 61  LRKFTTMYWSAGFPSFVGPPGVGEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120

Query: 121 VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180
           VDFPD+WP LL  + + I + HS NA+SLL E+  D+++ EMFF+   G + V  +   L
Sbjct: 121 VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180

Query: 181 ATDTSTLVXXXXXXXXXXXXXXQMSSHNGYDEESRKS--------FISQCLSTSLQRLGQ 232
             DT  L               Q+ + + +      S         ++ C+   L+  G 
Sbjct: 181 NDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGN 240

Query: 233 LL---TMGFHSENVVSQLKL----KSIIYENLVLIKNDFS-KNHFSIDLQKQFKIVTVQD 284
            +    +G   E  ++  KL    +SI+  N      D S +   ++D  K        +
Sbjct: 241 NMESEVIGLKGELFMALSKLFDLNQSILGSN-----GDLSYRLRITLDAIKS-------N 288

Query: 285 LNNIAHLDTNGNSIEYESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQV 344
            N+ A   TN + +  E I+ +     I  V++L  + +    +  +         LC +
Sbjct: 289 ANSYARALTNNDELRLEIINSSC----INTVQYLAYIPSDLIENPTLPDFTEDFIKLCLL 344

Query: 345 NSEIMELWISDFNTFVSKETGLAASYNVRDQSSEXXXXXXXXXXXXXX-XVISKDIERNT 403
             +  +L  SDFN F+SKETGL+ASYN RD+  +                V+ K ++  +
Sbjct: 345 PEDYFKL--SDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTS 402

Query: 404 YDNQIXXXXXXXXXXXXXNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVI 463
            + Q              N+  +      + L   +    +      VK    +R IL I
Sbjct: 403 NEAQYQEACLFLFQELCSNETSMNVPRYQDFLSLAVMILDDDACPTFVK----SRTILTI 458

Query: 464 PKVLDKFIDVLPDIKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGP 523
           PK  +  ++ LP+IK L  +FL K+++  +  +++ + ++ +I+FTYY  FAEL S+L  
Sbjct: 459 PKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDY 518

Query: 524 DVCSEIQGKVIQIINDINSDSEEDTNGAIMEVLSQVIS--YNPKGLDSKEEILQAEFHLV 581
                +Q  +++ I  +  DSEED+ G ++E + +++   +  + L +K+EIL      +
Sbjct: 519 QTSMILQQSLLKAIKTLYVDSEEDSLGLLLEAMHEIVKTWHFQQDLHTKQEILNL----L 574

Query: 582 FTISSKDPANVQVVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSP 641
             +SS +P+NV++V +S   L  LL +IN  +Y    E C PSFI  + +   +   YSP
Sbjct: 575 LKLSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSP 634

Query: 642 LLSLVLEFITVFLKKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFN 701
           L+ L LEF++VFLK  P+   + DE+ +Y+  P+ + +    +E   + A ++F YL  N
Sbjct: 635 LVVLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACN 694

Query: 702 TDTQVMEPRLMDIMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVI 761
           ++ +  +  + D+  +   +   E S    ++V P+++             +G+I+E  I
Sbjct: 695 SNPKFWKDSMFDLCSL---VFDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTI 751

Query: 762 VRLVKAQNISTQQNLLSVLCFLTCNDSRQTVEFLSNFRIDDKNAL-SLVMQKWMEAFEVI 820
            +LV    +    + + + C +   D +  + ++ +  I  + ++ + ++++  + FE  
Sbjct: 752 SKLVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFDCFEEN 811

Query: 821 RGEKRIKENIVALSNLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLY 880
           R +  +KE  ++LS LFF +D RL                  TRS      D  V+ P  
Sbjct: 812 RSKNMLKEVALSLSELFFSNDQRL------------------TRSSYHDESDGVVR-PFK 852

Query: 881 TKIIKLFVSELGFQ 894
             I+K+F  EL  Q
Sbjct: 853 EYIVKMFADELTRQ 866

>NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 58/129 (44%), Gaps = 13/129 (10%)

Query: 5   ELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKL 64
           E     Q A    +++AE QL QW        +  L ++ L   + L+SR  A +  +  
Sbjct: 17  EQAGNPQQAGSQVQKSAEQQLKQWEIQPGYHYY--LQSIYLDLSNTLQSRWLAAIQFKNG 74

Query: 65  ITMYWSPGFESYRSTSVVEVNV--KDFIREVLLKLCLNDNENTKIINGASYCIVQISAVD 122
           +  YW       RS+ V  +N   K  IR  L +L   D +N ++    +  I +I+ +D
Sbjct: 75  VDRYW-------RSSRVHAINKDEKASIRARLFELI--DEQNNQLGIQYAQAIAKIARLD 125

Query: 123 FPDQWPQLL 131
           FP +WP L 
Sbjct: 126 FPAEWPDLF 134

>KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8.624
           YPL125W
          Length = 1041

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 65/147 (44%), Gaps = 16/147 (10%)

Query: 1   MNIDELVTRA---QSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFA 57
           +N+ +++ +A   Q A    ++ AE QL  W           L +V L   +PL+ R  A
Sbjct: 11  LNVVQMLEQAGNPQHAGSEIQKLAEQQLKAW--EIKPGFHHLLQSVYLDLSNPLQVRWLA 68

Query: 58  LLSLRKLITMYWSPGFESYRSTSVVEVNV--KDFIREVLLKLCLNDNENTKIINGASYCI 115
           ++  +  I  YW       RST V  ++   K  IR  L +L   D +N ++    +   
Sbjct: 69  VIQFKNGIDKYW-------RSTRVHAISKEEKSLIRSRLFELI--DEQNNQLTIQNAQAA 119

Query: 116 VQISAVDFPDQWPQLLTVIYDAISHQH 142
            +IS +DFP +WP L   +   +   H
Sbjct: 120 SKISRLDFPGEWPNLFEQLEHLLKDNH 146

>KNAG0J01420 Chr10 complement(260385..263546) [3162 bp, 1053 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1053

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 55/126 (43%), Gaps = 13/126 (10%)

Query: 5   ELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKL 64
           E  +  Q A    +  AETQL +W     S     L  + L   +PL+ R  A++  +  
Sbjct: 18  EQASNPQHAGSEVQRLAETQLKEW--EIQSGFHYILQTIYLDLSNPLQVRWLAVIQFKNG 75

Query: 65  ITMYWSPGFESYRSTSV--VEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVD 122
           I  YW       RST V  +  + K  IR  L  L   D +N ++    +    +I+ +D
Sbjct: 76  IERYW-------RSTRVNAIRKDEKASIRARLFDLI--DEQNNQLCIQNAQATSKIARLD 126

Query: 123 FPDQWP 128
           FP +WP
Sbjct: 127 FPAEWP 132

>TPHA0H01010 Chr8 (213903..217121) [3219 bp, 1072 aa] {ON} Anc_5.111
           YGR218W
          Length = 1072

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 65/126 (51%), Gaps = 20/126 (15%)

Query: 45  LQHQSPLESRQFALLSLRKLITMYWS--PGFESYRSTSVVEVNVKDFIREVLLKLCLND- 101
           LQ+   ++S+  AL  L  LI   W+  P  +        ++N++ FI  ++L +C +D 
Sbjct: 55  LQYSENIQSKFIALSILDNLIVSRWNMLPNDQ--------KINIRTFIVGMILSVCNDDS 106

Query: 102 --NENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISHQHSL--NAMSLLNEIYDDV 157
             N N ++IN A+  +VQI   D+P +W   L  + D+  +  ++  N + +L      V
Sbjct: 107 LFNSNRELINKANLVLVQIIKKDWPARWSNFLPELIDSSKYSENICQNNLEILK-----V 161

Query: 158 VSEEMF 163
           ++EE+F
Sbjct: 162 LAEEIF 167

>NCAS0C01430 Chr3 complement(262823..265912) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 60/140 (42%), Gaps = 13/140 (9%)

Query: 5   ELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKL 64
           E     Q A    ++ AE+QL QW   +       L  + L   + L++R  A++  +  
Sbjct: 17  EQAGNPQQAGSQVQKLAESQLKQWEVQSGYHFL--LQTIYLDLSNSLQTRWLAVIQFKNG 74

Query: 65  ITMYWSPGFESYRSTSVVEVNV--KDFIREVLLKLCLNDNENTKIINGASYCIVQISAVD 122
           +  YW       RST V  +N   K  IR  L  +   D +N ++    +    +I+ +D
Sbjct: 75  VDKYW-------RSTRVHCINKDEKASIRTRLFDMI--DEQNNQLGIQYAQATARIARLD 125

Query: 123 FPDQWPQLLTVIYDAISHQH 142
           FP +WP L   +   + + H
Sbjct: 126 FPVEWPNLFETLKSLLENDH 145

>TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1031

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 58/138 (42%), Gaps = 13/138 (9%)

Query: 7   VTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLIT 66
            +  Q A    ++AAE QL +W           L ++ L   + L+ R  A++  +  + 
Sbjct: 19  ASNPQHAGSEVQKAAEQQLREWQQQPGFHFL--LQSIYLNLSNSLQIRWLAVIQFKNGVE 76

Query: 67  MYWSPGFESYRSTSVVEVNV--KDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFP 124
            YW       RST +  +N   K  IR  L  L    N    I N  +    +I+ +DFP
Sbjct: 77  KYW-------RSTRINAINKDEKISIRGRLFDLIDEQNNQLSIQNAQA--AAKIARLDFP 127

Query: 125 DQWPQLLTVIYDAISHQH 142
            +WP L   +   +S+ H
Sbjct: 128 VEWPNLFEQLEQLLSNDH 145

>Kpol_1050.49 s1050 (111270..114521) [3252 bp, 1083 aa] {ON}
           (111270..114521) [3252 nt, 1084 aa]
          Length = 1083

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 48/94 (51%), Gaps = 9/94 (9%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ+ +  +++   L  L KLIT  W       R      V ++DFI  +++ +C +
Sbjct: 51  ADKILQYSNNPQTKFIGLTILDKLITTKWKLLPNEQR------VGIRDFIVGMIISMCQD 104

Query: 101 DN--ENTK-IINGASYCIVQISAVDFPDQWPQLL 131
           DN  +N K +IN +   +VQI   ++P  WP  +
Sbjct: 105 DNVFQNQKNLINKSDLTLVQILKQEWPQNWPNFI 138

>SAKL0G15180g Chr7 (1306761..1310015) [3255 bp, 1084 aa] {ON} highly
           similar to uniprot|P30822 Saccharomyces cerevisiae
           YGR218W CRM1 Major karyopherin involved in export of
           proteins RNAs and ribosomal subunits from the nucleus
          Length = 1084

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 74/165 (44%), Gaps = 27/165 (16%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ     +++   L  L KLIT  W    + +R      + +++FI  +++ LC +
Sbjct: 51  ADKILQFSDNPQTKFIGLSILDKLITTRWKMLPQEHR------IGIRNFIVGMIITLCQD 104

Query: 101 DN---ENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISHQHSLNA-------MSLL 150
           DN       +IN +   +VQI   ++P  WP  +  +    S + S+N        + LL
Sbjct: 105 DNVFQTQKNLINKSDLTLVQILKQEWPQNWPDFIPELVS--SSESSINVCENNMVILKLL 162

Query: 151 NEIYDDVVSEEMFFEGGIGL---------ETVQIIFKVLATDTST 186
           +E   D  +E+M     + L         +  ++ F+VL + +ST
Sbjct: 163 SEEIFDFSAEQMTQAKALHLKKSMSKEFEQIFKLCFRVLDSGSST 207

>Suva_7.513 Chr7 (888432..891683) [3252 bp, 1084 aa] {ON} YGR218W
           (REAL)
          Length = 1084

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 94/202 (46%), Gaps = 28/202 (13%)

Query: 3   IDELVTRAQSADKLTREAAETQLLQWCDS-NASQMFTALANVALQHQSPLESRQFALLSL 61
           +D++VT       + ++ A+  L ++ D+ +A Q     A+  LQ  +  +S+  AL  L
Sbjct: 16  LDQVVTTFYQGSGVQQKQAQEILTKFQDNPDAWQK----ADQILQFSTNPQSKFIALTIL 71

Query: 62  RKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLND---NENTKIINGASYCIVQI 118
            KLIT  W      +R      + +++F+  +++ +C +D        +IN +   +VQI
Sbjct: 72  DKLITRKWKLLPNDHR------IGIRNFVVGMIISMCQDDEAFKTQKNLINKSDLTLVQI 125

Query: 119 SAVDFPDQWPQLLTVIYDAISH-----QHSLNAMSLLNEIYDDVVSEEMFFEGGIGL--- 170
              ++P  WP+ +  +  + S      ++++  + LL+E   D  +E+M     + L   
Sbjct: 126 LKQEWPQNWPEFIPELIGSSSSSVNVCENNMIILKLLSEEVFDFSAEQMTQAKALHLKNS 185

Query: 171 ------ETVQIIFKVLATDTST 186
                 +  ++ F+VL   +ST
Sbjct: 186 MSKEFEQIFKLCFQVLEQGSST 207

>Skud_7.555 Chr7 (907277..910531) [3255 bp, 1084 aa] {ON} YGR218W
           (REAL)
          Length = 1084

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 94/202 (46%), Gaps = 28/202 (13%)

Query: 3   IDELVTRAQSADKLTREAAETQLLQWCDS-NASQMFTALANVALQHQSPLESRQFALLSL 61
           +D++VT       + ++ A+  L ++ D+ +A Q     A+  LQ  +  +S+  AL  L
Sbjct: 16  LDQVVTTFYQGSGVQQKQAQEILTKFQDNPDAWQK----ADQILQFSTNPQSKFIALSIL 71

Query: 62  RKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLND---NENTKIINGASYCIVQI 118
            KLIT  W      +R      + +++F+  +++ +C +D        +IN +   +VQI
Sbjct: 72  DKLITRKWKLLPNDHR------IGIRNFLVGMIISMCQDDEVFKTQKNLINKSDLTLVQI 125

Query: 119 SAVDFPDQWPQLLTVIYDAISH-----QHSLNAMSLLNEIYDDVVSEEMFFEGGIGL--- 170
              ++P  WP+ +  +  + S      ++++  + LL+E   D  +E+M     + L   
Sbjct: 126 LKQEWPQNWPEFIPELIGSSSSSVNVCENNMIVLKLLSEEVFDFSAEQMTQAKALHLKNS 185

Query: 171 ------ETVQIIFKVLATDTST 186
                 +  ++ F+VL   +ST
Sbjct: 186 MSKEFEQIFKLCFQVLEQGSST 207

>TPHA0A04970 Chr1 (1123879..1127136) [3258 bp, 1085 aa] {ON}
           Anc_5.111 YGR218W
          Length = 1085

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 64/130 (49%), Gaps = 14/130 (10%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ  +  +++   L  L KLIT  W    +  R      V ++DF+  +++ LC +
Sbjct: 51  ADKILQFSNNSQAKFIGLSILDKLITTKWKLLPQEQR------VGIRDFVVGMVISLCQD 104

Query: 101 DN--ENTK-IINGASYCIVQISAVDFPDQWPQLLTVIYDAISH-----QHSLNAMSLLNE 152
           DN  +N K +IN     +VQI   ++P  WP  +  +  + S      ++++  + LL+E
Sbjct: 105 DNVFKNEKNLINKCDLTLVQILKQEWPQNWPNFIPELIGSSSSSVNVCENNMIILKLLSE 164

Query: 153 IYDDVVSEEM 162
              D  +E+M
Sbjct: 165 EVFDFSAEQM 174

>KLLA0E16061g Chr5 complement(1428731..1431991) [3261 bp, 1086 aa]
           {ON} highly similar to uniprot|P30822 Saccharomyces
           cerevisiae YGR218W CRM1 Major karyopherin involved in
           export of proteins RNAs and ribosomal subunits from the
           nucleus
          Length = 1086

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 64/132 (48%), Gaps = 18/132 (13%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ+ +  +++   L  L KLIT  W    + +R      + +++FI  +++ +C +
Sbjct: 51  ADKILQYSNNPQTKFIGLSILDKLITTKWKMLPQEHR------LGIRNFIVGMIISMCQD 104

Query: 101 DN---ENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISHQHSLNA-------MSLL 150
           D        +I+ +   +VQI   D+P+ WP  +  +   +S Q S+N        + LL
Sbjct: 105 DQVFQTQKNLIHKSDLTLVQILKQDWPENWPDFIPEL--VLSSQASVNVCENNMVMLKLL 162

Query: 151 NEIYDDVVSEEM 162
           +E   D  +E+M
Sbjct: 163 SEEVFDFSAEQM 174

>SAKL0H07876g Chr8 (674192..677290) [3099 bp, 1032 aa] {ON} highly
           similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1032

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 58/141 (41%), Gaps = 19/141 (13%)

Query: 7   VTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLIT 66
            +  Q A    +  AE QL  W     S     L ++ L     L+ R  A++  +  I 
Sbjct: 20  ASNPQHAGSQVQRLAEQQLKTW--ETQSGYHYLLQSIYLDLSCSLQIRWLAIIQFKNGIE 77

Query: 67  MYWSPGFESYRSTSV--VEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFP 124
            YW       RST V  +  + K  IR  L  +   D +N ++    +    +I+ +DFP
Sbjct: 78  RYW-------RSTRVNAISKDEKASIRSRLFDMI--DEQNNQLCIQNAQASARIARLDFP 128

Query: 125 DQWPQLLTVIYDAISHQHSLN 145
           ++WP L   +      +H LN
Sbjct: 129 NEWPNLFEFL------EHMLN 143

>Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {ON}
           YPL125W (KAP120) - karyopherin [contig 67] FULL
          Length = 1034

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 64/152 (42%), Gaps = 20/152 (13%)

Query: 11  QSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYWS 70
           + A    ++ AE QL QW           L ++ L    PL  R  A++  +  +  +W 
Sbjct: 23  RHAGSQIQKQAEQQLKQWETQEGFHYL--LQSIYLDLSCPLNVRWLAIIQFKNGVEKFW- 79

Query: 71  PGFESYRSTSV--VEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPDQWP 128
                 RST V  +    K  IR  L  L   D +N ++    S    +I+ +DFP +WP
Sbjct: 80  ------RSTRVNAIRKEEKVSIRTRLFDLI--DEKNNQLCIQNSQATARIARLDFPGEWP 131

Query: 129 QLLTVI-----YDAISHQH--SLNAMSLLNEI 153
            L   +     YD I   +  + N + ++N+I
Sbjct: 132 GLFDQLEKLLSYDKIWQDNIKTYNLLLIMNQI 163

>TDEL0G01360 Chr7 complement(270498..273767) [3270 bp, 1089 aa] {ON}
           Anc_5.111 YGR218W
          Length = 1089

 Score = 39.7 bits (91), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 73/165 (44%), Gaps = 27/165 (16%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ  +  +S+   L  L KLIT  W    E  R      V +++F+  +++ +C +
Sbjct: 51  ADKILQFSNNPQSKFIGLTILDKLITTKWKLLPEEQR------VGIRNFVVGMIITMCQD 104

Query: 101 D---NENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISHQHSLNA-------MSLL 150
           D   +    +IN +   +VQI   ++P  WP  +  +    S   SLN        + LL
Sbjct: 105 DALFHSQKNLINKSDLTLVQILKQEWPQNWPDFIPELIG--SSNSSLNVCENNMIILKLL 162

Query: 151 NEIYDDVVSEEMFFEGGIGLET---------VQIIFKVLATDTST 186
           +E   D  +E+M     + L+T          ++ ++VL   +ST
Sbjct: 163 SEEVFDFSAEQMTQAKSLHLKTSMSKEFEQIFKLCYQVLEQGSST 207

>YGR218W Chr7 (932541..935795) [3255 bp, 1084 aa] {ON}  CRM1Major
           karyopherin, involved in export of proteins, RNAs, and
           ribosomal subunits from the nucleus; exportin
          Length = 1084

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 63/130 (48%), Gaps = 14/130 (10%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ  +  +S+  AL  L KLIT  W      +R      + +++F+  +++ +C +
Sbjct: 51  ADQILQFSTNPQSKFIALSILDKLITRKWKLLPNDHR------IGIRNFVVGMIISMCQD 104

Query: 101 D---NENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISH-----QHSLNAMSLLNE 152
           D        +IN +   +VQI   ++P  WP+ +  +  + S      ++++  + LL+E
Sbjct: 105 DEVFKTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSSSSVNVCENNMIVLKLLSE 164

Query: 153 IYDDVVSEEM 162
              D  +E+M
Sbjct: 165 EVFDFSAEQM 174

>Ecym_2068 Chr2 (114936..118184) [3249 bp, 1082 aa] {ON} similar to
           Ashbya gossypii ADL128C
          Length = 1082

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 18/132 (13%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ  S  +++   L  L KLIT  W      +R      V +++FI  +++ +C +
Sbjct: 51  ADKILQFSSNPQTKFIGLSILDKLITTKWKMLPRDHR------VGIRNFIVGMIISMCQD 104

Query: 101 D---NENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISHQHSLNA-------MSLL 150
           D        +IN +   +VQI   ++P  WP  +  +    S Q S+N        + LL
Sbjct: 105 DAVFQTQKNLINKSDLTLVQILKQEWPQNWPDFIPELVS--SSQSSINVCENNMVILKLL 162

Query: 151 NEIYDDVVSEEM 162
           +E   D  +E+M
Sbjct: 163 SEEVFDFSTEQM 174

>Kwal_27.9870 s27 complement(93662..96916) [3255 bp, 1084 aa] {ON}
           YGR218W (CRM1) - Chromosome region maintenance protein
           [contig 43] FULL
          Length = 1084

 Score = 39.7 bits (91), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 72/165 (43%), Gaps = 27/165 (16%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ     +++   L  L KLI   W      +R      V +++FI  +++ LC +
Sbjct: 51  ADQILQFSQNPQTKFIGLSILDKLINTKWKMLPPEHR------VGIRNFIVGMIISLCQD 104

Query: 101 DN---ENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISHQHSLNA-------MSLL 150
           DN       +IN +   +VQI   ++P  WP  +  +    S Q S+N        + LL
Sbjct: 105 DNVFQSQKNLINKSDLTLVQILKQEWPQNWPDFIPELVQ--SAQSSVNVCENNMVILKLL 162

Query: 151 NEIYDDVVSEEMFFEGGIGLET---------VQIIFKVLATDTST 186
           +E   D  +E+M     + L+T          ++ F+V+   ++T
Sbjct: 163 SEEVFDFSAEQMTQAKALHLKTSMSKEFEQIYKLCFQVMEAGSTT 207

>ADL128C Chr4 complement(464142..467390) [3249 bp, 1082 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR218W
           (CRM1)
          Length = 1082

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 61/132 (46%), Gaps = 18/132 (13%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ  +  +++   L  L +LIT  W    + +R      V +++FI  +++ LC +
Sbjct: 51  ADKILQFSANPQTKFIGLSILDRLITTKWKMLPQDHR------VGIRNFIVGMIISLCQD 104

Query: 101 D---NENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISHQHSLNA-------MSLL 150
           D        +IN +   +VQI   ++P  WP  +  +    S Q S+N        + LL
Sbjct: 105 DAVFQSQKNLINKSDLTLVQILKQEWPQNWPDFIPELVS--SSQSSINVCENNMVILKLL 162

Query: 151 NEIYDDVVSEEM 162
           +E   D  +E+M
Sbjct: 163 SEEVFDFSTEQM 174

>SAKL0B04312g Chr2 complement(385051..387636) [2586 bp, 861 aa] {ON}
           highly similar to uniprot|Q06142 Saccharomyces
           cerevisiae YLR347C KAP95 Karyopherin beta forms a
           dimeric complex with Srp1p (Kap60p) that mediates
           nuclear import of cargo proteins via a nuclear
           localization signal (NLS) interacts with nucleoporins to
           guide transport across the nuclear pore complex
          Length = 861

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 61/128 (47%), Gaps = 5/128 (3%)

Query: 12  SADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYWSP 71
           SAD   R  +ETQL +  + N  Q    L+ +       LE+R  A LSL+  +    S 
Sbjct: 16  SADPTVRLQSETQLKKLSNDNFLQFAGLLSQILADESVRLEARILAALSLKNELISKNSV 75

Query: 72  GFESY--RSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFP-DQWP 128
             + +  R  + ++   K+ I++  L   L  +   ++ N ++  I  I+ ++ P  +WP
Sbjct: 76  KSQQFAQRWLTQIDTESKNHIKKFALGALL--SPEARVANASAQLIAAIADIELPRGEWP 133

Query: 129 QLLTVIYD 136
           +L+ ++ D
Sbjct: 134 ELMKIMVD 141

>Ecym_2590 Chr2 complement(1149034..1151901) [2868 bp, 955 aa] {ON}
           similar to Ashbya gossypii AFR273W
          Length = 955

 Score = 38.9 bits (89), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 111/236 (47%), Gaps = 24/236 (10%)

Query: 581 VFTISSKDPANVQVVVQSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYS 640
           + TI +K+P+N +    + E L  ++ + N DN  + IE  +P F+N+L ++ +  +   
Sbjct: 601 IITIIAKNPSNPRFTHYTFESLSVVI-KFNHDNLASIIEAIMPIFLNIL-ADDIQEF--- 655

Query: 641 PLLSLVLEFITVFLKKKPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYL-- 698
             +  V + I   +++ P +  +P+ I Q L++PL    V+      L+    + + L  
Sbjct: 656 --MPYVFQIIAYCVEQLPSNMGIPEAIAQ-LYQPLLSPTVWD-----LKGCVPAVTRLLK 707

Query: 699 -IFNTDTQVMEPRLMDIMKVLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRIL 757
            I   D     P L+ ++ + +RL++ +  D+    +   ++T +   SK +Q  + +I 
Sbjct: 708 DIIKHDPSAY-PNLIPVLGIFQRLIASKAYDTHGFELLEYIIT-YIPLSK-LQDYLKQIA 764

Query: 758 EAVIVRLVKAQNISTQQNLLSVLCFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKW 813
             ++ RL   Q   T++ +   + FL    ++   +F+  F ID+     L  Q W
Sbjct: 765 VLLLQRL---QGSRTEKYVKKFIVFLGVLSNKFDSDFVVRF-IDEVQP-ELFKQVW 815

>CAGL0G01144g Chr7 complement(108004..110589) [2586 bp, 861 aa] {ON}
           highly similar to uniprot|Q06142 Saccharomyces
           cerevisiae YLR347c KAP95 karyopherin-beta
          Length = 861

 Score = 38.5 bits (88), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 64/128 (50%), Gaps = 5/128 (3%)

Query: 12  SADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYWSP 71
           S D+  R  +ETQL +  + N  Q    LA V +  ++ +E+R  A LSL+  +    S 
Sbjct: 16  SPDQNVRLTSETQLKKLSNENFLQYAGLLAQVLVLPEAKVEARILAALSLKNELVSKDSI 75

Query: 72  GFESY--RSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFP-DQWP 128
             + +  R  + ++   K  I+   L + L DNE  ++ N ++  I  I+ ++ P  +WP
Sbjct: 76  KNQQFAQRWATTIDPESKQQIKSNALAV-LMDNE-PRVANASAQLIAAIADIELPRGEWP 133

Query: 129 QLLTVIYD 136
            L+ ++ D
Sbjct: 134 DLMQIMVD 141

>Smik_16.86 Chr16 complement(160938..164192) [3255 bp, 1084 aa] {ON}
           YGR218W (REAL)
          Length = 1084

 Score = 38.5 bits (88), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 63/130 (48%), Gaps = 14/130 (10%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ  +  +S+  AL  L KLIT  W      +R      + +++FI  +++ +C +
Sbjct: 51  ADQILQFSTNPQSKFIALSILDKLITRKWKLLPNDHR------IGIRNFIVGMIISMCQD 104

Query: 101 D---NENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISH-----QHSLNAMSLLNE 152
           +        +IN +   +VQI   ++P  WP+ +  +  + S      ++++  + LL+E
Sbjct: 105 EEVFKTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSSSSVNVCENNMIVLKLLSE 164

Query: 153 IYDDVVSEEM 162
              D  +E+M
Sbjct: 165 EVFDFSAEQM 174

>KLTH0D10010g Chr4 complement(830376..833480) [3105 bp, 1034 aa]
           {ON} similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1034

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 49/123 (39%), Gaps = 13/123 (10%)

Query: 11  QSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYWS 70
           + A    +  AE QL  W           L +V L    PL+ R  A++  +  +  YW 
Sbjct: 24  RHAGSQAQRFAEQQLKLWETQKGFHFL--LQSVYLNLSCPLDVRWLAIIQFKNGVEKYW- 80

Query: 71  PGFESYRSTSV--VEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPDQWP 128
                 RST +  +  + K  IR  L  L   +N    I N  S    +I+ +DFP  WP
Sbjct: 81  ------RSTRINAIGKDEKASIRARLFDLIDENNNQLGIQN--SQAAARIARLDFPGDWP 132

Query: 129 QLL 131
            L 
Sbjct: 133 TLF 135

>KLTH0G17600g Chr7 (1523631..1526225) [2595 bp, 864 aa] {ON} highly
           similar to uniprot|Q06142 Saccharomyces cerevisiae
           YLR347C KAP95 Karyopherin beta forms a dimeric complex
           with Srp1p (Kap60p) that mediates nuclear import of
           cargo proteins via a nuclear localization signal (NLS)
           interacts with nucleoporins to guide transport across
           the nuclear pore complex
          Length = 864

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 61/138 (44%), Gaps = 7/138 (5%)

Query: 12  SADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLR-KLITMYWS 70
           S D   R   ETQL +  + N  Q    LA V       LE+R  A LS++ +L++    
Sbjct: 18  SPDATVRLQCETQLKKLSNENFLQFVGLLAQVLADETCRLEARILAGLSIKNELVS---K 74

Query: 71  PGFESYRSTSVVEVNVKDFIREVLLKLCLN--DNENTKIINGASYCIVQISAVDFP-DQW 127
              +S + T      V D  R  + +L L        ++ N ++  I  I+ ++ P +QW
Sbjct: 75  DSVKSQQLTQRWLTQVDDASRAHIRQLALAALATPEPRVANASAQLIAAIATIELPRNQW 134

Query: 128 PQLLTVIYDAISHQHSLN 145
           P L+ ++ D  + Q   N
Sbjct: 135 PDLMKIMVDNTAAQQPEN 152

>KLLA0B05665g Chr2 (510167..512752) [2586 bp, 861 aa] {ON} highly
           similar to uniprot|Q06142 Saccharomyces cerevisiae
           YLR347C KAP95 Karyopherin beta forms a dimeric complex
           with Srp1p (Kap60p) that mediates nuclear import of
           cargo proteins via a nuclear localization signal (NLS)
           interacts with nucleoporins to guide transport across
           the nuclear pore complex
          Length = 861

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 69/137 (50%), Gaps = 5/137 (3%)

Query: 12  SADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLR-KLITMYWS 70
           + D   R  AET L +  + N  Q    L+ +       LE+R  A L+L+ +LI+   +
Sbjct: 16  TPDPTVRLQAETTLKKLSNDNFLQFAGLLSQILADVSVRLEARILAGLTLKNELISKNPT 75

Query: 71  PGFE-SYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFP-DQWP 128
              + + R ++ V+   +  I++  L+  L D E T++ N ++  I  I+ ++ P +QWP
Sbjct: 76  KAQQFAQRWSTQVDAESRHHIKQFALQ-ALVDPE-TRVANASAQLIAAIAEIELPLNQWP 133

Query: 129 QLLTVIYDAISHQHSLN 145
           +L+ ++ D  + +   N
Sbjct: 134 ELMKIMVDNTAQEQPEN 150

>Smik_6.324 Chr6 complement(507726..510824) [3099 bp, 1032 aa] {ON}
           YPL125W (REAL)
          Length = 1032

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 65/136 (47%), Gaps = 16/136 (11%)

Query: 1   MNIDELVTRAQSADKLTREA---AETQLLQWCDSNASQMFTALANVALQHQSPLESRQFA 57
           +N+ +++ +A +   +  E    AE QL QW ++ A   F  L ++ L   + L+ R  A
Sbjct: 8   LNLVQVLEQASNPQHIRSEVQKLAEQQLKQW-ETQAGFHFL-LQSIYLNLSNSLQIRWLA 65

Query: 58  LLSLRKLITMYWSPGFESYRSTSV--VEVNVKDFIREVLLKLCLNDNENTKIINGASYCI 115
           ++  +  +  YW       RS+ V  +  + K  IR  L ++   D +N ++    +   
Sbjct: 66  VIQFKNGVDKYW-------RSSRVNAIPKDEKASIRGRLFEMI--DEQNNQLCIQNAQAA 116

Query: 116 VQISAVDFPDQWPQLL 131
            +I+ +DFP +WP L 
Sbjct: 117 ARIARLDFPVEWPNLF 132

>TBLA0G01350 Chr7 complement(361561..364158) [2598 bp, 865 aa] {ON}
           Anc_4.180 YLR347C
          Length = 865

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 76/150 (50%), Gaps = 7/150 (4%)

Query: 12  SADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPL--ESRQFALLSLR-KLITMY 68
           + D+  R  +ETQL +  + N  Q    L+ V +    P+  E+R  A L+L+ +LI+  
Sbjct: 16  ATDQNVRLTSETQLKKLSNDNFIQFAGMLSQVLVDSSIPIKDEARILAALTLKNELISKD 75

Query: 69  WSPGFE-SYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFP-DQ 126
                + S R  + V++N K  I++  L   +++  + ++ N  +  I  I+ ++ P ++
Sbjct: 76  SVKNNQFSLRWINNVDMNSKLQIKQNALMALVSNVTSARVSNAVAQLIAAIANIELPRNE 135

Query: 127 WPQLLTVIYDAIS--HQHSLNAMSLLNEIY 154
           WP+LL ++ D  S   Q ++   SLL   Y
Sbjct: 136 WPELLKIMVDNTSSTQQENVKRASLLTLGY 165

>CAGL0B02189g Chr2 complement(202354..205617) [3264 bp, 1087 aa]
           {ON} highly similar to uniprot|P30822 Saccharomyces
           cerevisiae YGR218w CRM1
          Length = 1087

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 65/140 (46%), Gaps = 14/140 (10%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ      ++   L  L KLIT  W    + +R      + +++FI  +++ +C +
Sbjct: 51  ADKILQFSQNPHAKFIGLSILDKLITTKWKLLPQEHR------IGIRNFIVGMIISMCQD 104

Query: 101 DN---ENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISH-----QHSLNAMSLLNE 152
           D        +IN +   +VQI   ++P  WP+ +  +  + S      ++++  + LL+E
Sbjct: 105 DTVFQTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSSASVNVCENNMVILKLLSE 164

Query: 153 IYDDVVSEEMFFEGGIGLET 172
              D  +E+M     + L+T
Sbjct: 165 EVFDFSAEQMTQAKALHLKT 184

>ACR159C Chr3 complement(631643..634720) [3078 bp, 1025 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL125W
           (KAP120)
          Length = 1025

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 66/158 (41%), Gaps = 20/158 (12%)

Query: 5   ELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKL 64
           E  +  + A    ++ AE QL  W        F  L ++ L     L+ R  A++  +  
Sbjct: 15  ERASTPRGAQPEIQKQAEQQLKIWEVQAGYHFF--LQSIYLDLSCSLQIRWLAIIQFKNG 72

Query: 65  ITMYWSPGFESYRSTSV--VEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVD 122
           +  YW       R+T V  +  + K  IR  L ++   D +N ++    ++   +I+  D
Sbjct: 73  LDKYW-------RATRVNAISKDEKQSIRARLFEMV--DEQNNQLCIQNAHACARIARSD 123

Query: 123 FPDQWPQLLTVI------YDAISHQ-HSLNAMSLLNEI 153
           +P  WP L          YDA+ +   + N +  LN++
Sbjct: 124 YPHDWPDLFEYFEKALGDYDALQNNVRTYNVLVCLNQV 161

>NCAS0A03530 Chr1 complement(698730..701312) [2583 bp, 860 aa] {ON}
           Anc_4.180 YLR347C
          Length = 860

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 63/125 (50%), Gaps = 4/125 (3%)

Query: 12  SADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYWSP 71
           S D+  R  +ETQL +  + N  Q    L+ V +  Q  LE+R  A L+L+  +    S 
Sbjct: 16  SHDQNVRVQSETQLKKLSNENFLQFAGLLSEVLVDSQVRLEARMLAALTLKNELISKDSI 75

Query: 72  GFESYRSTSV-VEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPD-QWPQ 129
             + Y+   + +++N K  I+   L+  +N  +  ++ N  +  I  I+ ++ P+ QW +
Sbjct: 76  RNQQYKQRWLTLDINAKTQIKANALQALVNAED--RVANSTAQLIAAIADIELPEGQWDE 133

Query: 130 LLTVI 134
           L+ ++
Sbjct: 134 LMGIV 138

>Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL125W
           (REAL)
          Length = 1032

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 62/136 (45%), Gaps = 16/136 (11%)

Query: 1   MNIDELVTRAQSADKLTREA---AETQLLQWCDSNASQMFTALANVALQHQSPLESRQFA 57
           +N+ +++ +A +   +  E    AE QL QW     +     L ++ L   + L+ R  A
Sbjct: 8   LNLIQVLEQASNPQHIRSEIQKLAEQQLKQW--ETQAGFHYLLQSIYLNLSNSLQIRWLA 65

Query: 58  LLSLRKLITMYWSPGFESYRSTSV--VEVNVKDFIREVLLKLCLNDNENTKIINGASYCI 115
           ++  +  +  YW       RST +  +  + K  IR  L ++   D +N ++    +   
Sbjct: 66  VIQFKNGVDKYW-------RSTRINAISKDEKASIRGRLFEMI--DEQNNQLCIQNAQAA 116

Query: 116 VQISAVDFPDQWPQLL 131
            +I+ +DFP +WP L 
Sbjct: 117 ARIARLDFPVEWPNLF 132

>NCAS0A07450 Chr1 (1477489..1480743) [3255 bp, 1084 aa] {ON}
           Anc_5.111 YGR218W
          Length = 1084

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 74/163 (45%), Gaps = 23/163 (14%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ  +  +++   L  L KLI   W    E  R      + +++F+  +++ LC +
Sbjct: 51  ADKILQFSNNPQAKFIGLTILDKLINTKWKLLPEDQR------IGIRNFVVGMIITLCQD 104

Query: 101 DN---ENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISH-----QHSLNAMSLLNE 152
           D        +IN +   +VQI   ++P  WP+ +  +  + +      ++++  + LL+E
Sbjct: 105 DTVFQTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSTSSVNVCENNMVILKLLSE 164

Query: 153 IYDDVVSEEMFFEGGIGLET---------VQIIFKVLATDTST 186
              D  +E+M     + L+T          ++ F+VL   +ST
Sbjct: 165 EVFDFSAEQMTQAKALHLKTSMSKEFEQIFKLCFQVLEQASST 207

>KLTH0C02024g Chr3 complement(176824..180078) [3255 bp, 1084 aa]
           {ON} highly similar to uniprot|P30822 Saccharomyces
           cerevisiae YGR218W CRM1 Major karyopherin involved in
           export of proteins RNAs and ribosomal subunits from the
           nucleus
          Length = 1084

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 74/168 (44%), Gaps = 28/168 (16%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ     +++   L  L KLI   W      +R      V +++FI  +++ LC +
Sbjct: 51  ADQILQFSQNPQTKFIGLSILDKLINTKWKLLPPEHR------VGIRNFIVGMIISLCQD 104

Query: 101 D---NENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISHQHSLNA-------MSLL 150
           D        +IN +   +VQI   ++P  WP  +  +    S Q S+N        + LL
Sbjct: 105 DAVFQSQKNLINKSDLTLVQILKQEWPQNWPDFIPELVQ--SSQSSVNVCENNMVILKLL 162

Query: 151 NEIYDDVVSEEMFFEGGIGLET---------VQIIFKVL-ATDTSTLV 188
           +E   D  +E+M     + L+T          ++ F+V+ A  T++LV
Sbjct: 163 SEEVFDFSAEQMTQAKALHLKTSMSKEFEQIFKLCFQVMDAGSTTSLV 210

>CAGL0J06776g Chr10 (651309..654392) [3084 bp, 1027 aa] {ON} highly
           similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125w KAP120 nuclear transport factor
          Length = 1027

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 63/147 (42%), Gaps = 16/147 (10%)

Query: 1   MNIDELVTRAQSADKLTRE---AAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFA 57
           +N+ E++ +A     +  E    AE+QL  W           L ++ L   + L  R  A
Sbjct: 9   LNLVEVLQQASDMQHMGTERQRMAESQLKAWETQPGFHFL--LQSIYLDLSNGLHVRWLA 66

Query: 58  LLSLRKLITMYWSPGFESYRSTSVVEV--NVKDFIREVLLKLCLNDNENTKIINGASYCI 115
           ++  +  +  YW       R+T +  +  + K  IR+ L  +   D +N ++    +   
Sbjct: 67  VIQFKNGVEKYW-------RATRINSIGKDEKASIRKRLFDVV--DEQNNQLCIQNAQAT 117

Query: 116 VQISAVDFPDQWPQLLTVIYDAISHQH 142
            +IS +DFP +WP L   I   ++  H
Sbjct: 118 ARISRIDFPVEWPNLFESIEQLLNINH 144

>TBLA0J00470 Chr10 (85713..88823) [3111 bp, 1036 aa] {ON} Anc_8.624
           YPL125W
          Length = 1036

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 13/124 (10%)

Query: 13  ADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYWSPG 72
           A+   +  AE QL  W    A      L ++ L   +PL+ R  A++  +  +  YW   
Sbjct: 26  ANPNAQRLAEQQLKLW--ETALGFHYLLQSIYLDLSNPLQVRWLAVIQFKNGVERYW--- 80

Query: 73  FESYRSTSV--VEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPDQWPQL 130
               RST +  +  + K  IR  L ++   D +N ++    +    +I+ +DFP  W  L
Sbjct: 81  ----RSTRINAISKDEKASIRNRLFEVL--DEQNNQLCIQNAQATARIARLDFPSDWTNL 134

Query: 131 LTVI 134
              I
Sbjct: 135 FETI 138

>YPL125W Chr16 (313388..316486) [3099 bp, 1032 aa] {ON}
           KAP120Karyopherin responsible for the nuclear import of
           ribosome maturation factor Rfp1p
          Length = 1032

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 13/113 (11%)

Query: 21  AETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTS 80
           AE QL QW     +     L ++ L   + L+ R  A++  +  +  YW       RST 
Sbjct: 31  AEQQLRQW--ETQAGFHYLLQSIYLNLSNSLQIRWLAVIQFKNGVDKYW-------RSTR 81

Query: 81  V--VEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPDQWPQLL 131
           +  +  + K  IR  L ++   D +N ++    +    +I+ +DFP +WP L 
Sbjct: 82  INAIPKDEKASIRGRLFEMI--DEQNNQLCIQNAQASARIARLDFPVEWPTLF 132

>ZYRO0F06160g Chr6 complement(509916..513005) [3090 bp, 1029 aa]
           {ON} highly similar to uniprot|Q02932 Saccharomyces
           cerevisiae YPL125W KAP120 Karyopherin with a role in the
           assembly or export of 60S ribosomal subunits
          Length = 1029

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 60/144 (41%), Gaps = 13/144 (9%)

Query: 5   ELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKL 64
           E  +  Q A    +  AE QL +W           L ++ L   + L+ R  +++  +  
Sbjct: 17  EQASNPQHAGSEVQRLAERQLSEW--QTQPGFHYTLQSIYLDLSNSLQIRWLSVIQFKNG 74

Query: 65  ITMYWSPGFESYRSTSVVEVNV--KDFIREVLLKLCLNDNENTKIINGASYCIVQISAVD 122
           +  YW       RST +  ++   K  IR  L  L   D +N ++    +    +I+  D
Sbjct: 75  VDKYW-------RSTRLHAISKEEKSSIRARLFDLI--DEQNNQLCIQNAQATARIARYD 125

Query: 123 FPDQWPQLLTVIYDAISHQHSLNA 146
           FP +WP L   +    +++  +N+
Sbjct: 126 FPVEWPNLFEQLEQLFANEQLMNS 149

>Suva_16.185 Chr16 (322908..326006) [3099 bp, 1032 aa] {ON} YPL125W
           (REAL)
          Length = 1032

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 54/129 (41%), Gaps = 13/129 (10%)

Query: 5   ELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKL 64
           E  +  Q      ++ AE QL QW           L ++ L   + L+ R  A++  +  
Sbjct: 15  EQASNPQHLRSEVQKLAEQQLKQW--ETQPGFHYLLQSIYLNLSNSLQIRWLAVIQFKNG 72

Query: 65  ITMYWSPGFESYRSTSV--VEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVD 122
           +  YW       RST +  +  + K  IR  L ++   D +N ++    +    +I+ +D
Sbjct: 73  VDKYW-------RSTRINAIPKDEKASIRGRLFEMI--DEQNNQLCIQNAQAAARIARLD 123

Query: 123 FPDQWPQLL 131
           FP  WP L 
Sbjct: 124 FPVDWPNLF 132

>ACL187W Chr3 (30322..32907) [2586 bp, 861 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR347C (KAP95)
          Length = 861

 Score = 35.4 bits (80), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 65/137 (47%), Gaps = 5/137 (3%)

Query: 12  SADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLR-KLITMYWS 70
           S D   R  +ETQL +  + N  Q    L+ +       LE+R  A L+L+ +L++    
Sbjct: 16  SPDAGVRLQSETQLRKLSNDNFLQYAGTLSQLLADESVILEARILAALTLKNELVSKDPV 75

Query: 71  PGFE-SYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFP-DQWP 128
            G + + R   +V+   +  I++  L   +  ++  ++ N ++  I  I+ ++ P D+WP
Sbjct: 76  KGQQFAQRWLGLVDAESRHHIKQFALAALV--DKQPRVANASAQLIAAIADIELPRDEWP 133

Query: 129 QLLTVIYDAISHQHSLN 145
            L+ ++ +  +     N
Sbjct: 134 DLMKILVENTTQHQPEN 150

>Kpol_460.18 s460 complement(33770..36640) [2871 bp, 956 aa] {ON}
           complement(33770..36640) [2871 nt, 957 aa]
          Length = 956

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 74/179 (41%), Gaps = 23/179 (12%)

Query: 6   LVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLI 65
           + + A+SA++  RE            N       L +V      P+ +R    L  +  I
Sbjct: 16  VASTAKSAERSLREL----------ENQDGFGLTLLHVVASTNLPISTRLAGALFFKNFI 65

Query: 66  TMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPD 125
              W     +Y    ++ +N  D I++ ++ L +    N ++  G +  I+  S  DFP+
Sbjct: 66  RRKWVDEDGNY----LIPLNNVDLIKKEIVPLMITLPNNLQVQIGEAISIIADS--DFPN 119

Query: 126 QWPQLLTVIY------DAISHQHSLN-AMSLLNEIYDDVVSEEMFFEGGIGLETVQIIF 177
            WP LL  +       D ++++  L  A S+         S+E+F E  + L+T  I F
Sbjct: 120 NWPTLLNDLTSRLSADDMVTNKGVLTVAHSIFKRWRPLFRSDELFLEIKLVLDTFAIPF 178

>Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON}
           (33954..37046) [3093 nt, 1031 aa]
          Length = 1030

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 54/124 (43%), Gaps = 9/124 (7%)

Query: 18  REAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYR 77
           ++ AE QL +W           L  + L   + L+ R  A++  +  I  +W        
Sbjct: 27  QKLAEQQLKEWEIQPGYHYL--LQTIYLDLSNSLQIRWMAVIQFKNGIEKFWRSS----- 79

Query: 78  STSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDA 137
            T+ ++ + K  IR  L +L   D +N ++    S    +I+ +DFP  WP L   +   
Sbjct: 80  RTNAIKKDEKASIRARLFELI--DEQNNQLAIQNSQAAAKIARLDFPVDWPNLFEQLESL 137

Query: 138 ISHQ 141
           +S++
Sbjct: 138 LSNE 141

>TDEL0D02700 Chr4 (511059..513647) [2589 bp, 862 aa] {ON} Anc_4.180
           YLR347C
          Length = 862

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 64/137 (46%), Gaps = 4/137 (2%)

Query: 12  SADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYWSP 71
           S D+  R A+ETQL +  + N  Q    L++V +   + LE+R  A LSL+  +    S 
Sbjct: 16  SVDQGLRVASETQLKKLSNENFLQFAGLLSSVVVDSGAKLEARILAALSLKNELVSKDSV 75

Query: 72  GFESY--RSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFP-DQWP 128
             + Y  R  + ++   K+ I+   +   +  +E  ++ N ++  I  I+ ++ P  +W 
Sbjct: 76  KSQQYAQRWVATIDPASKEQIKVNAINGLMESSE-PRVANASAQLIAAIANIELPRGEWL 134

Query: 129 QLLTVIYDAISHQHSLN 145
            L+  + D  S     N
Sbjct: 135 DLMKTMVDNTSPSQPEN 151

>Kwal_27.12100 s27 (1084460..1087714) [3255 bp, 1084 aa] {OFF}
           YPL082C (MOT1) - putative helicase [contig 23] FULL
          Length = 1084

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 760 VIVRLVKAQNISTQQNLLSVLCFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEV 819
           ++V LVKAQ  S    ++  LC   C D+ +  EF  N    D + L+L+ ++   AF+ 
Sbjct: 450 LVVELVKAQKGSVANKIVKNLCGFLCVDTSEVPEFAPNSHYKD-SILTLIREQTALAFQD 508

Query: 820 IRGEKRIKEN 829
               K++ E+
Sbjct: 509 DANAKKLAED 518

>Kwal_YGOB_27.12097 s27 (1082859..1083947,1084163..1087714) [4641
           bp, 1546 aa] {ON} ANNOTATED BY YGOB -
          Length = 1546

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 760 VIVRLVKAQNISTQQNLLSVLCFLTCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEV 819
           ++V LVKAQ  S    ++  LC   C D+ +  EF  N    D + L+L+ ++   AF+ 
Sbjct: 912 LVVELVKAQKGSVANKIVKNLCGFLCVDTSEVPEFAPNSHYKD-SILTLIREQTALAFQD 970

Query: 820 IRGEKRIKEN 829
               K++ E+
Sbjct: 971 DANAKKLAED 980

>ZYRO0A12672g Chr1 complement(1006921..1009503) [2583 bp, 860 aa]
           {ON} highly similar to uniprot|Q06142 Saccharomyces
           cerevisiae YLR347C KAP95 Karyopherin beta forms a
           dimeric complex with Srp1p (Kap60p) that mediates
           nuclear import of cargo proteins via a nuclear
           localization signal (NLS) interacts with nucleoporins to
           guide transport across the nuclear pore complex
          Length = 860

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 68/148 (45%), Gaps = 7/148 (4%)

Query: 12  SADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYWSP 71
           + D+  R A ETQL +  + N  Q    L++V +   + LE+R  A L+L+  +    S 
Sbjct: 15  TPDQSLRVANETQLKKLSNENFLQFAGLLSSVLIDENARLEARILAALTLKNELVAKDSV 74

Query: 72  GFESY--RSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFP-DQWP 128
               Y  R  +VV+   KD I+   ++  L      ++ N ++  I  I+ ++ P  +W 
Sbjct: 75  KASQYAQRWITVVDPASKDQIKLNTVQALLTG--EPRVANASAQLIAAIANIELPRGEWG 132

Query: 129 QLLTVIYDAI--SHQHSLNAMSLLNEIY 154
            L+  + D+   S   ++   SLL   Y
Sbjct: 133 DLMKTMVDSTNPSQPENVKRASLLTLGY 160

>KAFR0B04170 Chr2 (866794..870048) [3255 bp, 1084 aa] {ON} Anc_5.111
           YGR218W
          Length = 1084

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 9/94 (9%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ      ++   L  L KLIT  W       R      V +++FI  +++ +C +
Sbjct: 51  ADQILQFSKNPHAKFIGLSILDKLITTKWKLLPNEQR------VGIRNFIVGMIISMCQD 104

Query: 101 D---NENTKIINGASYCIVQISAVDFPDQWPQLL 131
           D        +IN +   +VQ+   ++P  WP+ +
Sbjct: 105 DAVFKTQKNLINKSDLTLVQVLKQEWPQNWPEFI 138

>ZYRO0B15466g Chr2 complement(1256964..1260233) [3270 bp, 1089 aa]
           {ON} highly similar to uniprot|P30822 Saccharomyces
           cerevisiae YGR218W CRM1 Major karyopherin involved in
           export of proteins RNAs and ribosomal subunits from the
           nucleus
          Length = 1089

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 65/140 (46%), Gaps = 14/140 (10%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ     +++   L  L +LIT  W    +  R      V +++F+  +++ +C +
Sbjct: 51  ADQILQFSQNPQTKFIGLSILDRLITRKWKLLPQEQR------VGIRNFVVGMIISICQD 104

Query: 101 D---NENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISH-----QHSLNAMSLLNE 152
           D   +    +IN +   +VQI   ++P  WP  +  +  + +      ++++  + LL+E
Sbjct: 105 DSLFHTQKNLINKSDLTLVQILKQEWPQNWPDFIPELIGSSTSSINVCENNMVILKLLSE 164

Query: 153 IYDDVVSEEMFFEGGIGLET 172
              D  +E+M     + L+T
Sbjct: 165 EVFDFSAEQMTQAKSLHLKT 184

>Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON}
           similar to Ashbya gossypii ACR159C
          Length = 1027

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 49/122 (40%), Gaps = 10/122 (8%)

Query: 21  AETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTS 80
           AE QL  W          +L +V L     L+ R  A++  +     +W P        +
Sbjct: 31  AEEQLKLW--QGLPGYHYSLQSVYLNLSWSLQVRWLAIIQFKNSTDKFWRPT-----RMN 83

Query: 81  VVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAIS- 139
            +  + K  IR+ L  +   +N    I N   +   +I+ +D+P  WP +      A++ 
Sbjct: 84  CISKDEKSSIRDRLFHMVNEENNQLAIQNA--HATAKIARLDYPQNWPNMFEYFEIALAD 141

Query: 140 HQ 141
           HQ
Sbjct: 142 HQ 143

>CAGL0G03443g Chr7 complement(331868..335209) [3342 bp, 1113 aa]
           {ON} highly similar to uniprot|P40069 Saccharomyces
           cerevisiae YER110c KAP123 RAN-binding protein
          Length = 1113

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 48/100 (48%), Gaps = 12/100 (12%)

Query: 45  LQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNEN 104
           L H +    +Q A + +RKLI  +W+           ++V  K+ I+E +L+   ++ + 
Sbjct: 49  LHHSNDDALKQLAGVEVRKLIPKHWAS----------IDVATKNGIKETVLQYAFSEQKE 98

Query: 105 TKIINGASYCIVQISAVDFPD-QWPQLLTVIYDAISHQHS 143
             I +  +  I  I + +  D QWP+L+  +  A + + S
Sbjct: 99  I-IRHSNARVIAVIGSEEMSDNQWPELIPNLVQAAAGEDS 137

>KNAG0M01330 Chr13 (239645..241483) [1839 bp, 612 aa] {ON} Anc_5.143
           YGR197C
          Length = 612

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 27/119 (22%)

Query: 528 EIQGKVIQIIND----INSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFT 583
           EI  K+++++ D    +  + +E+   A+         YN   ++        +++    
Sbjct: 270 EINAKIVELVYDEKIWMALNIKENATAAL---------YNSYMVEGAPAFNSTKYYQAVY 320

Query: 584 ISSKDPANVQVVVQSQ-ECLEKLLDEINMDNYKNYIEL-CLPSFI----NVLDSNSVNN 636
           +S +DPAN    +  Q + +EKL        Y+NY  +  LP F+    NVLD NS+N+
Sbjct: 321 MSGRDPANFNAQMLPQLQIVEKL--------YRNYFTMDYLPRFLDNMTNVLDLNSINS 371

>CAGL0I01782g Chr9 (146481..149636) [3156 bp, 1051 aa] {ON} weakly
           similar to uniprot|P30822 Saccharomyces cerevisiae
           YGR218w CRM1 nuclear export factor
          Length = 1051

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 45  LQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNEN 104
           LQ  S ++ +  AL  L  ++T  W      Y      ++ V++F+   +L +C  +  N
Sbjct: 55  LQFSSNVQGKYIALSVLDNMVTGGW------YELPQEQKLGVRNFLVGFILYVCEKNKPN 108

Query: 105 TK-IINGASYCIVQISAVDFPDQWPQLL 131
              ++  A   +++I   ++PD WP  L
Sbjct: 109 ESFMLRKADLVLIEILKREWPDNWPSFL 136

>KNAG0A01660 Chr1 complement(92179..95433) [3255 bp, 1084 aa] {ON}
           Anc_5.111 YGR218W
          Length = 1084

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 9/94 (9%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ     +++   L  L KLI   W    +  R      + +++FI  +++ LC +
Sbjct: 51  ADQILQFSGNPQTKFIGLSILDKLINTKWKLLPDEQR------IGIRNFIVGMIISLCQD 104

Query: 101 DN---ENTKIINGASYCIVQISAVDFPDQWPQLL 131
           D        +IN +   +VQ+   ++P  WP+ +
Sbjct: 105 DAVFASQKNLINKSDLTLVQVLKQEWPQNWPEFI 138

>NDAI0D02420 Chr4 (560987..564241) [3255 bp, 1084 aa] {ON} Anc_5.111
           YGR218W
          Length = 1084

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 65/140 (46%), Gaps = 14/140 (10%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ  +  +++   L  L KLI+  W       R      + +++F+  +++ +C +
Sbjct: 51  ADQILQFSNNPQAKFIGLSILNKLISTKWKLLPAEQR------IGIRNFVVGMIITMCQD 104

Query: 101 D---NENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISH-----QHSLNAMSLLNE 152
           D        +I+ +   +VQI   ++P  WP+ +  +  + +      Q+++  + LL+E
Sbjct: 105 DMVFQTQKNLISKSDLTLVQILKQEWPQNWPEFIPELISSSTSSLNVCQNNMVILKLLSE 164

Query: 153 IYDDVVSEEMFFEGGIGLET 172
              D  +E+M     + L+T
Sbjct: 165 EVFDFSAEQMTQAKALHLKT 184

>KAFR0A06350 Chr1 (1280152..1282737) [2586 bp, 861 aa] {ON}
           Anc_4.180 YLR347C
          Length = 861

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 14  DKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYWSPGF 73
           D+  R  +ETQL +  + N  Q     + V +   + LE+R  A LSL+  +    S   
Sbjct: 18  DQNIRLQSETQLKKLSNENFLQFAGLSSQVLIDENAKLEARILAALSLKNELVSKDSIKS 77

Query: 74  ESY--RSTSVVEVNVKDFIR-EVLLKLCLNDNENTKIINGASYCIVQISAVDFP-DQWPQ 129
           + +  R T+ ++++ ++ I+   ++ L    +   ++ N ++  I  I+ ++ P + WP+
Sbjct: 78  QQFVQRWTTQIDIDSRNQIKTNAIMSLV---SIEPRVANASAQLIAAIADIELPLNSWPE 134

Query: 130 LLTVIYD 136
           L+ ++ D
Sbjct: 135 LMNIMVD 141

>Smik_7.22 Chr7 (44367..47249) [2883 bp, 960 aa] {ON} YGL238W (REAL)
          Length = 960

 Score = 32.7 bits (73), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 10  AQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYW 69
           A+S    T +A+E  L Q    +   +   L +V      PL +R    L  +  I   W
Sbjct: 12  AESVVASTAKASERNLKQLETQDGFGL--TLLHVIASTNLPLSTRLAGALFFKNFIKRKW 69

Query: 70  SPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPDQWPQ 129
                      ++  N  + I++ ++ L ++   N ++  G    I  I+  DFPD+WP 
Sbjct: 70  V----DENGNHLLPANNVELIKKEIVPLMISLPNNLQVQIGE--AISGIAESDFPDRWPT 123

Query: 130 LL 131
           LL
Sbjct: 124 LL 125

>Skud_7.28 Chr7 (53753..56635) [2883 bp, 960 aa] {ON} YGL238W (REAL)
          Length = 960

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 10  AQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLITMYW 69
           A+S    T +A+E  L Q    +   +   L +V      PL +R    L  +  I   W
Sbjct: 12  AESVVASTAKASERNLRQLETQDGLGL--TLLHVIASTNLPLSTRLAGALFFKNFIKRKW 69

Query: 70  SPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPDQWPQ 129
                      ++  N  + I++ ++ L +    N ++  G +  I  I+  DFPD+WP 
Sbjct: 70  V----DENGNHLLPANNVELIKKEIVPLMITLPNNLQVQIGEA--ISSIADSDFPDRWPT 123

Query: 130 LL 131
           LL
Sbjct: 124 LL 125

>KLLA0D06633g Chr4 complement(568539..571610) [3072 bp, 1023 aa]
           {ON} similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1023

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 51/129 (39%), Gaps = 13/129 (10%)

Query: 5   ELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKL 64
           E  +  Q A    +  AE Q+  W           L ++ +     L+ R  A++  +  
Sbjct: 15  EQASNPQYAGSEVQRQAEQQIKSW--EILPGFHYLLQSIYMDLSVSLQVRWLAIIQFKNG 72

Query: 65  ITMYWSPGFESYRSTSV--VEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVD 122
           +  YW       RST +  +  + K  IR  L  +    N+   I N  +    +++ +D
Sbjct: 73  LDKYW-------RSTRINAITKDEKQQIRNRLFGMIDEPNDKLAIQNAQA--TARVARID 123

Query: 123 FPDQWPQLL 131
           FP +WP L 
Sbjct: 124 FPVEWPHLF 132

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 32.3 bits (72), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 12/90 (13%)

Query: 216 KSFISQCLSTSLQRLGQLLTMGFHSENV---------VSQLKLKSIIYENLVLIKNDFSK 266
           +++   C++   Q L  ++  GF    V         V+ L L  II++N+   KND  K
Sbjct: 461 QAYYGWCMNNK-QSLFDIIETGFKKYGVFKEYNGYYIVNDLSLTKIIFDNIRENKND--K 517

Query: 267 NHFSIDLQKQFKIVTVQDLNNIAHLDTNGN 296
             +   +  +FK++T +DL      DT GN
Sbjct: 518 EKYVSHIGTEFKVITFRDLTLGYQSDTIGN 547

>TBLA0B07490 Chr2 complement(1779793..1783068) [3276 bp, 1091 aa]
           {ON} Anc_5.111 YGR218W
          Length = 1091

 Score = 32.3 bits (72), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 12/126 (9%)

Query: 41  ANVALQHQSPLESRQFALLSLRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLN 100
           A+  LQ  +  +++   L  + KLIT  W       R      + +++FI  +++ +C +
Sbjct: 51  ADKILQLSNNPQTKFIGLSIMDKLITTKWKLLPADQR------IGIRNFIVGMIISMCQD 104

Query: 101 D---NENTKIINGASYCIVQISAVDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDV 157
           +        +IN +   +VQI   ++P  WP     I + IS   S   +   N I   +
Sbjct: 105 NTLFRSQKNLINKSDLTLVQILKQEWPQNWPNF---IPELISSSTSSPNVCENNMIILKL 161

Query: 158 VSEEMF 163
           +SEE+F
Sbjct: 162 LSEEVF 167

>Kwal_55.20479 s55 complement(422679..424148) [1470 bp, 489 aa] {ON}
           YPR119W (CLB2) - G(sub)2-specific B-type cyclin [contig
           148] FULL
          Length = 489

 Score = 32.0 bits (71), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 450 EVKELTLARAILVIPKVLDKFIDVLPDIKSLTSKFLTKSLDLALKHDNELI 500
           +++  TLA+ +L I  V  +FI VLP + + TS FL++ +    K D  LI
Sbjct: 370 DIQSRTLAKYLLEISVVDFRFIGVLPSLCAATSMFLSRKMLGKGKWDGNLI 420

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,341,918
Number of extensions: 3918178
Number of successful extensions: 13968
Number of sequences better than 10.0: 132
Number of HSP's gapped: 14296
Number of HSP's successfully gapped: 146
Length of query: 1004
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 884
Effective length of database: 39,721,479
Effective search space: 35113787436
Effective search space used: 35113787436
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)