Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_7.193.565ON1811618371e-115
YGL242C3.565ON1811617971e-109
Suva_7.193.565ON1811617851e-107
Skud_7.253.565ON1811617831e-107
NDAI0B062703.565ON1821536436e-86
KAFR0J001803.565ON1821556235e-83
CAGL0H07755g3.565ON1721566191e-82
Kpol_507.113.565ON1891536106e-81
TPHA0A059903.565ON1761536001e-79
TDEL0D063303.565ON1791525942e-78
SAKL0F00858g3.565ON1731525871e-77
KNAG0D029503.565ON1741575862e-77
NCAS0F039603.565ON1861525769e-76
TBLA0I034903.565ON1751495671e-74
ZYRO0E09482g3.565ON1751535653e-74
Kwal_47.192623.565ON1711515462e-71
KLTH0G00770g3.565ON1711555374e-70
KLLA0A00781g3.565ON1711515236e-68
Ecym_25953.565ON1701505151e-66
AFR268C3.565ON1681604881e-62
NCAS0C051602.639ON4081071036e-05
Skud_3.1296.319ON2221331001e-04
YCR051W6.319ON222134982e-04
Ecym_20996.319ON207125963e-04
TDEL0A073406.319ON21548900.002
Smik_3.1536.319ON246133900.002
YMR068W (AVO2)2.639ON426109880.005
TPHA0I015808.599ON124696890.005
NDAI0I005106.319ON212103870.005
CAGL0F06655g2.639ON408118870.007
Suva_3.896.319ON223134860.008
YIL112W (HOS4)2.257ON1083117860.011
Suva_9.822.257ON1141117860.012
KAFR0J025006.319ON21268840.013
NDAI0G045402.639ON45693840.015
TBLA0F040206.319ON21979830.017
Skud_13.2242.639ON42295840.017
TBLA0A007802.639ON72693840.019
Smik_13.2472.639ON430106840.019
Suva_13.2432.639ON416106830.022
Kpol_1028.586.319ON208107820.024
KLLA0C09108g6.319ON208107820.025
AAR063C6.319ON220108810.027
SAKL0G15554g5.96ON1090152820.037
SAKL0A01870g6.319ON20679800.040
CAGL0C03003g6.319ON20648800.041
KLTH0A06248g6.319ON202109790.052
TPHA0D037906.319ON21378790.063
Skud_9.592.257ON1077117800.070
TDEL0B073302.639ON37591790.073
Smik_6.4436.265ON19958780.077
ZYRO0D08690g6.319ON208102770.096
Smik_9.572.257ON1085117780.12
KAFR0J015402.257ON106843780.12
KNAG0I025906.319ON21452760.14
TBLA0G025002.257ON1259118770.15
TDEL0C040402.257ON1007118760.18
KLTH0F01826g1.60ON66352760.21
CAGL0H00935g6.265ON193128740.24
Kwal_23.62186.319ON20254730.30
ZYRO0E00924g2.639ON408103740.31
Kwal_33.132591.60ON66452740.32
Ecym_33842.662ON1146116740.37
KLLA0E15687g5.96ON1148110730.44
ZYRO0B15114g5.97ON226116720.48
Skud_1.913.175ON116555730.54
SAKL0E08382g2.257ON1085118730.55
Suva_1.1103.175ON115955730.55
TDEL0D044803.175ON126855730.57
NCAS0C036803.175ON120855720.60
Kpol_1073.82.639ON42899720.62
Smik_1.1073.175ON117955720.63
Suva_16.686.265ON19958710.63
Kpol_1039.262.257ON120446720.67
NCAS0D044306.319ON23078700.73
NCAS0B086601.60ON75152710.89
Kpol_1050.625.97ON23069691.0
KNAG0M025102.639ON41133691.3
ABL119C8.847ON53780691.5
KAFR0A002802.639ON38728681.8
TBLA0A006802.662ON149443691.9
YAR042W (SWH1)3.175ON118855681.9
KLLA0F03619g2.257ON96046682.0
ZYRO0C11132g5.626ON759128682.1
KNAG0C006501.60ON74852682.2
AER388C5.626ON72487672.4
ZYRO0A05258g3.175ON154855672.5
CAGL0C01309g2.257ON1110118672.6
Kpol_1045.523.175ON1255103672.8
NDAI0G030203.175ON149596672.9
AFR690C1.60ON70053672.9
Ecym_34092.639ON43651662.9
TPHA0P005803.175ON125779673.0
NCAS0I018303.175ON125753673.2
CAGL0L06600g5.97ON23172653.4
TDEL0G012005.97ON22786653.4
KLLA0F26004g2.639ON336109663.4
KLLA0E15709g5.97ON23080653.4
KNAG0K012303.175ON122855663.6
NDAI0E025408.599ON120189663.9
ACR165W2.662ON1139108664.1
Ecym_10651.60ON82952654.4
Kwal_14.9822.639ON41628654.8
NDAI0A064303.175ON131247655.2
TDEL0C064201.60ON75752645.8
NDAI0D003607.494ON111657645.9
ZYRO0E07942g6.265ON20949636.5
KAFR0C009403.175ON112084646.6
NCAS0B064102.257ON1054121647.3
Kwal_47.183185.589ON42550637.4
Kpol_1002.186.265ON20668628.1
YLR182W (SWI6)1.60ON80352638.3
SAKL0A03278g6.265ON19884628.8
YLL015W (BPT1)4.52ON1559124639.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_7.19
         (181 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_7.19 Chr7 complement(39474..40019) [546 bp, 181 aa] {ON} YG...   327   e-115
YGL242C Chr7 complement(44652..45197) [546 bp, 181 aa] {ON} Puta...   311   e-109
Suva_7.19 Chr7 complement(39229..39774) [546 bp, 181 aa] {ON} YG...   306   e-107
Skud_7.25 Chr7 complement(48834..49379) [546 bp, 181 aa] {ON} YG...   306   e-107
NDAI0B06270 Chr2 (1518518..1519066) [549 bp, 182 aa] {ON} Anc_3....   252   6e-86
KAFR0J00180 Chr10 complement(29811..30359) [549 bp, 182 aa] {ON}...   244   5e-83
CAGL0H07755g Chr8 complement(756294..756812) [519 bp, 172 aa] {O...   243   1e-82
Kpol_507.11 s507 complement(58716..59285) [570 bp, 189 aa] {ON} ...   239   6e-81
TPHA0A05990 Chr1 (1356065..1356595) [531 bp, 176 aa] {ON} Anc_3....   235   1e-79
TDEL0D06330 Chr4 (1138062..1138601) [540 bp, 179 aa] {ON} Anc_3....   233   2e-78
SAKL0F00858g Chr6 complement(76158..76679) [522 bp, 173 aa] {ON}...   230   1e-77
KNAG0D02950 Chr4 (532378..532902) [525 bp, 174 aa] {ON} Anc_3.56...   230   2e-77
NCAS0F03960 Chr6 (795002..795562) [561 bp, 186 aa] {ON} Anc_3.56...   226   9e-76
TBLA0I03490 Chr9 (839793..840320) [528 bp, 175 aa] {ON} Anc_3.56...   223   1e-74
ZYRO0E09482g Chr5 (756328..756855) [528 bp, 175 aa] {ON} highly ...   222   3e-74
Kwal_47.19262 s47 (1160155..1160670) [516 bp, 171 aa] {ON} YGL24...   214   2e-71
KLTH0G00770g Chr7 complement(52958..53473) [516 bp, 171 aa] {ON}...   211   4e-70
KLLA0A00781g Chr1 complement(75435..75950) [516 bp, 171 aa] {ON}...   206   6e-68
Ecym_2595 Chr2 (1158968..1159480) [513 bp, 170 aa] {ON} similar ...   202   1e-66
AFR268C Chr6 complement(915788..916294) [507 bp, 168 aa] {ON} Sy...   192   1e-62
NCAS0C05160 Chr3 complement(1050360..1051586) [1227 bp, 408 aa] ...    44   6e-05
Skud_3.129 Chr3 (198354..199022) [669 bp, 222 aa] {ON} YCR051W (...    43   1e-04
YCR051W Chr3 (214071..214739) [669 bp, 222 aa] {ON} Putative pro...    42   2e-04
Ecym_2099 Chr2 complement(176120..176743) [624 bp, 207 aa] {ON} ...    42   3e-04
TDEL0A07340 Chr1 (1284474..1285121) [648 bp, 215 aa] {ON} Anc_6....    39   0.002
Smik_3.153 Chr3 (212077..212817) [741 bp, 246 aa] {ON} YCR051W (...    39   0.002
YMR068W Chr13 (406304..407584) [1281 bp, 426 aa] {ON}  AVO2Compo...    39   0.005
TPHA0I01580 Chr9 complement(358279..362019) [3741 bp, 1246 aa] {...    39   0.005
NDAI0I00510 Chr9 complement(104836..105474) [639 bp, 212 aa] {ON...    38   0.005
CAGL0F06655g Chr6 (654908..656134) [1227 bp, 408 aa] {ON} simila...    38   0.007
Suva_3.89 Chr3 (127217..127888) [672 bp, 223 aa] {ON} YCR051W (R...    38   0.008
YIL112W Chr9 (151595..154846) [3252 bp, 1083 aa] {ON}  HOS4Subun...    38   0.011
Suva_9.82 Chr9 (146137..149562) [3426 bp, 1141 aa] {ON} YIL112W ...    38   0.012
KAFR0J02500 Chr10 (476605..477243) [639 bp, 212 aa] {ON} Anc_6.3...    37   0.013
NDAI0G04540 Chr7 (1085981..1087351) [1371 bp, 456 aa] {ON} Anc_2...    37   0.015
TBLA0F04020 Chr6 (993029..993688) [660 bp, 219 aa] {ON} Anc_6.31...    37   0.017
Skud_13.224 Chr13 (380698..381966) [1269 bp, 422 aa] {ON} YMR068...    37   0.017
TBLA0A00780 Chr1 complement(168204..170384) [2181 bp, 726 aa] {O...    37   0.019
Smik_13.247 Chr13 (390443..391735) [1293 bp, 430 aa] {ON} YMR068...    37   0.019
Suva_13.243 Chr13 (387561..388661,388691..388840) [1251 bp, 416 ...    37   0.022
Kpol_1028.58 s1028 complement(133357..133983) [627 bp, 208 aa] {...    36   0.024
KLLA0C09108g Chr3 complement(795433..796059) [627 bp, 208 aa] {O...    36   0.025
AAR063C Chr1 complement(453099..453761) [663 bp, 220 aa] {ON} Sy...    36   0.027
SAKL0G15554g Chr7 complement(1337081..1340353) [3273 bp, 1090 aa...    36   0.037
SAKL0A01870g Chr1 complement(167727..168347) [621 bp, 206 aa] {O...    35   0.040
CAGL0C03003g Chr3 (297244..297864) [621 bp, 206 aa] {ON} similar...    35   0.041
KLTH0A06248g Chr1 (524183..524791) [609 bp, 202 aa] {ON} similar...    35   0.052
TPHA0D03790 Chr4 (797282..797923) [642 bp, 213 aa] {ON} Anc_6.31...    35   0.063
Skud_9.59 Chr9 (128451..131684) [3234 bp, 1077 aa] {ON} YIL112W ...    35   0.070
TDEL0B07330 Chr2 (1291145..1292272) [1128 bp, 375 aa] {ON} Anc_2...    35   0.073
Smik_6.443 Chr6 complement(724235..724834) [600 bp, 199 aa] {ON}...    35   0.077
ZYRO0D08690g Chr4 complement(747083..747709) [627 bp, 208 aa] {O...    34   0.096
Smik_9.57 Chr9 (129281..132538) [3258 bp, 1085 aa] {ON} YIL112W ...    35   0.12 
KAFR0J01540 Chr10 complement(277907..281113) [3207 bp, 1068 aa] ...    35   0.12 
KNAG0I02590 Chr9 complement(499721..500365) [645 bp, 214 aa] {ON...    34   0.14 
TBLA0G02500 Chr7 complement(648451..652230) [3780 bp, 1259 aa] {...    34   0.15 
TDEL0C04040 Chr3 complement(707532..710555) [3024 bp, 1007 aa] {...    34   0.18 
KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} simila...    34   0.21 
CAGL0H00935g Chr8 (91979..92560) [582 bp, 193 aa] {ON} highly si...    33   0.24 
Kwal_23.6218 s23 (1495388..1495996) [609 bp, 202 aa] {ON} YCR051...    33   0.30 
ZYRO0E00924g Chr5 complement(62334..63560) [1227 bp, 408 aa] {ON...    33   0.31 
Kwal_33.13259 s33 (143081..145075) [1995 bp, 664 aa] {ON} YLR182...    33   0.32 
Ecym_3384 Chr3 complement(728692..732132) [3441 bp, 1146 aa] {ON...    33   0.37 
KLLA0E15687g Chr5 (1402940..1406386) [3447 bp, 1148 aa] {ON} sim...    33   0.44 
ZYRO0B15114g Chr2 complement(1233061..1233741) [681 bp, 226 aa] ...    32   0.48 
Skud_1.91 Chr1 (162916..166413) [3498 bp, 1165 aa] {ON} YAR042W ...    33   0.54 
SAKL0E08382g Chr5 complement(676318..679575) [3258 bp, 1085 aa] ...    33   0.55 
Suva_1.110 Chr1 (170339..173818) [3480 bp, 1159 aa] {ON} YAR042W...    33   0.55 
TDEL0D04480 Chr4 (818876..822682) [3807 bp, 1268 aa] {ON} Anc_3....    33   0.57 
NCAS0C03680 Chr3 complement(737681..741307) [3627 bp, 1208 aa] {...    32   0.60 
Kpol_1073.8 s1073 complement(10633..11919) [1287 bp, 428 aa] {ON...    32   0.62 
Smik_1.107 Chr1 (171768..175307) [3540 bp, 1179 aa] {ON} YAR042W...    32   0.63 
Suva_16.68 Chr16 (108464..109063) [600 bp, 199 aa] {ON} YPL239W ...    32   0.63 
Kpol_1039.26 s1039 (82489..86103) [3615 bp, 1204 aa] {ON} (82489...    32   0.67 
NCAS0D04430 Chr4 (843610..844302) [693 bp, 230 aa] {ON} Anc_6.319      32   0.73 
NCAS0B08660 Chr2 (1665156..1667411) [2256 bp, 751 aa] {ON} Anc_1...    32   0.89 
Kpol_1050.62 s1050 (137219..137911) [693 bp, 230 aa] {ON} (13721...    31   1.0  
KNAG0M02510 Chr13 complement(465793..467028) [1236 bp, 411 aa] {...    31   1.3  
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    31   1.5  
KAFR0A00280 Chr1 complement(53403..54566) [1164 bp, 387 aa] {ON}...    31   1.8  
TBLA0A00680 Chr1 complement(145681..150165) [4485 bp, 1494 aa] {...    31   1.9  
YAR042W Chr1 (192619..196185) [3567 bp, 1188 aa] {ON}  SWH1Prote...    31   1.9  
KLLA0F03619g Chr6 (342770..345652) [2883 bp, 960 aa] {ON} simila...    31   2.0  
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    31   2.1  
KNAG0C00650 Chr3 (110325..112571) [2247 bp, 748 aa] {ON} Anc_1.6...    31   2.2  
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    30   2.4  
ZYRO0A05258g Chr1 (424968..429614) [4647 bp, 1548 aa] {ON} some ...    30   2.5  
CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} simil...    30   2.6  
Kpol_1045.52 s1045 complement(122763..126530) [3768 bp, 1255 aa]...    30   2.8  
NDAI0G03020 Chr7 complement(699746..704233) [4488 bp, 1495 aa] {...    30   2.9  
AFR690C Chr6 complement(1712886..1714988) [2103 bp, 700 aa] {ON}...    30   2.9  
Ecym_3409 Chr3 complement(771477..772787) [1311 bp, 436 aa] {ON}...    30   2.9  
TPHA0P00580 Chr16 (117136..120909) [3774 bp, 1257 aa] {ON} Anc_3...    30   3.0  
NCAS0I01830 Chr9 complement(336447..340220) [3774 bp, 1257 aa] {...    30   3.2  
CAGL0L06600g Chr12 (744800..745495) [696 bp, 231 aa] {ON} simila...    30   3.4  
TDEL0G01200 Chr7 complement(246082..246765) [684 bp, 227 aa] {ON...    30   3.4  
KLLA0F26004g Chr6 complement(2411261..2412271) [1011 bp, 336 aa]...    30   3.4  
KLLA0E15709g Chr5 complement(1406502..1407194) [693 bp, 230 aa] ...    30   3.4  
KNAG0K01230 Chr11 complement(239226..242912) [3687 bp, 1228 aa] ...    30   3.6  
NDAI0E02540 Chr5 complement(526907..530512) [3606 bp, 1201 aa] {...    30   3.9  
ACR165W Chr3 (644229..647648) [3420 bp, 1139 aa] {ON} Syntenic h...    30   4.1  
Ecym_1065 Chr1 (120443..122932) [2490 bp, 829 aa] {ON} similar t...    30   4.4  
Kwal_14.982 s14 complement(141369..142619) [1251 bp, 416 aa] {ON...    30   4.8  
NDAI0A06430 Chr1 (1461045..1464983) [3939 bp, 1312 aa] {ON} Anc_...    30   5.2  
TDEL0C06420 Chr3 complement(1174443..1176716) [2274 bp, 757 aa] ...    29   5.8  
NDAI0D00360 Chr4 complement(72274..75624) [3351 bp, 1116 aa] {ON...    29   5.9  
ZYRO0E07942g Chr5 complement(619330..619959) [630 bp, 209 aa] {O...    29   6.5  
KAFR0C00940 Chr3 (189934..193296) [3363 bp, 1120 aa] {ON} Anc_3....    29   6.6  
NCAS0B06410 Chr2 complement(1209149..1212313) [3165 bp, 1054 aa]...    29   7.3  
Kwal_47.18318 s47 (779578..780855) [1278 bp, 425 aa] {ON} YDR465...    29   7.4  
Kpol_1002.18 s1002 (48873..49493) [621 bp, 206 aa] {ON} (48873.....    28   8.1  
YLR182W Chr12 (517940..520351) [2412 bp, 803 aa] {ON}  SWI6Trans...    29   8.3  
SAKL0A03278g Chr1 (302501..303097) [597 bp, 198 aa] {ON} similar...    28   8.8  
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...    29   9.0  

>Smik_7.19 Chr7 complement(39474..40019) [546 bp, 181 aa] {ON}
           YGL242C (REAL)
          Length = 181

 Score =  327 bits (837), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY
Sbjct: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV
Sbjct: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNGLADNN 161
           RNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNGLADNN
Sbjct: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNGLADNN 161

>YGL242C Chr7 complement(44652..45197) [546 bp, 181 aa] {ON}
           Putative protein of unknown function; deletion mutant is
           viable
          Length = 181

 Score =  311 bits (797), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 151/161 (93%), Positives = 159/161 (98%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           M+TEGASLSEQLLDAARRNNLDLLETVF+SLDN+PEKIAKLINES+EPLGNTALHLCCKY
Sbjct: 1   MNTEGASLSEQLLDAARRNNLDLLETVFDSLDNDPEKIAKLINESKEPLGNTALHLCCKY 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLDK+LDQ+GEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV
Sbjct: 61  GSWEVLDKILDQDGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNGLADNN 161
           RNYNNQKP+DLVHGDELDELIDLLQGAELAID+TNG  DNN
Sbjct: 121 RNYNNQKPVDLVHGDELDELIDLLQGAELAIDSTNGSGDNN 161

>Suva_7.19 Chr7 complement(39229..39774) [546 bp, 181 aa] {ON}
           YGL242C (REAL)
          Length = 181

 Score =  306 bits (785), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 148/161 (91%), Positives = 158/161 (98%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           MDTEGASLSEQLLDAARRNNLDL+ETVF+SLDN+PEKIAKLINESREPLGNTALHLCCKY
Sbjct: 1   MDTEGASLSEQLLDAARRNNLDLVETVFDSLDNDPEKIAKLINESREPLGNTALHLCCKY 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLDK+LDQ+G IEIDPQNDVDGDTPLHVTV+YSQEEPEHGTFIARNLIEVGADPR+
Sbjct: 61  GSWEVLDKILDQDGGIEIDPQNDVDGDTPLHVTVKYSQEEPEHGTFIARNLIEVGADPRI 120

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNGLADNN 161
           +NYNNQKPIDLVHGDELDELIDLLQGAELAID+ NGLAD +
Sbjct: 121 KNYNNQKPIDLVHGDELDELIDLLQGAELAIDSNNGLADKD 161

>Skud_7.25 Chr7 complement(48834..49379) [546 bp, 181 aa] {ON}
           YGL242C (REAL)
          Length = 181

 Score =  306 bits (783), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 149/161 (92%), Positives = 157/161 (97%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           MDTEGASLSEQLLDAARRNNLDLLETVF+ LD + EKIAKLIN+S+EPLGNTALHLCCKY
Sbjct: 1   MDTEGASLSEQLLDAARRNNLDLLETVFDGLDGDSEKIAKLINKSKEPLGNTALHLCCKY 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLD++LDQ+G IEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV
Sbjct: 61  GSWEVLDRILDQDGGIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNGLADNN 161
           RNYNNQKPIDLVHGDELDELIDLLQGAELAID+TNGLADNN
Sbjct: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDSTNGLADNN 161

>NDAI0B06270 Chr2 (1518518..1519066) [549 bp, 182 aa] {ON} Anc_3.565
           YGL242C
          Length = 182

 Score =  252 bits (643), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 137/153 (89%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           M  EGASL EQLLDA+RRNN+DLLE +F +LDN+ EKIA LIN +++PLGNTALHL CKY
Sbjct: 1   MSVEGASLKEQLLDASRRNNVDLLEQIFTTLDNDEEKIADLINTAKDPLGNTALHLSCKY 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLDK+LDQEG+IEIDP+ND+DGDTPLH  VRY+Q+EPEHG FIA+NLIEVGADPR+
Sbjct: 61  GSWEVLDKILDQEGDIEIDPKNDMDGDTPLHSAVRYAQDEPEHGEFIAQNLIEVGADPRI 120

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDN 153
           RN +NQKPIDL+HGD+ D LIDLLQGAELA DN
Sbjct: 121 RNNHNQKPIDLIHGDDFDSLIDLLQGAELAADN 153

>KAFR0J00180 Chr10 complement(29811..30359) [549 bp, 182 aa] {ON}
           Anc_3.565 YGL242C
          Length = 182

 Score =  244 bits (623), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 114/155 (73%), Positives = 137/155 (88%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           M+TEGAS  EQLLDA+RRNN+DLLETVF+ L N+ +KIA LIN S++P GNTALHL CKY
Sbjct: 1   METEGASFGEQLLDASRRNNVDLLETVFSDLANDHKKIADLINSSKDPFGNTALHLSCKY 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLDK+LD EG+IEIDP+N++DG+TPLH  V+YSQ EPEHGTFIA NLI+VGADPR+
Sbjct: 61  GSWEVLDKILDLEGDIEIDPKNNIDGETPLHCAVKYSQTEPEHGTFIASNLIQVGADPRL 120

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTN 155
           +N NNQ+PIDL+H +ELD+LIDLLQGAELA D+ N
Sbjct: 121 KNNNNQRPIDLIHSEELDDLIDLLQGAELAADHAN 155

>CAGL0H07755g Chr8 complement(756294..756812) [519 bp, 172 aa] {ON}
           highly similar to uniprot|P53066 Saccharomyces
           cerevisiae YGL242c
          Length = 172

 Score =  243 bits (619), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 118/156 (75%), Positives = 135/156 (86%), Gaps = 1/156 (0%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           M +EGAS  EQLLDA+RRNN DLL ++F +L ++ EKIA+LIN S++PLGNTALHLCCKY
Sbjct: 1   MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCKY 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLD +LDQEG I+IDPQN VDGDTPLHVTVRY  EEPEHG FIARNLIEVGADPR+
Sbjct: 61  GSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPRI 119

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNG 156
           +N NNQ P+DLVHGD+ DELIDLLQGA LA DN +G
Sbjct: 120 KNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDG 155

>Kpol_507.11 s507 complement(58716..59285) [570 bp, 189 aa] {ON}
           complement(58716..59285) [570 nt, 190 aa]
          Length = 189

 Score =  239 bits (610), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 140/153 (91%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           M TEGASLSEQLLD +RRNN+DLL+T+  +L+N+PEKIA LIN S++P GNTALHLCCKY
Sbjct: 1   MSTEGASLSEQLLDLSRRNNVDLLDTILETLENDPEKIAGLINTSKDPFGNTALHLCCKY 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLDK+LDQEG+IEIDP+N  DGDTPLHVTVRYS EEPEHGTFIA NLIEVG+DPR+
Sbjct: 61  GSWEVLDKILDQEGDIEIDPKNTTDGDTPLHVTVRYSMEEPEHGTFIASNLIEVGSDPRI 120

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDN 153
           +N +NQKPIDL+HGDELD+LIDLLQGAE+A D+
Sbjct: 121 KNNSNQKPIDLIHGDELDDLIDLLQGAEIAADS 153

>TPHA0A05990 Chr1 (1356065..1356595) [531 bp, 176 aa] {ON} Anc_3.565
           YGL242C
          Length = 176

 Score =  235 bits (600), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 110/153 (71%), Positives = 131/153 (85%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           M +EGASL+EQLLD ARRNN DL  ++  SL N+   I++LIN SR+P GNTALHL C+Y
Sbjct: 1   MSSEGASLNEQLLDCARRNNEDLFNSILESLGNDTYNISELINTSRDPFGNTALHLACQY 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLDK+LDQEG+IEIDPQN  DGDTPLHVTV+Y+  EPEHGTFIA+NLIEVGADPR+
Sbjct: 61  GSWEVLDKILDQEGDIEIDPQNTTDGDTPLHVTVKYAHNEPEHGTFIAKNLIEVGADPRI 120

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDN 153
           RN  N++PID +HGDEL+ELIDLLQGAE++ DN
Sbjct: 121 RNNRNERPIDCIHGDELEELIDLLQGAEISADN 153

>TDEL0D06330 Chr4 (1138062..1138601) [540 bp, 179 aa] {ON} Anc_3.565
           YGL242C
          Length = 179

 Score =  233 bits (594), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 133/152 (87%), Gaps = 1/152 (0%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           M +EGAS  EQLL+A+RRNN+DLL  +  S+ N+P KIA+++N S++P GNTALHLCCK 
Sbjct: 1   MSSEGASYGEQLLEASRRNNVDLLNDILESVKNDPVKIAEIVNFSKDPFGNTALHLCCKS 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLD +LDQ G+IEIDPQN +DGDTPLH TVRY+Q+EPEHGTFIARNLIEVGADPR+
Sbjct: 61  GSWEVLDILLDQ-GDIEIDPQNKLDGDTPLHFTVRYAQDEPEHGTFIARNLIEVGADPRL 119

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAID 152
           RN +NQKPIDL+H ++LDEL DLLQGAELAID
Sbjct: 120 RNKHNQKPIDLIHSEDLDELTDLLQGAELAID 151

>SAKL0F00858g Chr6 complement(76158..76679) [522 bp, 173 aa] {ON}
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 173

 Score =  230 bits (587), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 118/152 (77%), Positives = 137/152 (90%)

Query: 2   DTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYG 61
           + +GASL EQLLDA+RRNN DLLET+  SLDNNP+KIAKLIN + +PLGNT LHLCCKYG
Sbjct: 3   EIQGASLQEQLLDASRRNNADLLETILESLDNNPDKIAKLINSACDPLGNTCLHLCCKYG 62

Query: 62  SWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVR 121
           SWEVLD++LDQ+G IEIDP+N+VDGDTPLHVTVRY+ EEPEHGTFIA+NLIEVGADPR+R
Sbjct: 63  SWEVLDRILDQDGGIEIDPRNNVDGDTPLHVTVRYAIEEPEHGTFIAQNLIEVGADPRIR 122

Query: 122 NYNNQKPIDLVHGDELDELIDLLQGAELAIDN 153
           N   QKP+DL+HGD LD+L+DLLQGAELA DN
Sbjct: 123 NKAGQKPVDLIHGDGLDDLLDLLQGAELAADN 154

>KNAG0D02950 Chr4 (532378..532902) [525 bp, 174 aa] {ON} Anc_3.565
           YGL242C
          Length = 174

 Score =  230 bits (586), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 116/157 (73%), Positives = 139/157 (88%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           M  +GASLSEQLLDA+RRNN DLLE VF  LDN+P KIA+LIN +R+P+GNTALHLCCKY
Sbjct: 1   MSVKGASLSEQLLDASRRNNDDLLEQVFKQLDNDPGKIAELINTARDPMGNTALHLCCKY 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLDK+LDQEG+IEIDP+N++DGDTPLH+ VRY+ +EPEHGTFIA NL+EVGAD R+
Sbjct: 61  GSWEVLDKILDQEGDIEIDPRNELDGDTPLHLAVRYAMDEPEHGTFIANNLVEVGADARI 120

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNGL 157
           +N NNQKP+DL+HGDELD+L DLLQGAELA D+   +
Sbjct: 121 KNNNNQKPVDLIHGDELDDLFDLLQGAELARDHPGAI 157

>NCAS0F03960 Chr6 (795002..795562) [561 bp, 186 aa] {ON} Anc_3.565
           YGL242C
          Length = 186

 Score =  226 bits (576), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 115/152 (75%), Positives = 135/152 (88%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           M  EGASL EQLLDA+RRNN+DLLE  FN LDN+P+KIA LIN +++PLGNTALHL  KY
Sbjct: 1   MSVEGASLKEQLLDASRRNNVDLLEQAFNDLDNDPKKIADLINTAKDPLGNTALHLASKY 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLDK+LD +G+IEIDPQND+DGDTPLH  VRY++EEPEHGTFIA+NLIEVGAD R+
Sbjct: 61  GSWEVLDKILDLDGDIEIDPQNDIDGDTPLHEAVRYAKEEPEHGTFIAQNLIEVGADARI 120

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAID 152
            N +NQKP+DL+HGDELD+L+DLLQGAELA D
Sbjct: 121 ANKHNQKPVDLIHGDELDDLVDLLQGAELAAD 152

>TBLA0I03490 Chr9 (839793..840320) [528 bp, 175 aa] {ON} Anc_3.565
           YGL242C
          Length = 175

 Score =  223 bits (567), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 125/149 (83%)

Query: 3   TEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGS 62
           T+GAS SEQLL+AARRNN+DLL  +   L+N+P KIA L+NES++  GNTALHLC K+GS
Sbjct: 4   TQGASYSEQLLEAARRNNIDLLNNIVTGLNNDPTKIAHLLNESKDAFGNTALHLCAKHGS 63

Query: 63  WEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRN 122
           W+VLDK+LDQEG+IE+DPQN  DGDTPLH  VR +Q+EPE GTFIA+NLI VGADPR+RN
Sbjct: 64  WDVLDKLLDQEGDIEVDPQNITDGDTPLHCAVRLAQDEPEEGTFIAKNLIAVGADPRIRN 123

Query: 123 YNNQKPIDLVHGDELDELIDLLQGAELAI 151
             NQKP+DL+HG+ L  L+D LQGAELA+
Sbjct: 124 KQNQKPVDLIHGNSLTALVDTLQGAELAV 152

>ZYRO0E09482g Chr5 (756328..756855) [528 bp, 175 aa] {ON} highly
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 175

 Score =  222 bits (565), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 114/153 (74%), Positives = 136/153 (88%), Gaps = 1/153 (0%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           MD EGAS  EQLLDA+RRNN+DLL+ VF  L  +PE+I++LINESR+PLG+TALHLCC+Y
Sbjct: 1   MDKEGASFGEQLLDASRRNNIDLLKMVFEGLGGDPERISELINESRDPLGDTALHLCCRY 60

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWEVLD++LDQ+G IEIDPQN  + DTPLHVTVRY+ +EPEHGTFIARNL+EVGADPR+
Sbjct: 61  GSWEVLDEILDQDG-IEIDPQNTKELDTPLHVTVRYAHDEPEHGTFIARNLVEVGADPRI 119

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDN 153
           +N N  KP+DL+HGD+LDELIDLLQGAELA DN
Sbjct: 120 KNMNGDKPVDLIHGDDLDELIDLLQGAELAADN 152

>Kwal_47.19262 s47 (1160155..1160670) [516 bp, 171 aa] {ON} YGL242C
           - Hypothetical ORF [contig 344] FULL
          Length = 171

 Score =  214 bits (546), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 133/151 (88%)

Query: 3   TEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGS 62
           ++GAS  EQLLDA+RRNN+DLLETVF  L+N+ +KIA+LIN + +P+GN++LHLCCK GS
Sbjct: 2   SQGASFREQLLDASRRNNVDLLETVFQELNNDEKKIAELINTAHDPMGNSSLHLCCKSGS 61

Query: 63  WEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRN 122
           WEVLD +LDQEG IEID +N V+GDTPLHVTVRY+ EEPEHGTFIARNLIEVGADPR+ N
Sbjct: 62  WEVLDIILDQEGGIEIDCKNSVEGDTPLHVTVRYAIEEPEHGTFIARNLIEVGADPRIIN 121

Query: 123 YNNQKPIDLVHGDELDELIDLLQGAELAIDN 153
              QKP+DLVHG++LD+L+DLLQGAELA +N
Sbjct: 122 KAGQKPLDLVHGNDLDDLVDLLQGAELAAEN 152

>KLTH0G00770g Chr7 complement(52958..53473) [516 bp, 171 aa] {ON}
           highly similar to uniprot|P53066 Saccharomyces
           cerevisiae YGL242C Hypothetical ORF
          Length = 171

 Score =  211 bits (537), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 111/155 (71%), Positives = 129/155 (83%)

Query: 3   TEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGS 62
           ++GASL EQLLDA+RRNN+DLLETVF  L NN  +IA LIN + +P+GN+ LHLCC YGS
Sbjct: 2   SDGASLREQLLDASRRNNVDLLETVFQELGNNEAQIADLINTAHDPMGNSGLHLCCMYGS 61

Query: 63  WEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRN 122
           W+VLD +LDQEG IEID +N V+GDTPLH  VRY+ EEPEHGTFIARNLIEVGADPR+ N
Sbjct: 62  WDVLDVILDQEGGIEIDSKNKVEGDTPLHCAVRYAIEEPEHGTFIARNLIEVGADPRIVN 121

Query: 123 YNNQKPIDLVHGDELDELIDLLQGAELAIDNTNGL 157
              QKPIDLVHGDELD+LIDLLQGAELA +N   +
Sbjct: 122 QAGQKPIDLVHGDELDDLIDLLQGAELAAENQGAV 156

>KLLA0A00781g Chr1 complement(75435..75950) [516 bp, 171 aa] {ON}
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 171

 Score =  206 bits (523), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 98/151 (64%), Positives = 122/151 (80%), Gaps = 1/151 (0%)

Query: 3   TEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGS 62
           TEGASL EQLLDA+RRNN DLL  V  +LD + + I  LIN+S++PLGNTA+HLC KYGS
Sbjct: 2   TEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSKYGS 61

Query: 63  WEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRN 122
           W+VLD +LDQEG ++++ QN +DGDT LH+ V YS +EPE+GTFIA NLIEVGADPR+RN
Sbjct: 62  WDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPRIRN 120

Query: 123 YNNQKPIDLVHGDELDELIDLLQGAELAIDN 153
              Q P+ LVH DEL+ L++LLQGAE+A DN
Sbjct: 121 KRGQTPLQLVHSDELESLVNLLQGAEIAADN 151

>Ecym_2595 Chr2 (1158968..1159480) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AFR268C
          Length = 170

 Score =  202 bits (515), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 123/150 (82%), Gaps = 4/150 (2%)

Query: 4   EGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSW 63
           EGA+  EQLLDA+RRNN+DLLE +   L+ +   +AKLIN++++P GNT LH+CCKYGSW
Sbjct: 5   EGATYGEQLLDASRRNNVDLLEFI---LEQDSNIVAKLINDTKDPFGNTCLHMCCKYGSW 61

Query: 64  EVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNY 123
           +VLD +LD +  IEIDPQN V+GDTPLH  V+YS+EEPEHGTFIA NLI+VGADPR++N 
Sbjct: 62  DVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPRIKNN 120

Query: 124 NNQKPIDLVHGDELDELIDLLQGAELAIDN 153
           + +KPI+L+H D+  +LIDLLQ AELA DN
Sbjct: 121 SGRKPIELIHNDKFTDLIDLLQSAELAADN 150

>AFR268C Chr6 complement(915788..916294) [507 bp, 168 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL242C
          Length = 168

 Score =  192 bits (488), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 99/160 (61%), Positives = 119/160 (74%), Gaps = 5/160 (3%)

Query: 1   MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKY 60
           M  +GASL EQLL+AARRNN++LLE V    D  PE I  LIN SR+PLGNT LHLCC +
Sbjct: 1   MSVDGASLGEQLLEAARRNNVELLEAVVR--DAGPE-IEDLINGSRDPLGNTCLHLCCTH 57

Query: 61  GSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRV 120
           GSWE LD +LD +  IE+DPQN   GDTPLH   RY+ EEPEH TF+A NL++VGADPRV
Sbjct: 58  GSWEALDMILDLDCAIEVDPQNTA-GDTPLHAAARYAAEEPEHATFLASNLVQVGADPRV 116

Query: 121 RNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNGLADN 160
           RN    +P++LVHG EL+ L+D+LQG ELA D T+G A N
Sbjct: 117 RNKAGLRPVELVHGSELEPLVDVLQGGELAYD-THGEAVN 155

>NCAS0C05160 Chr3 complement(1050360..1051586) [1227 bp, 408 aa]
           {ON} Anc_2.639
          Length = 408

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 50/107 (46%), Gaps = 12/107 (11%)

Query: 36  EKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVR 95
           +   + INE  E  G T +H  C Y  ++ L  ++     + I    D DG+TPLH+ + 
Sbjct: 96  QHFPRFINEKGE-HGRTPVHFACMYDHFQCLSLLIGVGANLTIK---DEDGETPLHICLE 151

Query: 96  YSQEEPEHGTFIARNLIEVGA--DPRVRNYNNQKPIDLVHGDELDEL 140
           YS           + L+  G      +++ NN KPID++   E+ ++
Sbjct: 152 YS------SIHCMKILLSEGQLDSANIKDGNNFKPIDVIESFEMGKI 192

>Skud_3.129 Chr3 (198354..199022) [669 bp, 222 aa] {ON} YCR051W
           (REAL)
          Length = 222

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 59/133 (44%), Gaps = 19/133 (14%)

Query: 15  AARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQ-E 73
           AA   N+D +E V    +      +K IN      G T +H    YG  ++L K+  +  
Sbjct: 8   AASDGNMDRVERVLRESNGATTPQSKDIN------GYTPMHAAAAYGHTDLLKKMCSEYN 61

Query: 74  GEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDL-V 132
           G+I +    D DGDTPLH       E+      I     E+G D  VRN   Q P DL V
Sbjct: 62  GDINV---LDNDGDTPLHHV-----EDVATAKLIVE---ELGGDFTVRNAEGQTPYDLFV 110

Query: 133 HGDELDELIDLLQ 145
              E  ELI+ ++
Sbjct: 111 ENGEDGELIEYMR 123

>YCR051W Chr3 (214071..214739) [669 bp, 222 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm and
           nucleus; contains ankyrin (Ank) repeats; YCR051W is not
           an essential gene
          Length = 222

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 61/134 (45%), Gaps = 21/134 (15%)

Query: 15  AARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQ-E 73
           AA   NLD +E +        E    +  +S++  G T +H    YG  ++L K+ ++  
Sbjct: 8   AASDGNLDRVEHILR------ESKGAMTPQSKDINGYTPMHAAAAYGHLDLLKKMCNEYN 61

Query: 74  GEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLI-EVGADPRVRNYNNQKPID-L 131
           G+I +    D DGDTPLH                AR ++ E+G D  +RN   Q P D  
Sbjct: 62  GDINV---LDNDGDTPLHHV---------EDVATARLIVEELGGDFTIRNVEGQTPYDSF 109

Query: 132 VHGDELDELIDLLQ 145
           V   E  ELI+ ++
Sbjct: 110 VENGEDGELIEYMR 123

>Ecym_2099 Chr2 complement(176120..176743) [624 bp, 207 aa] {ON}
           similar to Ashbya gossypii AAR063C
          Length = 207

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 61/125 (48%), Gaps = 20/125 (16%)

Query: 23  LLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQ-EGEIEIDPQ 81
           L ETV   L   P     L   S++P G TA+H    YG  ++L  ++++  G+I +   
Sbjct: 11  LTETVEKLLQQQP----GLTANSKDPNGYTAVHGAASYGHVDLLRLLVNKYHGDINV--- 63

Query: 82  NDVDGDTPLHVTVRYSQEEPEHGTFIARNLI-EVGADPRVRNYNNQKPIDLVHGDELDEL 140
            D DGDTPLH T              A+ +I E+ AD +  N   + P+D+   D+  E 
Sbjct: 64  RDNDGDTPLHHT---------EDVATAKVIIEELNADFQATNNEGKTPLDVFEEDQ--ES 112

Query: 141 IDLLQ 145
           I+L+Q
Sbjct: 113 IELIQ 117

>TDEL0A07340 Chr1 (1284474..1285121) [648 bp, 215 aa] {ON}
          Anc_6.319 YCR051W
          Length = 215

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 4/48 (8%)

Query: 45 SREPLGNTALHLCCKYGSWEVLDKVLDQ-EGEIEIDPQNDVDGDTPLH 91
          S++P G T++H    YG  E+L K+  Q  G+I I    D DGDTPLH
Sbjct: 29 SKDPNGYTSVHAAAAYGHIELLKKLCKQYNGDINI---RDNDGDTPLH 73

>Smik_3.153 Chr3 (212077..212817) [741 bp, 246 aa] {ON} YCR051W
           (REAL)
          Length = 246

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 58/133 (43%), Gaps = 19/133 (14%)

Query: 15  AARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQ-E 73
           AA   N+D +E +    + +     K IN      G T +H    YG  ++L K+  +  
Sbjct: 32  AASDGNVDRVERILRESNGSMTPQTKDIN------GYTPMHAAAAYGHTDLLKKMCSEYN 85

Query: 74  GEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPID-LV 132
           G+I +    D DGDTPLH       E+      I     E+G D  +RN   Q P D  V
Sbjct: 86  GDINV---LDNDGDTPLHHV-----EDVGTAKLIVE---ELGGDFTIRNAEGQTPYDSFV 134

Query: 133 HGDELDELIDLLQ 145
              E  ELI+ ++
Sbjct: 135 ENGEDGELIEYMR 147

>YMR068W Chr13 (406304..407584) [1281 bp, 426 aa] {ON}
           AVO2Component of a complex containing the Tor2p kinase
           and other proteins, which may have a role in regulation
           of cell growth
          Length = 426

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 15/109 (13%)

Query: 36  EKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVR 95
           ++  + IN   E  G   +H+ C    ++ L  ++    ++ +    D +GDTPLHV + 
Sbjct: 96  QQFPRFINHRGEN-GRAPIHIACMNDYYQCLSLLIGVGADLWV---MDTNGDTPLHVCL- 150

Query: 96  YSQEEPEHGTFIARNLI----EVGADPRVRNYNNQKPIDLVHGDELDEL 140
                 E+G+     ++    EV  D  VR+  N KPID+    E+  +
Sbjct: 151 ------EYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVAQTFEVGNI 193

>TPHA0I01580 Chr9 complement(358279..362019) [3741 bp, 1246 aa] {ON}
           Anc_8.599 YPL110C
          Length = 1246

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 15/96 (15%)

Query: 9   SEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDK 68
           +E L D++ + ++ LL      LDN PEK   L++ +R+  G T LH   ++G  E +D 
Sbjct: 394 TESLQDSSSKISIALLYI----LDNLPEKFRSLLS-NRDVYGKTPLHYSAEFGIAEFIDN 448

Query: 69  VLDQEGEIEI----------DPQNDVDGDTPLHVTV 94
           ++ +  +  I             +DVD  TP+H+ V
Sbjct: 449 IILKLQKWSIWNESYSIDDSRYWSDVDNHTPMHLAV 484

>NDAI0I00510 Chr9 complement(104836..105474) [639 bp, 212 aa] {ON}
           Anc_6.319 YCR051W
          Length = 212

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 50/103 (48%), Gaps = 13/103 (12%)

Query: 45  SREPLGNTALHLCCKYGSWEVLDKVLDQ-EGEIEIDPQNDVDGDTPLHVTVRYSQEEPEH 103
           S++P G T +H    YG  ++L  +  +  G+I I    D DGDTPLH    Y+      
Sbjct: 30  SKDPNGYTPIHAAAAYGHIDLLRSLCSEFGGDINI---RDNDGDTPLHHCEDYAT----- 81

Query: 104 GTFIARNLIEVGADPRVRNYNNQKPIDLVHGD-ELDELIDLLQ 145
           G  I     E+G +  + N   + P+++V  D E  ELI  L+
Sbjct: 82  GKVIVE---ELGGNFTLTNNEGKTPLEVVEEDGESTELIQYLK 121

>CAGL0F06655g Chr6 (654908..656134) [1227 bp, 408 aa] {ON} similar
           to uniprot|Q04749 Saccharomyces cerevisiae YMR068w
          Length = 408

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 55/118 (46%), Gaps = 8/118 (6%)

Query: 36  EKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVR 95
           +   + IN++ E LG T  H+ C +  ++ L  ++     + +    D  G+TPLH+ + 
Sbjct: 96  QHFPRFINKAGE-LGRTPTHIACIHDYYQCLSLLIGVGANLMMK---DDKGNTPLHLCLE 151

Query: 96  YSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHGDELDELIDLLQGAELAIDN 153
           +          +  N I++ +D  +RN +N +P D+    EL +    ++    A DN
Sbjct: 152 FGSTNCMK---MLVNEIQI-SDDSIRNNDNWRPSDVAKTVELAKFYKKIRKESAATDN 205

>Suva_3.89 Chr3 (127217..127888) [672 bp, 223 aa] {ON} YCR051W
           (REAL)
          Length = 223

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 62/134 (46%), Gaps = 21/134 (15%)

Query: 15  AARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLD-QE 73
           AA   N++ +E++    D+N      +  +S++  G T +H    YG  ++L K+     
Sbjct: 8   AASDGNVERVESILR--DSN----GAMTPQSKDVNGYTPMHAAAAYGHADLLKKLCSVYN 61

Query: 74  GEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLI-EVGADPRVRNYNNQKPID-L 131
           G+I +    D DGDTPLH                AR ++ E+G +  +RN   Q P D  
Sbjct: 62  GDINV---LDNDGDTPLHHV---------EDVATARLIVEELGGNVTIRNAEGQTPYDSF 109

Query: 132 VHGDELDELIDLLQ 145
           V   E  ELI+ ++
Sbjct: 110 VENGEDGELIEYMR 123

>YIL112W Chr9 (151595..154846) [3252 bp, 1083 aa] {ON}  HOS4Subunit
           of the Set3 complex, which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity; potential Cdc28p substrate
          Length = 1083

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 57/117 (48%), Gaps = 12/117 (10%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGT 105
           R+  G T L + C  G ++V+ K++ +EG  +I+ Q++  G+T LH        E     
Sbjct: 326 RDSGGRTRLQIACDKGKYDVVKKMI-EEGGYDINDQDNA-GNTALHEAALQGHIE----- 378

Query: 106 FIARNLIEVGADPRVRN---YNNQKPIDLVHGDELDELIDLLQ-GAELAIDNTNGLA 158
            I   LIE GAD  +++   + +   ID      LD +  LL+ GA+  I N  GL 
Sbjct: 379 -IVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLT 434

>Suva_9.82 Chr9 (146137..149562) [3426 bp, 1141 aa] {ON} YIL112W
           (REAL)
          Length = 1141

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 12/117 (10%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGT 105
           R+  G T L + C  G ++V+ K++ ++G  +I+ Q++  G+T LH        E     
Sbjct: 383 RDSGGRTRLQIACDKGKFDVVQKMI-EDGGYDINDQDNA-GNTALHEAALQGHIE----- 435

Query: 106 FIARNLIEVGADPRVRN---YNNQKPIDLVHGDELDELIDLL-QGAELAIDNTNGLA 158
            I   LIE GAD  +++   + +   ID      LD +  LL QGA+  I N+ GL 
Sbjct: 436 -IVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKQGADPTIRNSKGLT 491

>KAFR0J02500 Chr10 (476605..477243) [639 bp, 212 aa] {ON}
          Anc_6.319 YCR051W
          Length = 212

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 11/68 (16%)

Query: 32 DNNPEKIAKLINE-------SREPLGNTALHLCCKYGSWEVLDKVLDQ-EGEIEIDPQND 83
          D   E + K +NE       +++P G T +H    YG  ++L K+  +  G++ I    D
Sbjct: 9  DGRQELVEKFLNENPSLSANTKDPNGYTPVHAAAAYGHHDLLRKLCSEYNGDVNI---RD 65

Query: 84 VDGDTPLH 91
           DGDTPLH
Sbjct: 66 ADGDTPLH 73

>NDAI0G04540 Chr7 (1085981..1087351) [1371 bp, 456 aa] {ON}
           Anc_2.639 YMR068W
          Length = 456

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 7/93 (7%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIAR 109
           G T +H+ C +  ++ L  ++    ++ +    D +G+TPLH+ + Y   +         
Sbjct: 109 GWTPVHIACMHDHYQCLSLLIGVGADVLL---TDDNGETPLHICLEYGSVQCMRLLVKET 165

Query: 110 NLIEVGADPRVRNYNNQKPIDLVHGDELDELID 142
           NLI    +  V++ NN KP D+V   EL +L +
Sbjct: 166 NLI----NDNVKDMNNFKPSDVVETFELGKLYN 194

>TBLA0F04020 Chr6 (993029..993688) [660 bp, 219 aa] {ON} Anc_6.319
          YCR051W
          Length = 219

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 13/79 (16%)

Query: 15 AARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQE- 73
          AA    +DL+E   N+ DN       LI  S++P G T +H    YG  ++L ++L Q+ 
Sbjct: 6  AASDGRIDLVEKFLNN-DNG------LIANSKDPNGYTPIHAAAAYGHVDLL-RLLCQKY 57

Query: 74 -GEIEIDPQNDVDGDTPLH 91
           G+I I    D DGDTPLH
Sbjct: 58 NGDINI---LDNDGDTPLH 73

>Skud_13.224 Chr13 (380698..381966) [1269 bp, 422 aa] {ON} YMR068W
           (REAL)
          Length = 422

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 14/95 (14%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIAR 109
           G   +H+ C    ++ L  ++    ++ +    D +GDTPLHV +       E+G+    
Sbjct: 109 GRAPIHIACMNDYYQCLSLLIGVGADLWV---MDTNGDTPLHVCL-------EYGSINCM 158

Query: 110 NLI----EVGADPRVRNYNNQKPIDLVHGDELDEL 140
            ++    E+  D  VR+  N KPID+    E+  +
Sbjct: 159 KMLVNEGEISLDDSVRDKGNWKPIDVAQTFEVGNM 193

>TBLA0A00780 Chr1 complement(168204..170384) [2181 bp, 726 aa] {ON}
           Anc_2.639 YMR068W
          Length = 726

 Score = 37.0 bits (84), Expect = 0.019,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 11/93 (11%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIAR 109
           G T  H+ C +  ++ L  ++    ++ I   ND +GDTPLHV + Y            +
Sbjct: 109 GQTPTHIACMHDYYQCLSLLVGVGADLSI--VND-EGDTPLHVCLEYGSVN------CMK 159

Query: 110 NLIEVG--ADPRVRNYNNQKPIDLVHGDELDEL 140
            LI+ G   D  +RN NN +P D+    EL  L
Sbjct: 160 MLIQEGNMTDDTIRNRNNWRPSDVAKTYELARL 192

>Smik_13.247 Chr13 (390443..391735) [1293 bp, 430 aa] {ON} YMR068W
           (REAL)
          Length = 430

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 49/106 (46%), Gaps = 15/106 (14%)

Query: 36  EKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVR 95
           ++  + IN   E  G   +H+ C    ++ L  ++    ++ +    D +GDTPLHV + 
Sbjct: 96  QQFPRFINHRGEN-GRAPIHIACMNDYYQCLSLLIGVGADLWVV---DANGDTPLHVCL- 150

Query: 96  YSQEEPEHGTFIARNLI----EVGADPRVRNYNNQKPIDLVHGDEL 137
                 E+G+     ++    EV  D  VR+  N KPI++    E+
Sbjct: 151 ------EYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIEVAQTFEV 190

>Suva_13.243 Chr13 (387561..388661,388691..388840) [1251 bp, 416 aa]
           {ON} YMR068W (REAL)
          Length = 416

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 49/106 (46%), Gaps = 15/106 (14%)

Query: 36  EKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVR 95
           ++  + IN   E  G   +H+ C    ++ L  ++    ++ +    D +GDTPLHV + 
Sbjct: 96  QQFPQFINHRGEN-GRAPIHIACMKNYYQCLSLLIGVGADLWV---MDTNGDTPLHVCL- 150

Query: 96  YSQEEPEHGTFIARNLI----EVGADPRVRNYNNQKPIDLVHGDEL 137
                 E+G+     ++    EV  D  V++  N KPID+    E+
Sbjct: 151 ------EYGSLNCMKMLVNEGEVSLDDNVKDNGNWKPIDVAQTFEV 190

>Kpol_1028.58 s1028 complement(133357..133983) [627 bp, 208 aa] {ON}
           complement(133357..133983) [627 nt, 209 aa]
          Length = 208

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 13/107 (12%)

Query: 41  LINESREPLGNTALHLCCKYGSWEVLDKVLDQE-GEIEIDPQNDVDGDTPLHVTVRYSQE 99
           L   S++P G T +H    YG   +L+K+  +  G+I +    D DGDTPLH       E
Sbjct: 25  LTANSKDPNGYTPVHAAAAYGHIGLLEKLCKEYGGDINV---RDSDGDTPLHHV-----E 76

Query: 100 EPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHGD-ELDELIDLLQ 145
           +     FI     E+  D ++ N   +  +++   D E  ELI  ++
Sbjct: 77  DANTARFIVE---ELNGDYKLTNEEGKTALEVFEEDSEFPELIQYMR 120

>KLLA0C09108g Chr3 complement(795433..796059) [627 bp, 208 aa] {ON}
           similar to uniprot|P25631 Saccharomyces cerevisiae
           YCR051W Hypothetical ORF
          Length = 208

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 15/107 (14%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQE-GEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIA 108
           G T +H    YG  ++L K++ +  G++ I    D D DTPLH          E  T  A
Sbjct: 32  GYTPIHAAAAYGHIDLLKKLVQEHNGDVNI---KDSDNDTPLH--------HCEDAT-TA 79

Query: 109 RNLIE-VGADPRVRNYNNQKPIDLVHGDELDELIDLLQGAELAIDNT 154
           R+LIE +GAD  + N N  K    V  +  D+ +DLL+ AE  +  T
Sbjct: 80  RSLIEQLGADRELLN-NEGKTCFQVWQETCDDNLDLLRYAEEVLGET 125

>AAR063C Chr1 complement(453099..453761) [663 bp, 220 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR051W
          Length = 220

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 51/108 (47%), Gaps = 23/108 (21%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVL-DQEGEIEIDPQNDVDGDTPLH-----VTVRYSQE 99
           ++P G T +H    YG  ++L  ++ +  G++ +    D DGDTPLH      TVR   E
Sbjct: 29  KDPNGYTPMHAAAAYGHIDLLRLLIANYRGDVNV---RDNDGDTPLHHAEDLQTVRVLVE 85

Query: 100 EPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHGD-ELDELIDLLQG 146
                        E+GADP + N +   P+ +   D E  ELI+ ++ 
Sbjct: 86  -------------ELGADPSLLNADGNTPLAVYEDDAENAELIEYMRA 120

>SAKL0G15554g Chr7 complement(1337081..1340353) [3273 bp, 1090 aa]
           {ON} similar to uniprot|P17442 Saccharomyces cerevisiae
           YGR233C PHO81 Cyclin-dependent kinase (CDK) inhibitor
           regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK
           complexes in response to phosphate levels required for
           derepression of PHO5 transcriptionally regulated by
           Pho4p and Pho2p
          Length = 1090

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 72/152 (47%), Gaps = 17/152 (11%)

Query: 12  LLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLD 71
           L+ A  RN++D+ +T+  +   NP   +  INE   P   + L++ C + + + +  +L+
Sbjct: 434 LILAITRNHIDITKTLLVNAGANP---SPEINEFSRP-QFSPLNVACAHKNLDAVKLILE 489

Query: 72  QEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADP-RVRNYNNQKPID 130
             G+I++    D  G  PLH+  + + +       +   L+  GADP  +  +N   PI 
Sbjct: 490 I-GKIDLTKVRDSQGLCPLHIVAKNAGDAQ-----LIELLVSHGADPNSIDGFNQWTPIF 543

Query: 131 LV----HGDELDELIDLLQGAELAIDNTNGLA 158
                 H   ++ELI    GA L + + + L+
Sbjct: 544 YAIQEGHTSTVEELIK--NGARLNLTDDDNLS 573

>SAKL0A01870g Chr1 complement(167727..168347) [621 bp, 206 aa]
          {ON} highly similar to gnl|GLV|CAGL0C03003g Candida
          glabrata CAGL0C03003g and similar to YCR051W
          uniprot|P25631 Saccharomyces cerevisiae YCR051W
          Hypothetical ORF
          Length = 206

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 36/79 (45%), Gaps = 14/79 (17%)

Query: 15 AARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQ-- 72
          AA     DL+E   N+          L   SR+P G T +H    Y   E+L K+  +  
Sbjct: 6  AASDGRTDLVEQFLNN---------GLSANSRDPNGYTPIHAAASYAHTELLRKLCSEPY 56

Query: 73 EGEIEIDPQNDVDGDTPLH 91
           G+I +    D DGDTPLH
Sbjct: 57 NGDINV---RDNDGDTPLH 72

>CAGL0C03003g Chr3 (297244..297864) [621 bp, 206 aa] {ON} similar
          to uniprot|P25631 Saccharomyces cerevisiae YCR051w
          Length = 206

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 4/48 (8%)

Query: 45 SREPLGNTALHLCCKYGSWEVLDKVLDQE-GEIEIDPQNDVDGDTPLH 91
          S++P G T +H    YG  ++L K+  +  G+I +    D DGDTPLH
Sbjct: 27 SKDPNGYTPVHAAAAYGHLDLLRKLCQEHGGDINV---RDSDGDTPLH 71

>KLTH0A06248g Chr1 (524183..524791) [609 bp, 202 aa] {ON} similar to
           uniprot|P25631 Saccharomyces cerevisiae YCR051W
           Hypothetical ORF
          Length = 202

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 49/109 (44%), Gaps = 14/109 (12%)

Query: 41  LINESREPLGNTALHLCCKYGSWEVLDKVLDQ--EGEIEIDPQNDVDGDTPLHVTVRYSQ 98
              ES++P G T +H    YG  ++L ++      G + +    D DGDTPLH       
Sbjct: 23  FTAESKDPNGYTPIHAAASYGHIDLLRELCSAPYSGSVNV---RDNDGDTPLHHC----- 74

Query: 99  EEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHGD-ELDELIDLLQG 146
           E+      I   L E+G D ++ N   +  + +   D E  +LI  L+G
Sbjct: 75  EDANTARVI---LEELGGDAKLTNNEGKTALAVCEEDGEFTDLIQYLRG 120

>TPHA0D03790 Chr4 (797282..797923) [642 bp, 213 aa] {ON} Anc_6.319
          YCR051W
          Length = 213

 Score = 35.0 bits (79), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 11/78 (14%)

Query: 15 AARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQ-E 73
          AA    +DL+E   NS           +N S++  G T +H    YG  ++L K+ ++  
Sbjct: 6  AASDGRIDLVEKFLNS------NTGVTVN-SKDENGYTPVHAAAAYGHNDLLRKLCNEYN 58

Query: 74 GEIEIDPQNDVDGDTPLH 91
          G+I I    D DGDTPLH
Sbjct: 59 GDINI---RDFDGDTPLH 73

>Skud_9.59 Chr9 (128451..131684) [3234 bp, 1077 aa] {ON} YIL112W
           (REAL)
          Length = 1077

 Score = 35.4 bits (80), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 56/117 (47%), Gaps = 12/117 (10%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGT 105
           R+  G T L + C  G ++V+ K+L +EG  +I+ Q++  G+T LH        E     
Sbjct: 315 RDSGGRTRLQIACDKGKFDVVKKML-EEGGYDINDQDNA-GNTALHEAALQGHIE----- 367

Query: 106 FIARNLIEVGADPRVRN---YNNQKPIDLVHGDELDELIDLLQG-AELAIDNTNGLA 158
            I   LIE GAD  +++   + +   ID      LD +  LL+  A+  I N  GL 
Sbjct: 368 -IVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNDADPTIRNAKGLT 423

>TDEL0B07330 Chr2 (1291145..1292272) [1128 bp, 375 aa] {ON}
           Anc_2.639 YMR068W
          Length = 375

 Score = 35.0 bits (79), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 7/91 (7%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIAR 109
           G   +H+ C +  ++ L  ++    +++I    D DGDTPLHV + Y          I  
Sbjct: 109 GRAPIHIACMHDHFQCLSLLMGVGAKLDI---TDDDGDTPLHVCLEYGSIHCMKLLLIDG 165

Query: 110 NLIEVGADPRVRNYNNQKPIDLVHGDELDEL 140
            ++   A    RN  N +P D+    EL +L
Sbjct: 166 GIVNDNA----RNNLNWRPSDVAETFELAKL 192

>Smik_6.443 Chr6 complement(724235..724834) [600 bp, 199 aa] {ON}
           YPL239W (REAL)
          Length = 199

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 6/58 (10%)

Query: 23  LLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDP 80
           +LETV  +L+N+ +++   INE+ E  GNTALH     G  EV+  + D   E E DP
Sbjct: 69  ILETV--ALENSAKELKAFINEANET-GNTALHWASLNGKLEVVKLLCD---EYEADP 120

>ZYRO0D08690g Chr4 complement(747083..747709) [627 bp, 208 aa] {ON}
           highly similar to gnl|GLV|CAGL0C03003g Candida glabrata
           CAGL0C03003g and similar to YCR051W uniprot|P25631
           Saccharomyces cerevisiae YCR051W Hypothetical ORF
          Length = 208

 Score = 34.3 bits (77), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 46/102 (45%), Gaps = 13/102 (12%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVLDQE-GEIEIDPQNDVDGDTPLHVTVRYSQEEPEHG 104
           ++P G T +H    YG  E+L K+  +  G I +    D DGDTPLH        E  H 
Sbjct: 30  KDPNGYTPVHAAAAYGHIELLRKLCQEYGGNINV---KDSDGDTPLHHC------EDAHT 80

Query: 105 TFIARNLIEVGADPRVRNYNNQKPIDLVHGD-ELDELIDLLQ 145
             +   L E+G D  ++N   +  +     D E  ELI  L+
Sbjct: 81  AKVI--LEELGGDISLQNEEGKTALQSAEEDGEFPELIQYLR 120

>Smik_9.57 Chr9 (129281..132538) [3258 bp, 1085 aa] {ON} YIL112W
           (REAL)
          Length = 1085

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 56/117 (47%), Gaps = 12/117 (10%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGT 105
           R+  G T L + C  G ++V+  ++ +EG  +I+ Q++  G+T LH        E     
Sbjct: 322 RDSGGRTRLQIACDKGKFDVVKNMI-EEGSYDINDQDNA-GNTALHEAALQGHIE----- 374

Query: 106 FIARNLIEVGADPRVRN---YNNQKPIDLVHGDELDELIDLLQ-GAELAIDNTNGLA 158
            I   LI+ GAD  +++   + +   ID      LD +  LL+ GA+  I N  GL 
Sbjct: 375 -IVELLIKNGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLT 430

>KAFR0J01540 Chr10 complement(277907..281113) [3207 bp, 1068 aa]
           {ON} Anc_2.257 YIL112W
          Length = 1068

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 29/43 (67%), Gaps = 2/43 (4%)

Query: 49  LGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLH 91
            G+T LH  C  G ++++ ++L ++ EI+I  +++  G+TPLH
Sbjct: 335 FGSTKLHTACNKGKYDIVKQIL-EDDEIDIHDRDNA-GNTPLH 375

>KNAG0I02590 Chr9 complement(499721..500365) [645 bp, 214 aa] {ON}
          Anc_6.319 YCR051W
          Length = 214

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 41 LINESREPLGNTALHLCCKYGSWEVLDKVL-DQEGEIEIDPQNDVDGDTPLH 91
          L   S +P G T +H    YG  ++L  +  + +G+I I    D DGDTPLH
Sbjct: 25 LTANSADPNGYTPIHAAAAYGHIDMLRTLCREYDGDINI---RDADGDTPLH 73

>TBLA0G02500 Chr7 complement(648451..652230) [3780 bp, 1259 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1259

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 54/118 (45%), Gaps = 15/118 (12%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGT 105
           R+  G T L + C  G +++  K+L++  ++      D  G+T LH       E   +G 
Sbjct: 508 RDSAGRTKLQIACDKGKYDLAKKLLEENYDVNYQ---DNAGNTALH-------EAALNGY 557

Query: 106 F-IARNLIEVGADPRVRNY---NNQKPIDLVHGDELDELIDLL-QGAELAIDNTNGLA 158
             I + LIE GAD  +++Y    +   ID      LD +  LL  GA+  I N  G+ 
Sbjct: 558 LDIVKLLIEYGADINLQSYELFKDTPLIDASSNGHLDVVKFLLNSGADPLIANAKGIT 615

>TDEL0C04040 Chr3 complement(707532..710555) [3024 bp, 1007 aa] {ON}
           Anc_2.257 YIL112W
          Length = 1007

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 59/118 (50%), Gaps = 14/118 (11%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGT 105
           R+  G T L + C  G++E   K++++EG  +++ Q++  G+T LH       E   +G 
Sbjct: 315 RDAGGRTRLQISCDKGNYEQAKKLIEEEG-YDVNDQDNA-GNTALH-------EAALNGH 365

Query: 106 F-IARNLIEVGADPRVRNYNNQKPIDLVHGD---ELDELIDLL-QGAELAIDNTNGLA 158
             I + LIE GAD  ++++   K   L+       LD +  LL  GA+  I N  GL 
Sbjct: 366 LDIVKLLIENGADVNMQSFEMFKDTPLIDASANGHLDVVKYLLSHGADPTICNAKGLT 423

>KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} similar
           to uniprot|P09959 Saccharomyces cerevisiae YLR182W SWI6
           Transcription cofactor forms complexes with DNA-binding
           proteins Swi4p and Mbp1p to regulate transcription at
           the G1/S transition involved in meiotic gene expression
           localization regulated by phosphorylation potential
           Cdc28p substrate
          Length = 663

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 6/52 (11%)

Query: 83  DVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHG 134
           D++GDT L++  R           I   L++ GADPR+ N +  +P+D   G
Sbjct: 354 DINGDTCLNIASRLG------NVSIVEALLDYGADPRISNNSGLRPVDFGAG 399

>CAGL0H00935g Chr8 (91979..92560) [582 bp, 193 aa] {ON} highly
           similar to uniprot|P46683 Saccharomyces cerevisiae
           YPL239w YAR1 ankyrin repeat-containing protein
          Length = 193

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 24/128 (18%)

Query: 16  ARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQ--- 72
           AR  +L+ L+ +F +L + P+ +A  ++      G+TALH+    G  EV+  +++Q   
Sbjct: 20  ARAGDLESLQEIFTTLIH-PKLLATCVSSDN---GSTALHMAAANGHLEVVKYIMEQVKQ 75

Query: 73  ---EGEI--EIDPQNDVDGDTPLHV--------TVRYSQEEPEHGTFIARNLIEVGADPR 119
               G +   ++ QN   G+T LH          V+Y  +E +   F+     E G DP 
Sbjct: 76  SADAGAVGRYVNLQNKT-GNTALHWATLNGKLDVVQYLCDECDADPFVKN---EFGHDPI 131

Query: 120 VRNYNNQK 127
               NN K
Sbjct: 132 FEAENNGK 139

>Kwal_23.6218 s23 (1495388..1495996) [609 bp, 202 aa] {ON} YCR051W
          - Hypothetical ORF [contig 15] FULL
          Length = 202

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 13/54 (24%)

Query: 44 ESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQN------DVDGDTPLH 91
          ES++P G T +H    Y   ++L K+         DP N      D DGDTPLH
Sbjct: 26 ESKDPNGYTPIHAAASYAHIDLLKKLCS-------DPYNGNINVKDNDGDTPLH 72

>ZYRO0E00924g Chr5 complement(62334..63560) [1227 bp, 408 aa] {ON}
           similar to uniprot|Q04749 Saccharomyces cerevisiae
           YMR068W AVO2 Component of a complex containing the Tor2p
           kinase and other proteins which may have a role in
           regulation of cell growth
          Length = 408

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 46/103 (44%), Gaps = 12/103 (11%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIAR 109
           G T +H+ C++  ++  + ++     + I    D  GDTPLHV + Y            +
Sbjct: 109 GKTPVHIACQHDYFQCFNLLMGVGANLTI---KDDYGDTPLHVCLEYGSIN------CMK 159

Query: 110 NLIEVGA--DPRVRNYNNQKPIDLVHGDELDELI-DLLQGAEL 149
            LI  G   D  V+N    KP D+    E  +L   +L+ A++
Sbjct: 160 MLILQGGIVDDHVKNKKGWKPSDVASTYETTKLYTKVLKEAQM 202

>Kwal_33.13259 s33 (143081..145075) [1995 bp, 664 aa] {ON} YLR182W
           (SWI6) - transcription factor [contig 119] FULL
          Length = 664

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 6/52 (11%)

Query: 83  DVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHG 134
           D++GDT L++  R           I   L++ GADPR+ N +  +P+D   G
Sbjct: 355 DINGDTCLNIASRLG------NVSIVEALLDYGADPRISNNSGLRPMDFGAG 400

>Ecym_3384 Chr3 complement(728692..732132) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii ACR165W
          Length = 1146

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 47/116 (40%), Gaps = 19/116 (16%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIAR 109
           G+T LHL C  G  +++  ++ +   +E+    D  G TPLH        +      I R
Sbjct: 747 GHTMLHLACLKGYHQLVSLLVRKGARVEV---GDSYGFTPLHFACLNGDAK------IIR 797

Query: 110 NLIEVGADPRVRNYNNQKPIDLV----------HGDELDELIDLLQGAELAIDNTN 155
            L++  A       N   P+ L           +    +E++D+L  ++   D+ N
Sbjct: 798 LLVQCKAQVSTEAKNGTNPVGLFLANHQTNDERYKHYFNEVMDVLTKSDYEFDSYN 853

>KLLA0E15687g Chr5 (1402940..1406386) [3447 bp, 1148 aa] {ON}
           similar to uniprot|P17442 Saccharomyces cerevisiae
           YGR233C PHO81 Cyclin-dependent kinase (CDK) inhibitor
           regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK
           complexes in response to phosphate levels required for
           derepression of PHO5 transcriptionally regulated by
           Pho4p and Pho2p
          Length = 1148

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 52/110 (47%), Gaps = 13/110 (11%)

Query: 54  LHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIE 113
           L++ C   ++E   KV+ ++G+I +    D  G  PLH+  +        G+ + + L+ 
Sbjct: 505 LNVACSNKNYEA-AKVILEKGDINLSRLRDSQGLCPLHIVAKMGG-----GSELIKLLVS 558

Query: 114 VGADP-RVRNYNNQKPIDLV----HGDELDELIDLLQGAELAIDNTNGLA 158
            GADP  +  +N   PI       H   +  L++L  GA++ + +   L+
Sbjct: 559 YGADPDEIDGFNKWPPIFYAIQEGHATTVQVLLEL--GADVFMKDQQNLS 606

>ZYRO0B15114g Chr2 complement(1233061..1233741) [681 bp, 226 aa]
           {ON} similar to uniprot|P50086 Saccharomyces cerevisiae
           YGR232W NAS6 Regulatory non-ATPase subunit of the 26S
           proteasome homolog of the human oncoprotein gankyrin
           which interacts with the retinoblastoma tumor suppressor
           (Rb) and cyclin-dependent kinase 4/6
          Length = 226

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 52/116 (44%), Gaps = 9/116 (7%)

Query: 42  INESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEID-PQNDVDGDTPLHVTVRYSQEE 100
           INE ++  G T  H+ C  G+ +++ ++     + +++ P N   G T LH+ V      
Sbjct: 63  INELKDESGWTPFHIACAVGNLDIVKQLYALHTKPDLNMPTN--QGITALHLAVSKKHAR 120

Query: 101 PEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNG 156
                 I   L+  GA  RV++  +Q P+          ++D+L  A   ++  +G
Sbjct: 121 ------ICEFLLNNGASVRVKDKRSQLPLHRAAAIGSMGMVDMLCRAGSPLNRNDG 170

>Skud_1.91 Chr1 (162916..166413) [3498 bp, 1165 aa] {ON} YAR042W
           (REAL)
          Length = 1165

 Score = 32.7 bits (73), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 78  IDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLV 132
           +DP+    GDT LH  V+      +    + R L+E GADP  R+   + PIDLV
Sbjct: 191 MDPET---GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRKGKLPIDLV 236

>SAKL0E08382g Chr5 complement(676318..679575) [3258 bp, 1085 aa]
           {ON} similar to uniprot|P40480 Saccharomyces cerevisiae
           YIL112W HOS4 Subunit of the Set3 complex which is a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity potential Cdc28p
           substrate
          Length = 1085

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 14/118 (11%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGT 105
           R+  G T L + C  G +++   ++ +EG   ++ Q++  G++PLH       E   +G 
Sbjct: 354 RDAGGRTKLQIACDKGKYDLAKMLIVEEG-YNVNDQDNA-GNSPLH-------EAALNGH 404

Query: 106 F-IARNLIEVGADPRVRNYNNQKPIDLVHGDELD--ELIDLL--QGAELAIDNTNGLA 158
             I + L+E GAD  +++Y   K   L+        E++ LL   GA+  I N  GL 
Sbjct: 405 LDIVKLLLEHGADINIQSYEMFKDTPLIDASANGHLEVVKLLLDHGADPTIVNAKGLT 462

>Suva_1.110 Chr1 (170339..173818) [3480 bp, 1159 aa] {ON} YAR042W
           (REAL)
          Length = 1159

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 78  IDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLV 132
           +DP+    GDT LH  V+      +    + R L+E GADP  R+   + PIDLV
Sbjct: 191 MDPET---GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRKGKLPIDLV 236

>TDEL0D04480 Chr4 (818876..822682) [3807 bp, 1268 aa] {ON} Anc_3.175
           YAR042W
          Length = 1268

 Score = 32.7 bits (73), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 78  IDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLV 132
           +DP+    GDT LH  V+      +    + R L+E GADP  R+   + PIDLV
Sbjct: 220 MDPET---GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRQGKLPIDLV 265

>NCAS0C03680 Chr3 complement(737681..741307) [3627 bp, 1208 aa] {ON}
           Anc_3.175
          Length = 1208

 Score = 32.3 bits (72), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 78  IDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLV 132
           +DP+    GDT LH  V+      +    + R L+E GADP  R+   + PIDLV
Sbjct: 200 MDPET---GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDSKGKLPIDLV 245

 Score = 32.0 bits (71), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 14  DAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQE 73
           DA R+ N   L+ + NS    P    +++ E  E + N A+ +       +++   +D++
Sbjct: 35  DALRQGNFQQLQALLNSSQFQPSD-NEIVLEVTELMLNYAVQVAPLPLIKDIVKYYVDEK 93

Query: 74  GEIEIDPQNDVDGDTPLHVTVRYSQ 98
           G ++I+ Q D +G+TPLH+    S+
Sbjct: 94  GLLDIN-QKDANGNTPLHLAAYQSR 117

>Kpol_1073.8 s1073 complement(10633..11919) [1287 bp, 428 aa] {ON}
           complement(10633..11919) [1287 nt, 429 aa]
          Length = 428

 Score = 32.3 bits (72), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 45/99 (45%), Gaps = 13/99 (13%)

Query: 49  LGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIA 108
            G T  H+ C +   + L  ++    ++ +    D +GDTPLH+ +       E G+   
Sbjct: 108 FGRTPAHIACMHDYHQCLSLLVGVGAKLFLP---DCNGDTPLHICL-------EFGSVNC 157

Query: 109 RNLIEV---GADPRVRNYNNQKPIDLVHGDELDELIDLL 144
             L+ +     D ++RN +N +P D+    E+ +L   L
Sbjct: 158 MRLLVLETENIDDQIRNNDNWRPSDVAITFEMMKLYKKL 196

>Smik_1.107 Chr1 (171768..175307) [3540 bp, 1179 aa] {ON} YAR042W
           (REAL)
          Length = 1179

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 78  IDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLV 132
           +DP+    GDT LH  V+      +    + R L+E GADP  R+   + PIDLV
Sbjct: 191 MDPET---GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRKGKLPIDLV 236

>Suva_16.68 Chr16 (108464..109063) [600 bp, 199 aa] {ON} YPL239W
           (REAL)
          Length = 199

 Score = 32.0 bits (71), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 6/58 (10%)

Query: 23  LLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDP 80
           +LETV  S +N+ E++   INE  E  GNTALH     G  +V+  + DQ    E DP
Sbjct: 69  ILETV--SRENSAEELKAFINEVNET-GNTALHWASLNGKLDVVRLLCDQ---YEADP 120

>Kpol_1039.26 s1039 (82489..86103) [3615 bp, 1204 aa] {ON}
           (82489..86103) [3615 nt, 1205 aa]
          Length = 1204

 Score = 32.3 bits (72), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLH 91
           R+  G T L + C  G ++ + K+++ EGEI+++ Q++  G++ LH
Sbjct: 388 RDSGGRTKLQIACDKGKYDTVKKLIE-EGEIDVNDQDNA-GNSSLH 431

>NCAS0D04430 Chr4 (843610..844302) [693 bp, 230 aa] {ON} Anc_6.319
          Length = 230

 Score = 31.6 bits (70), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 10/78 (12%)

Query: 15 AARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQ-E 73
          AA     DL+E    + +N P         S++P G T +H    YG  ++L  +     
Sbjct: 20 AASDGRQDLVEQYLTA-ENTP-----FTANSKDPNGYTPIHAAAAYGHKDLLRLLCSTYN 73

Query: 74 GEIEIDPQNDVDGDTPLH 91
          G++ +    D DGDTPLH
Sbjct: 74 GDVNV---RDSDGDTPLH 88

>NCAS0B08660 Chr2 (1665156..1667411) [2256 bp, 751 aa] {ON} Anc_1.60
          Length = 751

 Score = 32.0 bits (71), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 83  DVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHG 134
           DV+GDT L++  R           I   L+E GADP + N +  +P+D   G
Sbjct: 407 DVNGDTCLNIAARLG------NVGIVDALLEYGADPYIANKSGLRPLDFGAG 452

>Kpol_1050.62 s1050 (137219..137911) [693 bp, 230 aa] {ON}
          (137219..137911) [693 nt, 231 aa]
          Length = 230

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 6/69 (8%)

Query: 31 LDNNPEKIAKLINESREPL------GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDV 84
          +DN+ +K+ + + +S + +      G T LH    +    ++  +LD    I+ID  +D 
Sbjct: 14 MDNDLKKVQEFLEQSPQDVTKVDLDGRTGLHWAVSFQYEPIVRLLLDNMKGIDIDQLSDN 73

Query: 85 DGDTPLHVT 93
           G TP H+ 
Sbjct: 74 SGWTPFHIA 82

>KNAG0M02510 Chr13 complement(465793..467028) [1236 bp, 411 aa] {ON}
           Anc_2.639 YMR068W
          Length = 411

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQN 82
           G T LH+C +YGS E L  +L +  +++++  N
Sbjct: 142 GETPLHICLEYGSTECLKLLLQERPKVDVNAVN 174

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 32/80 (40%), Gaps = 18/80 (22%)

Query: 19  NNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEI 78
           + L L  TVF  L  NP ++AKL  ++   +    LHL  K+  W               
Sbjct: 201 SKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGAKHIFWR-------------- 246

Query: 79  DPQNDVDGD----TPLHVTV 94
           DP N V       TP H+ V
Sbjct: 247 DPGNSVGRGGQLFTPAHMAV 266

>KAFR0A00280 Chr1 complement(53403..54566) [1164 bp, 387 aa] {ON}
           Anc_2.639 YMR068W
          Length = 387

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQEGEIE 77
           G T LHLC +YGS+  L  +L  +  I+
Sbjct: 143 GETPLHLCLEYGSYHCLRMLLTYDTSIK 170

>TBLA0A00680 Chr1 complement(145681..150165) [4485 bp, 1494 aa] {ON}
            Anc_2.662 YIR033W
          Length = 1494

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/43 (25%), Positives = 22/43 (51%)

Query: 46   REPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDT 88
            ++  G T LH  C  G+++++  +L    +  I  QN++   T
Sbjct: 1027 KDSFGFTPLHFACVNGNFKIIKILLSCNADYSIKAQNNITAKT 1069

>YAR042W Chr1 (192619..196185) [3567 bp, 1188 aa] {ON}  SWH1Protein
           similar to mammalian oxysterol-binding protein; contains
           ankyrin repeats; localizes to the Golgi and the
           nucleus-vacuole junction
          Length = 1188

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 78  IDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLV 132
           +DP+    GDT LH  V+      +    + R L+E GADP  R+   + PI+LV
Sbjct: 192 MDPET---GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDRKGKLPIELV 237

>KLLA0F03619g Chr6 (342770..345652) [2883 bp, 960 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112W HOS4
           Subunit of the Set3 complex which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity potential Cdc28p substrate
          Length = 960

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLH 91
           R+  G T L + C  G +++  K+++++G  +++ Q++  G+TPLH
Sbjct: 255 RDAGGRTKLQIACDKGKYDLAKKLIEEDG-YDVNDQDNA-GNTPLH 298

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 30.8 bits (68), Expect = 2.1,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 25/128 (19%)

Query: 10  EQLLDAARRNNLDLLETVFNS----LDNNPEKIAKLINESREPLGNTALHLCCKYGSWEV 65
           +Q + A +R +L  ++ + NS    ++N+ +K  ++          T LH         V
Sbjct: 67  DQFMSACQRGDLAAVKEIVNSGQVDINNDYDKTEQV----------TGLHWASINNRLGV 116

Query: 66  LDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNN 125
           +D ++ +  ++ I   +      PLH   RY         +I   L+E GADPRV    +
Sbjct: 117 VDFLVSRGADVNIKAGSL--HAPPLHWAARYGY------VYIVHYLLEHGADPRV---TD 165

Query: 126 QKPIDLVH 133
            +  +L+H
Sbjct: 166 DQGFNLLH 173

>KNAG0C00650 Chr3 (110325..112571) [2247 bp, 748 aa] {ON} Anc_1.60
           YLR182W
          Length = 748

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 6/52 (11%)

Query: 83  DVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHG 134
           D +GDT L++  R           I   L++ GADP + N +  +P+D   G
Sbjct: 418 DYNGDTSLNIAARLGN------VAIVDALLDYGADPYIANKSGLRPVDFGAG 463

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 30.4 bits (67), Expect = 2.4,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 11/87 (12%)

Query: 44  ESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLH-VTVRYSQEEPE 102
           +S +P G TALH     G    ++ +L  + ++ +    D  G TPLH  TV+     P 
Sbjct: 186 DSPDPTGKTALHWAAYQGDPNTVEALLKFDADVRV---VDTGGFTPLHWATVK---GHPH 239

Query: 103 HGTFIARNLIEVGADPRVRNYNNQKPI 129
               + + LIE G+D  ++N + +  +
Sbjct: 240 ----VLKALIEHGSDVFLKNNDGKNAL 262

>ZYRO0A05258g Chr1 (424968..429614) [4647 bp, 1548 aa] {ON} some
           similarities with uniprot|Q12451 Saccharomyces
           cerevisiae YDL019C OSH2 Member of an oxysterol-binding
           protein family with seven members in S. cerevisiae
           family members have overlapping redundant functions in
           sterol metabolism and collectively perform a function
           essential for viability
          Length = 1548

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 78  IDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLV 132
           +DP+    GDT LH  V+      +    + R L+E GADP  R+   + P+DLV
Sbjct: 224 MDPET---GDTVLHEFVK------KRDVIMCRWLLEHGADPFNRDRQGRLPVDLV 269

>CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112w
          Length = 1110

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 59/118 (50%), Gaps = 14/118 (11%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGT 105
           R+  G T L + C  G ++V  +++++E + +++ Q++  G++ LH       E   +G 
Sbjct: 357 RDSGGRTRLQIACDKGKYDVAKRLIEEE-DYDVNDQDNA-GNSALH-------EAALNGH 407

Query: 106 F-IARNLIEVGADPRVRNYNNQKPIDLVHGD---ELDELIDLLQ-GAELAIDNTNGLA 158
             I + LI  GA+  +++Y   K   LV       LD +  LL+ GA+  I N  GL 
Sbjct: 408 LSIVKLLISHGANVNIQSYEMFKDTPLVDASANGHLDIVRYLLRHGADPTIPNAKGLT 465

>Kpol_1045.52 s1045 complement(122763..126530) [3768 bp, 1255 aa]
           {ON} complement(122765..126532) [3768 nt, 1256 aa]
          Length = 1255

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 21/103 (20%)

Query: 6   ASLSEQLLDAARRNNLD----LLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYG 61
           A L  +LLD+ R +N +    LL+T FN  D + + +  L+           LH   +  
Sbjct: 17  AMLELKLLDSLRGSNFEELKKLLDTDFNDFDKDSKDLKNLV-----------LHYAVQVA 65

Query: 62  SWEVLDKVLDQ---EGEIEIDPQ---NDVDGDTPLHVTVRYSQ 98
           + +++++++     EG  +I       D DG+TPLH+    S+
Sbjct: 66  NLDLIEQIVSSRNGEGSSKIITDINLQDKDGNTPLHLAAAQSR 108

>NDAI0G03020 Chr7 complement(699746..704233) [4488 bp, 1495 aa] {ON}
           Anc_3.175
          Length = 1495

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 24/96 (25%)

Query: 78  IDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHG--- 134
           +DP+    GDT LH  V+      +    + R L+E GADP  R+   + PI+L+     
Sbjct: 365 MDPET---GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDVKGKLPINLIPKINE 415

Query: 135 ------------DELDELIDLLQGAELAIDNTNGLA 158
                        EL +L++     +  ID TNG+A
Sbjct: 416 NEQASNTKMAIDIELKKLLEKAIREQSVIDITNGIA 451

>AFR690C Chr6 complement(1712886..1714988) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR182W
           (SWI6)
          Length = 700

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 6/53 (11%)

Query: 82  NDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHG 134
            D +GDT L++  R           I   L++ GADP + N +  +PID   G
Sbjct: 371 KDSNGDTCLNIASRLGN------VSIVEALLDYGADPYIANSSGLRPIDFGAG 417

>Ecym_3409 Chr3 complement(771477..772787) [1311 bp, 436 aa] {ON}
           similar to Ashbya gossypii ADR151W
          Length = 436

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEE 100
           G T  H+ C +   + L  ++    ++ +    D +GDTPLH+ + Y   E
Sbjct: 109 GRTPAHIACLFDYHKCLSLLVSAGTDLSL---GDNNGDTPLHIAMMYGSVE 156

>TPHA0P00580 Chr16 (117136..120909) [3774 bp, 1257 aa] {ON}
           Anc_3.175 YAR042W
          Length = 1257

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 16/79 (20%)

Query: 23  LLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQ--------EG 74
           L E  FNS D+   K  + I +S        LH C + GS E++  V+++        E 
Sbjct: 35  LFERDFNSEDSRNNKYIQDIKKS-------LLHYCVQVGSLELIKDVVNEFYQSDNSNEL 87

Query: 75  EIEIDP-QNDVDGDTPLHV 92
            +++D  Q D +G+TPLH+
Sbjct: 88  GVKLDINQQDENGNTPLHL 106

>NCAS0I01830 Chr9 complement(336447..340220) [3774 bp, 1257 aa] {ON}
           Anc_3.175 YAR042W
          Length = 1257

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 22  DLLETVFNSLDNNPEK--IAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQ 72
           DL+E +     N+PEK    KL   +++  GNTALHL       EV+  +LDQ
Sbjct: 67  DLVERIIKDYVNSPEKNPPLKLDLNAQDENGNTALHLAAAQSRSEVITLLLDQ 119

>CAGL0L06600g Chr12 (744800..745495) [696 bp, 231 aa] {ON} similar
          to uniprot|P50086 Saccharomyces cerevisiae YGR232w
          Length = 231

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 10/72 (13%)

Query: 31 LDNNPEKIAKLINESREPL---------GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQ 81
          L+N P K+ +L+ ES +P          G   LH      S  ++  +L     ++ID  
Sbjct: 10 LNNEPRKVQELL-ESSDPFKAVVQRDDDGRVPLHWAVSIQSDAIIKLLLPYMKSVDIDTL 68

Query: 82 NDVDGDTPLHVT 93
           D  G TP H++
Sbjct: 69 TDEAGWTPFHIS 80

>TDEL0G01200 Chr7 complement(246082..246765) [684 bp, 227 aa] {ON}
          Anc_5.97 YGR232W
          Length = 227

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 8/86 (9%)

Query: 8  LSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLD 67
          +S+ L DA   N+L     V  S++++ + + +     R+  G   LH    +   E++ 
Sbjct: 1  MSQSLTDACMNNDL---RKVQESVEDSAQNLFQ-----RDADGRIPLHWAVSFNHKEIIL 52

Query: 68 KVLDQEGEIEIDPQNDVDGDTPLHVT 93
           +L    E ++D   D  G TP H+ 
Sbjct: 53 YILSYMKEAQLDDYPDESGWTPFHIA 78

>KLLA0F26004g Chr6 complement(2411261..2412271) [1011 bp, 336 aa]
           {ON} some similarities with uniprot|Q04749 Saccharomyces
           cerevisiae YMR068W AVO2 Component of a complex
           containing the Tor2p kinase and other proteins
          Length = 336

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 48/109 (44%), Gaps = 5/109 (4%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIAR 109
           G ++LH    YG + ++ + L Q G          DGDT +H+ +    E+  H   + +
Sbjct: 40  GWSSLHYAAFYGRY-LICRHLIQLGHDATAMLKTYDGDTCIHLAITKGDEQTVH--LLLQ 96

Query: 110 NLIEVGADPRVRNYNNQKPIDLVHGDELDELIDLL--QGAELAIDNTNG 156
           + +E G + R  +     PI +         + LL   GA++ +++  G
Sbjct: 97  HFLEEGLNLRSSSARRWAPIHIACRSNHSRCLALLLQCGADVTLEDEEG 145

>KLLA0E15709g Chr5 complement(1406502..1407194) [693 bp, 230 aa]
           {ON} similar to uniprot|P50086 Saccharomyces cerevisiae
           YGR232W NAS6 Regulatory non-ATPase subunit of the 26S
           proteasome homolog of the human oncoprotein gankyrin
           which interacts with the retinoblastoma tumor suppressor
           (Rb) and cyclin-dependent kinase 4/6
          Length = 230

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 7/80 (8%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIAR 109
           G + +H+    GS  +L+K+L+   E  +D Q + +G T LH+              + +
Sbjct: 73  GWSPVHIASSIGSVTILEKLLNHTVEPNLDLQAN-NGITALHLACSKKHLN------VVQ 125

Query: 110 NLIEVGADPRVRNYNNQKPI 129
            L+E GA  R+++   Q P+
Sbjct: 126 LLVERGASVRIKDGLGQLPL 145

>KNAG0K01230 Chr11 complement(239226..242912) [3687 bp, 1228 aa]
           {ON} Anc_3.175 YAR042W
          Length = 1228

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 9/55 (16%)

Query: 78  IDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLV 132
           +DP+    GDT LH  V+      +    + R L+E GADP  R+   + P+DL+
Sbjct: 216 MDPKT---GDTVLHEFVK------KRDVIMCRWLLEHGADPFKRDAKGKLPLDLL 261

>NDAI0E02540 Chr5 complement(526907..530512) [3606 bp, 1201 aa] {ON}
           Anc_8.599
          Length = 1201

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 40/89 (44%), Gaps = 14/89 (15%)

Query: 16  ARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQEGE 75
           A+ N +D+L ++   L    E+   L+   R+    T LH  C+YG +++   +L    E
Sbjct: 356 AKNNVVDVLSSILGKLKR--EQSIYLLQ--RDDYKRTPLHYACQYGLYDLTKVLLIYMKE 411

Query: 76  IEIDPQN----------DVDGDTPLHVTV 94
             + P+N          D +   PLH+ +
Sbjct: 412 WNLWPENFTSSNLKEWEDYESLVPLHLAI 440

>ACR165W Chr3 (644229..647648) [3420 bp, 1139 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL020C (SPT23) and
           YIR033W (MGA2)
          Length = 1139

 Score = 30.0 bits (66), Expect = 4.1,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 44/108 (40%), Gaps = 19/108 (17%)

Query: 50  GNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIAR 109
           G+T LHL C  G ++++  ++ +   +E+    D  G TPLH             T I R
Sbjct: 751 GHTLLHLACLKGYYQLVSLLVKKGAHVEV---TDRFGFTPLHFACVNGD------TRITR 801

Query: 110 NLIEVGADPRVRNYNNQKPIDLVHGDE----------LDELIDLLQGA 147
            LI+  A       N   P D+   +            DE++D+L  A
Sbjct: 802 LLIQCKAQVSALALNGVTPSDVFTTNHRRDDRMYKLYFDEMMDVLDAA 849

>Ecym_1065 Chr1 (120443..122932) [2490 bp, 829 aa] {ON} similar to
           Ashbya gossypii AFR690C
          Length = 829

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 6/52 (11%)

Query: 83  DVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHG 134
           D +GDT L++  R           I   L++ GADP + N +  +PID   G
Sbjct: 503 DSNGDTCLNIASRLG------NVSIVEALLDYGADPYIANSSGLRPIDFGAG 548

>Kwal_14.982 s14 complement(141369..142619) [1251 bp, 416 aa] {ON}
           YMR068W - Hypothetical ORF [contig 244] FULL
          Length = 416

 Score = 29.6 bits (65), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 46  REPLGNTALHLCCKYGSWEVLDKVLDQE 73
           R+  GNTALH+C  YGS   +  ++ +E
Sbjct: 138 RDEFGNTALHICLIYGSENCMRMLVREE 165

>NDAI0A06430 Chr1 (1461045..1464983) [3939 bp, 1312 aa] {ON}
           Anc_3.175 YAR042W
          Length = 1312

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 6/47 (12%)

Query: 86  GDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLV 132
           GD+ LH  VR    E      +   L++ GADP  +N++ + P+DL+
Sbjct: 208 GDSLLHTFVRKRNIE------MCSWLLKHGADPHRKNFDGKTPLDLL 248

>TDEL0C06420 Chr3 complement(1174443..1176716) [2274 bp, 757 aa]
           {ON} Anc_1.60 YLR182W
          Length = 757

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 6/52 (11%)

Query: 83  DVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHG 134
           D +GDT L++  R           I   L++ GADP V N +  +P+D   G
Sbjct: 427 DSNGDTCLNIASRLG------NVAIVDALLDYGADPYVANKSGLRPVDFGAG 472

>NDAI0D00360 Chr4 complement(72274..75624) [3351 bp, 1116 aa] {ON}
           Anc_7.494 YJR109C
          Length = 1116

 Score = 29.3 bits (64), Expect = 5.9,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 3/57 (5%)

Query: 85  DGDTPLHV---TVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHGDELD 138
           DGD PL V    +R S+  P     +  N IE+     +      KP+DL+ G + D
Sbjct: 849 DGDKPLKVIECNIRASRSFPFVSKVLGTNFIEIAVKAFLGGDKVPKPVDLMLGKKYD 905

>ZYRO0E07942g Chr5 complement(619330..619959) [630 bp, 209 aa] {ON}
           similar to uniprot|P46683 Saccharomyces cerevisiae
           YPL239W YAR1
          Length = 209

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 4/49 (8%)

Query: 32  DNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDP 80
           +N PE+++  +N   +  GNTALH     G+ EV+ K+L +  E E DP
Sbjct: 75  ENAPEQLSSFVNRQNDT-GNTALHWASLNGNLEVV-KILCE--EFESDP 119

>KAFR0C00940 Chr3 (189934..193296) [3363 bp, 1120 aa] {ON} Anc_3.175
           YAR042W
          Length = 1120

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 9/84 (10%)

Query: 52  TALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVD---GDTPLHVTVRYSQEEPEHGTFIA 108
           TA  L      +E L+ +L  +   ++   N +D   GDT LH  V+      +    + 
Sbjct: 157 TAFKLAFNNRDFEHLESILSNQRNAQLLDINGIDPKSGDTVLHEFVK------KRDVIMC 210

Query: 109 RNLIEVGADPRVRNYNNQKPIDLV 132
             L+E G+DP  R+   + P+D++
Sbjct: 211 NWLLEHGSDPFKRDAKGRLPVDII 234

>NCAS0B06410 Chr2 complement(1209149..1212313) [3165 bp, 1054 aa]
           {ON} Anc_2.257
          Length = 1054

 Score = 29.3 bits (64), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 60/121 (49%), Gaps = 14/121 (11%)

Query: 43  NESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPE 102
           N  R+  G   L + C  G ++V  +++++EG  +++ Q++  G++ LH       E   
Sbjct: 297 NVYRDSGGRNRLQIACDKGKYDVAKRLIEEEG-YDVNDQDNA-GNSALH-------EAAL 347

Query: 103 HGTF-IARNLIEVGADPRVRNYNNQKPIDLVHGD---ELDELIDLLQ-GAELAIDNTNGL 157
           +G   I + LI+ GA+  +++Y   +   LV       LD +  LL+ GA+  I N  G+
Sbjct: 348 NGHISIVKLLIDNGANVNIQSYEMFQDTPLVDASANGHLDVVQLLLENGADPTITNAKGI 407

Query: 158 A 158
            
Sbjct: 408 T 408

>Kwal_47.18318 s47 (779578..780855) [1278 bp, 425 aa] {ON} YDR465C
           (RMT2) - Protein arginine methyltransferase [contig 196]
           FULL
          Length = 425

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 5/50 (10%)

Query: 88  TPLHVTVR-----YSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLV 132
           TPLHV +R      S EE E    +   L E GA     +Y N+ P DL+
Sbjct: 58  TPLHVLIRSLPDEVSNEEQEVVLKLMDTLFEFGAGWNFLDYENKSPGDLL 107

>Kpol_1002.18 s1002 (48873..49493) [621 bp, 206 aa] {ON}
           (48873..49493) [621 nt, 207 aa]
          Length = 206

 Score = 28.5 bits (62), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 15  AARRNNLDLLETVFNSLDNN--PEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQ 72
           AA   +L +++ +     NN   EK+ + +N + E  GNTALH     G  +V+  + D 
Sbjct: 57  AAANGHLGMIQYLLEMAKNNGDEEKLKEFVNATNET-GNTALHWAALNGKLDVVQLLCD- 114

Query: 73  EGEIEIDP 80
             E + DP
Sbjct: 115 --EYDADP 120

>YLR182W Chr12 (517940..520351) [2412 bp, 803 aa] {ON}
           SWI6Transcription cofactor; forms complexes with Swi4p
           and Mbp1p to regulate transcription at the G1/S
           transition; involved in meiotic gene expression; also
           binds Stb1p to regulate transcription at START; cell
           wall stress induces phosphorylation by Mpk1p, which
           regulates Swi6p localization; required for the unfolded
           protein response, independently of its known
           transcriptional coactivators
          Length = 803

 Score = 28.9 bits (63), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 6/52 (11%)

Query: 83  DVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHG 134
           D +GDT L++  R           I   L++ GADP + N +  +P+D   G
Sbjct: 467 DSNGDTCLNIAARLG------NISIVDALLDYGADPFIANKSGLRPVDFGAG 512

>SAKL0A03278g Chr1 (302501..303097) [597 bp, 198 aa] {ON} similar to
           uniprot|P46683 Saccharomyces cerevisiae YPL239W YAR1
          Length = 198

 Score = 28.5 bits (62), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 46/84 (54%), Gaps = 4/84 (4%)

Query: 4   EGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSW 63
           +  S S  L  AA   +L++++ + +  +  P ++ + +N +R   GNTALH     G+ 
Sbjct: 46  DSVSKSTPLHMAAANGHLEVIKYLLSIAE--PSEVKQWVN-TRNETGNTALHWASLNGNL 102

Query: 64  EVLDKVLDQEGEIEIDPQNDVDGD 87
           E++ K+L +E + +   +ND D D
Sbjct: 103 EIV-KLLCEEYDADPFIRNDFDHD 125

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC
           type transmembrane transporter of MRP/CFTR family, found
           in vacuolar membrane, involved in the transport of
           unconjugated bilirubin and in heavy metal detoxification
           via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score = 28.9 bits (63), Expect = 9.0,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 23/124 (18%)

Query: 25  ETVFNSLDNNPEKIAKLINESREPLGNTALHLCCKYGSWEVLDKVLDQEGEIEIDPQNDV 84
           E V N   NN  K+ KL+ E   P+ N                     E +++ + +++ 
Sbjct: 856 EDVMNR-KNNTSKLKKLLEEFDSPIDN-------------------GNESDVQTEHRSES 895

Query: 85  DGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPRVRNYNNQKPIDLVHGDELDELIDLL 144
           + D PL + V  S+ E E  T     LI+  A+ R  +    +P   V G +LD +    
Sbjct: 896 EVDEPLQLKVTESETEDEVVTESELELIK--ANSRRASLATLRPRPFV-GAQLDSVKKTA 952

Query: 145 QGAE 148
           Q AE
Sbjct: 953 QKAE 956

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,836,237
Number of extensions: 940869
Number of successful extensions: 2610
Number of sequences better than 10.0: 155
Number of HSP's gapped: 2565
Number of HSP's successfully gapped: 162
Length of query: 181
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 78
Effective length of database: 41,670,801
Effective search space: 3250322478
Effective search space used: 3250322478
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 62 (28.5 bits)