Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_7.183.566ON38538520610.0
YGL243W (TAD1)3.566ON40038515950.0
Skud_7.243.566ON39138415510.0
Suva_7.183.566ON38538514050.0
ZYRO0E09504g3.566ON3773859681e-129
Kpol_380.73.566ON3853869691e-129
NDAI0I032303.566ON3863879631e-128
KAFR0J028703.566ON3843849401e-125
SAKL0F00836g3.566ON3833919341e-124
NCAS0E002703.566ON3883889331e-124
TDEL0D063403.566ON4023909181e-121
TPHA0G036403.566ON3963928811e-116
Kwal_47.192633.566ON3833848431e-110
TBLA0E002303.566ON3943938411e-109
KLTH0G00748g3.566ON3853908341e-109
Ecym_25963.566ON3873857951e-103
CAGL0H07733g3.566ON3853887921e-102
KNAG0I002403.566ON3913867911e-102
KLLA0A00759g3.566ON3803827871e-102
AFR267W3.566ON3853867671e-98
Smik_1.108singletonON61481347e-10
AAL099C8.694ON1463144751.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_7.18
         (385 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)   798   0.0  
YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}  TAD1tRNA-spe...   619   0.0  
Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)   602   0.0  
Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)   545   0.0  
ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {...   377   e-129
Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON} ...   377   e-129
NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {O...   375   e-128
KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {...   366   e-125
SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar ...   364   e-124
NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566...   363   e-124
TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa] ...   358   e-121
TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {O...   343   e-116
Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]...   329   e-110
TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566...   328   e-109
KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar ...   325   e-109
Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {O...   310   e-103
CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} simila...   309   e-102
KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566...   309   e-102
KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar ...   307   e-102
AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic ho...   300   1e-98
Smik_1.108 Chr1 complement(176076..176135,176139..176261) [183 b...    56   7e-10
AAL099C Chr1 complement(165817..170208) [4392 bp, 1463 aa] {ON} ...    33   1.1  

>Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/385 (100%), Positives = 385/385 (100%)

Query: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60
           MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS
Sbjct: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60

Query: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET 120
           MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET
Sbjct: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET 120

Query: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180
           PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR
Sbjct: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180

Query: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240
           GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI
Sbjct: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240

Query: 241 PGLENEVKHVLKQSFHDRLPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMNDHT 300
           PGLENEVKHVLKQSFHDRLPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMNDHT
Sbjct: 241 PGLENEVKHVLKQSFHDRLPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMNDHT 300

Query: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKRR 360
           NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKRR
Sbjct: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKRR 360

Query: 361 TRLIIAIKDILSPDGWIPTKIDDVQ 385
           TRLIIAIKDILSPDGWIPTKIDDVQ
Sbjct: 361 TRLIIAIKDILSPDGWIPTKIDDVQ 385

>YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}
           TAD1tRNA-specific adenosine deaminase, deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 400

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/385 (76%), Positives = 337/385 (87%), Gaps = 1/385 (0%)

Query: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60
           M SED+LG+ ISTRVINEYSKLK  CRP+ RP+G++EWT+LAG+ AINR    N I++LS
Sbjct: 17  MPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILS 76

Query: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET 120
           +ATGVKA+PDSEL+RS GKILHDCHAEILALRG NTVLLN I+ YNP++G  FIQ NDE 
Sbjct: 77  IATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEI 136

Query: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180
           P RF LK+NWELALYIS+LPCGDAS+ FLNDNCKND DF KIED DEFQYV+ SVKTILR
Sbjct: 137 PARFNLKENWELALYISRLPCGDASMSFLNDNCKND-DFIKIEDSDEFQYVDRSVKTILR 195

Query: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240
           G LNFNR+NVVRTKPGRYDSNITLSKSCSDKLLMK+ SS+LN LNYELF +PVFLKY+VI
Sbjct: 196 GRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255

Query: 241 PGLENEVKHVLKQSFHDRLPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMNDHT 300
           P LE+E KH L+QSFH RLPN ++E  F++C   FYDDK  EEDVP LMCS+KLFM+D +
Sbjct: 256 PNLEDETKHHLEQSFHTRLPNLDNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMDDFS 315

Query: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKRR 360
            EEAILNGV+NGFYTKSSKPLRKHCQS VSRFAQWELFK+IRPEYEG+SYL+FKS QK+R
Sbjct: 316 TEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSRQKKR 375

Query: 361 TRLIIAIKDILSPDGWIPTKIDDVQ 385
           ++LIIAIK+ILSPDGWIPT+ DDV+
Sbjct: 376 SQLIIAIKNILSPDGWIPTRTDDVK 400

>Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)
          Length = 391

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/384 (72%), Positives = 333/384 (86%)

Query: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60
           M S++EL + IS +VI EYSKLK +C+P TRPTG+KEWT+LAG+V INR    NN++VLS
Sbjct: 7   MSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLS 66

Query: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET 120
           +ATGVKA+PDSEL+RSGGK+LHDCHAEILALRG NTVLL HIK+Y+PANGSDFI+SN+E 
Sbjct: 67  VATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFIESNNEI 126

Query: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180
           P RF LKD+WELALYIS+LPCGDAS+DFLND+CKN+ DF KIED+D FQYV+  VKTILR
Sbjct: 127 PIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILR 186

Query: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240
           G LNF++K+VVRTKPGRYDSNITLSKSCSDKL MK++SSILN+LNYELF QPV+LKY+VI
Sbjct: 187 GRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVI 246

Query: 241 PGLENEVKHVLKQSFHDRLPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMNDHT 300
           P +E++ KH+L++SFH+RLP   H+  F++C+T FYDD+  E D+PS MCSIKLF+ND +
Sbjct: 247 PDIEDKTKHILERSFHNRLPCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVNDSS 306

Query: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKRR 360
            EEAI NG+KNGFYTKSSKPLRKHCQS VSRFAQWELF+QIRP+++ MSYL FKS QK R
Sbjct: 307 TEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQQKER 366

Query: 361 TRLIIAIKDILSPDGWIPTKIDDV 384
            RLI   K+ LSPDGWI T+IDDV
Sbjct: 367 NRLITTAKNALSPDGWISTRIDDV 390

>Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/385 (69%), Positives = 323/385 (83%)

Query: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60
           M ++DEL ++IST+VI EYSKLK +CRPVTRP+G++EWT+LAG+ AINR    +NI VLS
Sbjct: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60

Query: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET 120
           +ATGVK++PDSEL+RS GK+LHDCHAEILALRG NTV LNHIK+++  NG D I+SN+E 
Sbjct: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEI 120

Query: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180
           PP+F+LKD WELALYISKLPCGDAS+DFLNDNC++D DF +I+DDD FQYV+  VKTILR
Sbjct: 121 PPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSDDDFLEIDDDDTFQYVDPDVKTILR 180

Query: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240
           G LNF +K+VVRTKPGRYDSNITLSKSCSDKLLM++ SSILN+LN  LF QPVFL+Y+VI
Sbjct: 181 GRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQSSSILNSLNSALFAQPVFLRYIVI 240

Query: 241 PGLENEVKHVLKQSFHDRLPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMNDHT 300
           P L+ + +H L+QSFH+RLP  +H   F++C+T FYDDK  E  VPSLMCS KLFMND T
Sbjct: 241 PNLDEKTRHTLEQSFHNRLPFCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMNDST 300

Query: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKRR 360
            EEAILNG+KNGFYTK  KPLRKHC+S +SRFAQWELF QI+PEY+  SYLQFK+ Q  R
Sbjct: 301 VEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQTER 360

Query: 361 TRLIIAIKDILSPDGWIPTKIDDVQ 385
            +LI  IK  LSPDGWIPTK DDV+
Sbjct: 361 NQLITLIKGALSPDGWIPTKTDDVK 385

>ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {ON}
           similar to uniprot|P53065 Saccharomyces cerevisiae
           YGL243W TAD1 tRNA-specific adenosine deaminase
           deaminates adenosine-37 to inosine in tRNA-Ala
          Length = 377

 Score =  377 bits (968), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 195/385 (50%), Positives = 267/385 (69%), Gaps = 19/385 (4%)

Query: 7   LGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSMATGVK 66
           LG+RI+ +V+  Y KL   C+P TR  GVKEWTVLAGIVAI++KN  +++ ++S+ATGVK
Sbjct: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKN--SDLRLISIATGVK 63

Query: 67  AMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIK--EYNPANGSDFIQSNDETPPRF 124
           A+PD+ L RSGGK++HDCHAEILALR  N V+L+ I     N  N  D ++   E    F
Sbjct: 64  ALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQ-LF 122

Query: 125 KLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILRGNLN 184
             KDNWELA+YIS LPCGDAS+D L   C+ D    +++DDD  Q+V+ +V +I+RG  N
Sbjct: 123 HFKDNWELAIYISTLPCGDASMDLL---CQ-DESIIEMQDDDPIQFVDPAVTSIVRGRFN 178

Query: 185 FNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVIPGLE 244
           ++R+ VVRTKPGR+DS ITL KSCSDKL  +++ SILN + ++L  +PV+LKY+V P   
Sbjct: 179 YSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTT 238

Query: 245 NEVKHVLKQSFHDR---LPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMN-DHT 300
           +    +L QSF+DR   LPN   +   + C+  F  DK   E+ PS M SIKL+   + T
Sbjct: 239 D----LLHQSFYDRIKVLPNVPLKV--LQCSYQFEHDKHSSEEEPSAMSSIKLYSTPEST 292

Query: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKRR 360
            E+A+LNG+KNGFYTK +KPLR++C+  VSR+AQW+LFK +RPE+   +YLQFK++ + R
Sbjct: 293 VEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDR 352

Query: 361 TRLIIAIKDILSPDGWIPTKIDDVQ 385
             LI   + +LSP GWI T  DD +
Sbjct: 353 NALIQDCRKLLSPKGWISTSRDDCE 377

>Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON}
           complement(11933..13090) [1158 nt, 386 aa]
          Length = 385

 Score =  377 bits (969), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 269/386 (69%), Gaps = 7/386 (1%)

Query: 2   LSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSM 61
           + E  LGD+IS  +  EYSKLK   +P TR   VKEWTVLA IVAI+  ND N I  +++
Sbjct: 1   MKEKSLGDKISNIIFEEYSKLKSSSKPTTRSNNVKEWTVLAAIVAIS--NDENEIIPITI 58

Query: 62  ATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDETP 121
           +TGVKA P+ EL RS GKILHDCH+EIL+LR  NT LL  ++  +  + S FI    +  
Sbjct: 59  STGVKATPNDELERSSGKILHDCHSEILSLRAFNTYLLQSVQRVSEGDKSKFILPA-KAD 117

Query: 122 PRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILRG 181
            ++   +N+++ALYISKLPCGDAS+D LN++ +++     IED+D +Q+++  +KT++RG
Sbjct: 118 GKYNWNENYKIALYISKLPCGDASMDTLNEDLEDNEQNFTIEDNDAYQFIDPKIKTVIRG 177

Query: 182 NLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVIP 241
            LN+++KNVVRTKPGRYDSN+TLSKSCSDKL MK+  SILN+LN++LF  P+FL YV+IP
Sbjct: 178 RLNYSKKNVVRTKPGRYDSNVTLSKSCSDKLCMKQAKSILNSLNWDLFENPIFLAYVIIP 237

Query: 242 GLENEVKHVLKQSFHDRLPNANHETI---FMSCNTSFYDDKAGEEDVPSLMCSIKLFM-N 297
            L++E+   L + F +RL       +   F++C   F DDK   +  P+L+ SIK+ +  
Sbjct: 238 TLKDELLLKLNKEFPERLRGIGIPIMPLTFLTCVEKFIDDKTEIKTEPALVSSIKILLPR 297

Query: 298 DHTNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQ 357
           +H  E++I+NGV+NG YTK +KPL+K+CQS +S+++QW+LFK ++ E    SY+++K SQ
Sbjct: 298 EHQIEQSIVNGVRNGSYTKKNKPLKKNCQSDISKYSQWQLFKTLKEEQLAKSYIEYKKSQ 357

Query: 358 KRRTRLIIAIKDILSPDGWIPTKIDD 383
             R  L   IK  LSPDGWI T  DD
Sbjct: 358 TLREDLKDIIKSKLSPDGWISTFQDD 383

>NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {ON}
           Anc_3.566 YGL243W
          Length = 386

 Score =  375 bits (963), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 189/387 (48%), Positives = 259/387 (66%), Gaps = 8/387 (2%)

Query: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60
           M  E +L DRI+  +  +Y  LK   +PV R  G+KEWTV AGIVAIN   DTN++ V+S
Sbjct: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAIN--TDTNDLRVIS 58

Query: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET 120
           +ATGVKA+P+ EL RSGGK+LHD HAEI+ALRG NTV+L  I +      +D +  + ++
Sbjct: 59  LATGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDS 118

Query: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180
              +  K N ++ALYIS+LPCGD S+  L +      +   I+D+D  QY+N   KTILR
Sbjct: 119 E-YYSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELA-IKDEDSIQYINQDNKTILR 176

Query: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240
           G LNFN+K  VRTKPGR DS +T SKSCSDKL MK+ +SILN L ++L  QPV+L Y+++
Sbjct: 177 GRLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIV 236

Query: 241 PGLENEVKHVLKQSFH---DRLPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMN 297
           PG+  E+K  +   F+   +R     HE  ++S +  F D +   +  PS + +IK+F+ 
Sbjct: 237 PGMTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIG 296

Query: 298 DHTN-EEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSS 356
              + E+ ILNGVKNG YTK +KPLRK+C++LVSRF+QW++FK+I P+Y  MSYL FK S
Sbjct: 297 QGNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQS 356

Query: 357 QKRRTRLIIAIKDILSPDGWIPTKIDD 383
           Q  R +LI   +  +SPDGWI T+ DD
Sbjct: 357 QHERRKLIDYTRSKMSPDGWISTQEDD 383

>KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {ON}
           Anc_3.566 YGL243W
          Length = 384

 Score =  366 bits (940), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 189/384 (49%), Positives = 258/384 (67%), Gaps = 9/384 (2%)

Query: 5   DELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSMATG 64
           D LGD I+  V  EY +LK   +PVTR  G KEWTVLA +VAIN   D  ++ +++++TG
Sbjct: 3   DSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTG 62

Query: 65  VKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDETPPRF 124
           VKAMP++ L RS G+ILHDCHAEILALRG N VLL ++++      S F+  + +   +F
Sbjct: 63  VKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQ-GGKF 121

Query: 125 KLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILRGNLN 184
           + K  W+LALY+S+LPCGDAS+D L D  + D +   + +DD  QY++     ILRG +N
Sbjct: 122 RWKSKWKLALYVSRLPCGDASMDHLEDASELDIE---MSEDDRLQYIDPGKSKILRGRMN 178

Query: 185 FNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVIPGLE 244
           F RK  VRTKPGR DS+ITLSKSCSDKL +K+++S LN+L +EL   PV+LKY+VIP L 
Sbjct: 179 FKRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELN 238

Query: 245 NEVKHVLKQSFHDRLPNA---NHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLF-MNDHT 300
           +  K  L + FH RL ++        F++   SF DDK  +  +PS    IK+F   +HT
Sbjct: 239 DTDKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHT 298

Query: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYE-GMSYLQFKSSQKR 359
            E+AILNGVKNGFYTK  KPLR+ C+S++SR++QW L+K ++ + E G+SYLQFK+ Q++
Sbjct: 299 IEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQ 358

Query: 360 RTRLIIAIKDILSPDGWIPTKIDD 383
           R  L+   K  LS   WI T  DD
Sbjct: 359 RRDLVENAKICLSHGSWIATLKDD 382

>SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 383

 Score =  364 bits (934), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 194/391 (49%), Positives = 268/391 (68%), Gaps = 18/391 (4%)

Query: 2   LSEDELGDRISTRVINE-YSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60
           +S +E  ++ S+++INE Y++LKPIC+P  R  G+KEWTVLAGI+AIN + +T  + ++S
Sbjct: 1   MSYEEFVEQGSSKLINEAYARLKPICKPTVRSNGIKEWTVLAGIIAINERKNT--MRLVS 58

Query: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGS--DFIQSND 118
           + TGVKA P+ EL+RS GKI+HDCHAEILALRG NTVLL  + E         D ++   
Sbjct: 59  LGTGVKATPNEELKRSKGKIVHDCHAEILALRGFNTVLLMQVSELTQGKHERVDLVEKAV 118

Query: 119 ETPPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTI 178
           +    FK+ D+W  ALYISKLPCGD+S+D L +   N  +   IE+ D  QY+  +  T+
Sbjct: 119 DGLS-FKVPDHWSFALYISKLPCGDSSMDTLEEEDLNSFN---IENTDACQYLEQNNHTL 174

Query: 179 LRGNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYV 238
           LRG  N+ +K  VRTKPGR DS ITLSKSCSDKL +++++S+LN++N+ELF  P++LKY+
Sbjct: 175 LRGRFNYQKKGFVRTKPGRKDSKITLSKSCSDKLSIRQVTSMLNSINWELFDTPIYLKYI 234

Query: 239 VIPGLENEVKHVLKQSFHDRLPNANHETI----FMSCNTSFYDDKAGEEDVPSLMCSIKL 294
           +IP L+      L++SF +RL   NH +     F+S + +F DDK  ++  PS M SI L
Sbjct: 235 IIPNLDEHALVGLERSF-ERL--CNHPSFNALRFLSGSQTFCDDKITQDQQPSSMSSISL 291

Query: 295 FMNDHTNE--EAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQ 352
            ++++  E  EAILNGVKNGFY K+ KPLRK+C+S+VSR +QW+L+  I    E  +YLQ
Sbjct: 292 NVHNNGEEFQEAILNGVKNGFYVKNKKPLRKNCESIVSRLSQWQLYNTISSNTEHETYLQ 351

Query: 353 FKSSQKRRTRLIIAIKDILSPDGWIPTKIDD 383
           FKS+Q  R  L    K  LSPDGWIPT +DD
Sbjct: 352 FKSTQVERNILKNEAKLCLSPDGWIPTGVDD 382

>NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566
           YGL243W
          Length = 388

 Score =  363 bits (933), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 194/388 (50%), Positives = 264/388 (68%), Gaps = 8/388 (2%)

Query: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60
           M  E  L DR++  V  EY+KLKP  +PV R  GVKEWTVLA  + ++  ++T N+ ++S
Sbjct: 1   MGGEVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLD--SNTGNLKMIS 58

Query: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNP-ANGSDFIQSNDE 119
           ++TGVKA+PD EL RSGGK++HDCHAEILALRG NTVLL  I   N     SD ++ +D 
Sbjct: 59  LSTGVKALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDA 118

Query: 120 TPPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTIL 179
              ++ L+  W+L LYIS+LPCGDAS+  L+++         I+D DEFQY++ ++ TIL
Sbjct: 119 NG-KYHLRAKWKLILYISRLPCGDASMRTLSNSSPTSSSLKSIDDSDEFQYIDPNIPTIL 177

Query: 180 RGNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVV 239
           RG LNF+R  VVRTKPGR DS  TLSKSCSDKL +++++SILN + + L   PVF+ Y++
Sbjct: 178 RGRLNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLL 237

Query: 240 IPGLENEVKHVLKQSFHDRL--PNANHETI-FMSCNTSFYDDKAGEEDVPSLMCSIKLFM 296
           IP L  + K+ L  SF +RL     N+  + +++    F +DK    + PS M SIKLF+
Sbjct: 238 IPQLNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFL 297

Query: 297 ND-HTNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKS 355
               T EEA+LNGVKNG YTK +KPLRK+C+S+VSR+AQW ++K+I P Y   SYL+FK 
Sbjct: 298 TQGETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKR 357

Query: 356 SQKRRTRLIIAIKDILSPDGWIPTKIDD 383
           SQ  R  LI    +ILS +GW+PT+ DD
Sbjct: 358 SQTARLELIKYTNEILSSEGWLPTQPDD 385

>TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa]
           {ON} Anc_3.566 YGL243W
          Length = 402

 Score =  358 bits (918), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 189/390 (48%), Positives = 258/390 (66%), Gaps = 11/390 (2%)

Query: 5   DELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSMATG 64
           D LGDRI+    +EY KL   C+PV R  G KEWTVL+GIVAI+  +    + ++S+ TG
Sbjct: 8   DRLGDRIAKLFEDEYLKLSSACKPVIRSNGSKEWTVLSGIVAIDHLSVDKKLRLVSIGTG 67

Query: 65  VKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEY--NPANGSDFIQSNDETPP 122
           VKA+PD+ L RS G+++HDCHAEILALRG NTVLL H+          +D I+    T  
Sbjct: 68  VKALPDATLERSHGRMVHDCHAEILALRGFNTVLLEHMNYMVTEQCGETDLIERT--TAG 125

Query: 123 RFKLKDNWELALYISKLPCGDASIDFL---NDNCKNDHDFPKIEDDDEFQYVNSSVKTIL 179
              LK  W+LALYIS LPCGDAS+  L   N+   N       E++ E Q+++  +++IL
Sbjct: 126 VCILKSKWKLALYISTLPCGDASMKDLQTYNNTDTNRKQELTFEENTEIQWIDQKIRSIL 185

Query: 180 RGNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVV 239
           RG  N++R  VVRTKPGRYDS IT SKSCSDKL +K+++SILN+L + L  QPVFL Y+V
Sbjct: 186 RGRFNYDRLGVVRTKPGRYDSQITFSKSCSDKLCIKQVTSILNSLTWSLMAQPVFLDYLV 245

Query: 240 IPGLENEVKHVLKQSFHDRLPNANHETI-FMSCNTSFYDDKAGEEDVPSLMCSIKLFMN- 297
           IP L  +    +  SF DRL     +++  + CN  F+D+K+ + + PS M S+KLF++ 
Sbjct: 246 IPNLAVDRCQGVHHSFQDRLGRLPQKSLELLECNVPFFDNKSSKSEEPSSMSSVKLFLDL 305

Query: 298 --DHTNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKS 355
                 E+AILNG+KNGFYTK +KPLRK+C+S VSR AQW+++  IRP+ +  +YL+FK+
Sbjct: 306 PERKCTEQAILNGLKNGFYTKGNKPLRKNCESAVSRLAQWKIYVNIRPDAKQQTYLEFKA 365

Query: 356 SQKRRTRLIIAIKDILSPDGWIPTKIDDVQ 385
               R R+I  +K +LSPDGWI T+ DD  
Sbjct: 366 GLSERNRIIQEVKKVLSPDGWISTRNDDCH 395

>TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {ON}
           Anc_3.566 YGL243W
          Length = 396

 Score =  343 bits (881), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/392 (47%), Positives = 261/392 (66%), Gaps = 17/392 (4%)

Query: 2   LSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSM 61
           +S++ + +++S  V  EYSKL+P  +PV +   V EWTVLAGI+AIN  N+T   + +++
Sbjct: 11  ISDNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAIN--NETGEFETIAI 68

Query: 62  ATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANG-SDFIQSNDET 120
            TGVKA PD++L RS GKI+HDCHAEILALR  N  LL+ I   +  +G S F+Q     
Sbjct: 69  TTGVKATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTN 128

Query: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180
              ++    W+LALYISKLPCGDAS+D L     +  +F +I DD+  QY++   KT +R
Sbjct: 129 S--YEWNKKWDLALYISKLPCGDASMDDLM-KVGDTAEF-EITDDNPLQYIDPKNKTTIR 184

Query: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240
           G LN+ +++V+RTKPGRYDS ITLSKSC+DKL MK++  IL++    L   P+FL+Y++I
Sbjct: 185 GRLNYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIII 244

Query: 241 PGLENEVKHVLKQSFHDRLPNAN---HETIFMSCNTSFYDDKAGEEDV--PSLMCSIKLF 295
           P +  + + +LK +F DRL   N    E  F+SC   F DD      V  P+L+ SIK+F
Sbjct: 245 PRISGK-ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIF 303

Query: 296 M-NDHTNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQI---RPEYEGMSYL 351
           M N+   E++I+NGVKNGFY+K  KPLRK+C+ ++SR+++W L KQI   R E   +SYL
Sbjct: 304 MDNNRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYL 363

Query: 352 QFKSSQKRRTRLIIAIKDILSPDGWIPTKIDD 383
           +FKS+  +R  L   ++ +LSPDGWI TK DD
Sbjct: 364 EFKSTLTKRMTLQQEVRSLLSPDGWITTKKDD 395

>Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]
           {ON} YGL243W (TAD1) - tRNA-specific adenosine deaminase
           1 (TAD1); Tad1p/scADAT1 [contig 344] FULL
          Length = 383

 Score =  329 bits (843), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 174/384 (45%), Positives = 239/384 (62%), Gaps = 14/384 (3%)

Query: 6   ELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSMATGV 65
           +L D+IS    + Y KLKP  +PV R  GVKEW VLA ++AI        + ++S+ATGV
Sbjct: 6   DLADKISDLAFSYYEKLKPSAKPVIRSNGVKEWNVLACVIAIG---PDQGLRLVSLATGV 62

Query: 66  KAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIK---EYNPANGSDFIQSNDETPP 122
           K+ P+ EL+RS G+ILHDCHAEILALRG N VLL  I+   +   A   D +  + +   
Sbjct: 63  KSTPNDELKRSNGRILHDCHAEILALRGFNMVLLKQIQMLVDPKAAVVPDLVSPSSDEDG 122

Query: 123 RFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILRGN 182
           +FKL D+W  ALYIS++PCGDAS+D L    ++D +F    +D   QYVN   +TILRG 
Sbjct: 123 KFKLGDDWSFALYISRIPCGDASMDLLQS--ESDMEF---SEDTSCQYVNPCNRTILRGR 177

Query: 183 LNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVIPG 242
            N+N++  VRTKPGR DS++TLSKSCSDKL  +++ SILNA+ ++L   P+FLKY+V+P 
Sbjct: 178 FNYNKRGYVRTKPGRKDSSLTLSKSCSDKLCYRQVMSILNAMTWDLMESPIFLKYIVVPK 237

Query: 243 LENEVKHVLKQSFHDRLPN--ANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMND-H 299
           + N  +   + +F DRL           + C   F DDK     VPS +  I L  ND  
Sbjct: 238 VSNTARRGFESAFKDRLREFPGIKSVELLECPKQFPDDKFELNQVPSSVSGILLNTNDGQ 297

Query: 300 TNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKR 359
             +++ILNGVK+G Y +  KPLRK+C++++SR AQW LFK+++   +  SY  FK  Q  
Sbjct: 298 PEQQSILNGVKSGAYVREPKPLRKNCETMISRLAQWTLFKKVKDYSDKKSYQAFKGEQVA 357

Query: 360 RTRLIIAIKDILSPDGWIPTKIDD 383
           R  L   ++  LS DGWI T  DD
Sbjct: 358 RNVLKNKVRSSLSSDGWISTGPDD 381

>TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566
           YGL243W
          Length = 394

 Score =  328 bits (841), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 179/393 (45%), Positives = 252/393 (64%), Gaps = 18/393 (4%)

Query: 6   ELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSMATGV 65
           ELGD+I+  +  EY+KLK   +P+ +  G+KEWT+++GIVA++ K DTN I V+S+ATGV
Sbjct: 5   ELGDKIAALLFREYNKLKKSNKPIKKSNGIKEWTIISGIVAVSNK-DTNIIKVISLATGV 63

Query: 66  KAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHI--KEYNPANGSDFI-QSNDETPP 122
           KA PDSEL+RS G I+HDCHAEILA+RG NT LL  I  KE +  N  D I +  +    
Sbjct: 64  KATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKCK 123

Query: 123 RFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILRGN 182
           ++   D ++L LYISKLPCGD+S++   +N    +   + +++D  QYV+ +++TILRG 
Sbjct: 124 KYSWNDEYDLGLYISKLPCGDSSME--EENSLESNSLIQFQENDLTQYVDPTIRTILRGR 181

Query: 183 LNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVIPG 242
           +N+N+   VRTKPGR DS IT SKSCSDK+ +K++ S+LN+LN EL   P+++KY+V P 
Sbjct: 182 INYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVLSLLNSLNTELLESPIYIKYLVCPD 241

Query: 243 LENEVKHVLKQSFHDRLPNAN---------HETIFMSCNTSFYDDKAGEEDVPSLMCSIK 293
           ++ +   +LK+SF+ R+ N           H   F+  +  F D K  +   PS    +K
Sbjct: 242 IKPQNLILLKKSFN-RIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVK 300

Query: 294 LF-MNDHTN-EEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYL 351
           +F  ND    E++I+NGVK G YTK SKPL K+  ++VSR  QW +FK I PE+E  SYL
Sbjct: 301 IFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYL 360

Query: 352 QFKSSQKRRTRLIIAIKDILSPDGWIPTKIDDV 384
            FK  Q  R      I+  LS DGWI T  DD+
Sbjct: 361 TFKRFQTDRIETRNRIRKCLSQDGWISTFNDDI 393

>KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 385

 Score =  325 bits (834), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 174/390 (44%), Positives = 241/390 (61%), Gaps = 14/390 (3%)

Query: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60
           M   +E+ D+I+      Y KLKP  +P  R  G KEW VLA +VAINR N+  ++ ++S
Sbjct: 1   MEVNEEVADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVVAINRANE--DLRLVS 58

Query: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANG---SDFIQSN 117
           +ATGVKA P+ +L+RS G+ILHDCHAEILALRG N VLL  I+    +      D + S+
Sbjct: 59  LATGVKAAPNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLKDSQSHPVPDLVSSS 118

Query: 118 DETPPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKT 177
            +    ++L + W  ALYIS+ PCGDAS+  L D            DDD  QYV+ + KT
Sbjct: 119 SDNSGIYRLNEEWSFALYISRAPCGDASMGLLYD-----EGCISFTDDDRCQYVDDNNKT 173

Query: 178 ILRGNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKY 237
           I+RG  N+ +K  VRTKPGR DS +TLSKSC+DKL  K++ SILN+L ++L   PVFL+Y
Sbjct: 174 IIRGRFNYAKKGYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTWDLLEAPVFLEY 233

Query: 238 VVIPGLENEVKHVLKQSFHDRLPNA--NHETIFMSCNTSFYDDKAGEEDVPSLMCSIKL- 294
           +VIP L    +   +++F  R+ ++    +   +SC+  F DDK  E   PSLM SI L 
Sbjct: 234 IVIPQLPRVAEADFERAFDTRIKDSVPMEKVQILSCSQRFDDDKTYENQPPSLMSSILLN 293

Query: 295 -FMNDHTNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQF 353
                 T +++ILNGVK G + K   PL+K+C+++VSR +QW LFKQI+   +  +Y +F
Sbjct: 294 IIEGQVTQQQSILNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQIKGGVDSQTYREF 353

Query: 354 KSSQKRRTRLIIAIKDILSPDGWIPTKIDD 383
           KS Q  R  L   I+  LS DGW+ T+ DD
Sbjct: 354 KSQQTDRNALKERIRLALSKDGWVGTESDD 383

>Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {ON}
           similar to Ashbya gossypii AFR267W
          Length = 387

 Score =  310 bits (795), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 237/385 (61%), Gaps = 13/385 (3%)

Query: 7   LGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSMATGVK 66
           L + +S  VI +Y  LK   +P  +  G+KEWTVLAGIVAI+   +TN + ++S+ATGVK
Sbjct: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDE--NTNELRLISVATGVK 65

Query: 67  AMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIK--EYNPANGSDFIQSNDETPPRF 124
           A+P+ EL RS G++LHD HAEILALR  N VLL  +     NP    D ++  + T P +
Sbjct: 66  ALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHP-Y 124

Query: 125 KLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILRGNLN 184
           +++  W++ALYIS+ PCGD S+D L ++   D ++ +   DD  QY+N  ++T LRG  N
Sbjct: 125 RMRKRWKIALYISRPPCGDCSMDILGED---DTNYMQFSFDDCCQYINPGIRTTLRGRFN 181

Query: 185 FNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVIPGLE 244
           ++ K V RTKPGR DS ITLSKSCSDKL  K++ SILN+ N++L   PVFL Y+V+P   
Sbjct: 182 YDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHH 241

Query: 245 NE-VKHVLKQSFHDRLPNAN--HETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMN--DH 299
            E       ++FH RL   N  H    + C+  F  DK  E   P  +  + + +   + 
Sbjct: 242 REKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEM 301

Query: 300 TNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKR 359
             EE ILNGV NGFY K+++PLRK+C+S++SR + W LF Q+       SYL FKS Q  
Sbjct: 302 DIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTS 361

Query: 360 RTRLIIAIKDILSPDGWIPTKIDDV 384
           R +L   ++  LS DGWIPT  DD 
Sbjct: 362 RNQLKEQVRLHLSSDGWIPTSADDC 386

>CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53065 Saccharomyces cerevisiae YGL243w TAD1
          Length = 385

 Score =  309 bits (792), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 168/388 (43%), Positives = 240/388 (61%), Gaps = 8/388 (2%)

Query: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60
           M   D+ G +I+  V++EY KL    RPVTR  G KE T++A ++A + + D ++I  L+
Sbjct: 1   MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSI--LT 58

Query: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET 120
           + TGVK+ P+ EL RS GKILHDCHAEILALRG N +LL HIK       S+ I +   T
Sbjct: 59  ITTGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLIHN---T 115

Query: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180
           P  F+  +  EL L+ISKLPCG+ S+  L +    D +    E+DD  QY+   +KTILR
Sbjct: 116 PNGFEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILR 175

Query: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240
           G  NFN++N VRTKPGR DS  T SKSCSDKL ++  +S+LN+L   +   P+++   VI
Sbjct: 176 GRCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVI 235

Query: 241 PGLENEVKHVLKQSFHDRLP-NANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMNDH 299
           P + +     +   F+  +  +++   +++  +   + D    E  PS M ++K+  ND+
Sbjct: 236 PNINSHQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPETPPSSMSALKILFNDN 295

Query: 300 -TNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQ- 357
              EE ILNGVKNG+YTK+SKPLRK+C+S VSR++ W LF  +  E++ ++YL+FK    
Sbjct: 296 DIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYC 355

Query: 358 KRRTRLIIAIKDILSPDGWIPTKIDDVQ 385
             R  LI +IK  LS DGW+ T  DD Q
Sbjct: 356 AERAELIRSIKSSLSSDGWLSTAEDDCQ 383

>KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566
           YGL243W
          Length = 391

 Score =  309 bits (791), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 239/386 (61%), Gaps = 8/386 (2%)

Query: 5   DELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSMATG 64
           D LG+ I+  V +EY +L    +P  R  G KEWT+L+G+VA+   +    + ++S+ TG
Sbjct: 3   DLLGNEIADLVYSEYDRLSTSSKPAVRSNGTKEWTILSGLVAVPL-HPGPQLRLISLTTG 61

Query: 65  VKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDETPPRF 124
           VKA P+ +L RS G++LHDCHAEILALRG N VLL  ++     +  D I    +   +F
Sbjct: 62  VKATPNQDLERSQGRVLHDCHAEILALRGFNYVLLRQMQAARNNDRCDLILPGIQDTNKF 121

Query: 125 KLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILRGNLN 184
           +L   ++LAL+IS+LPCGD S++ L +      D   I+DDD  QY++ + +++LRG  N
Sbjct: 122 RLNPEYQLALFISRLPCGDGSMNSLQEQGGLGQDTNGIDDDDPVQYIDPNNRSLLRGRFN 181

Query: 185 FNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVIPGLE 244
           + +K  VRTKPGR DS IT SKSCSDKL   + +SILNA  + L  + V++ Y+++P + 
Sbjct: 182 YAKKGCVRTKPGRMDSKITYSKSCSDKLCCHQATSILNACTWPLIEEAVYIDYLIVPNIS 241

Query: 245 NEVKHVLKQSFHDRLPNAN---HETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMND-HT 300
              ++ L++ F  RL +A    H+   +SC  SF DD+  E++ PS +  +KL++ +  T
Sbjct: 242 ASDRNALERCFTTRLSSATFPVHKMQILSCGQSFADDQQDEDEQPSSISCVKLYITEGET 301

Query: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEG--MSYLQFKSSQK 358
            E+A+L+G++NGF+TK SKPLR +C++ VSR +QW LF  + PE      SY  FKS   
Sbjct: 302 LEQAVLSGIRNGFFTKVSKPLRNNCETAVSRLSQWRLFCTLNPEASNKYTSYRDFKSKLV 361

Query: 359 RRTRLIIAIKDILS-PDGWIPTKIDD 383
            R  LI   + +L+    WIPT  DD
Sbjct: 362 PRAELITRTRSLLTNGQPWIPTCSDD 387

>KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 380

 Score =  307 bits (787), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 167/382 (43%), Positives = 226/382 (59%), Gaps = 12/382 (3%)

Query: 7   LGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSMATGVK 66
           + DRI+  VI+ Y KL    +P  R  GV EWTVL+GIVA +  ND    + +S+ TGVK
Sbjct: 4   IADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAFDELND--RYEPISLGTGVK 61

Query: 67  AMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDETPPRFKL 126
           A P+ EL+RS G+I+HDCHAE++ LR  N +LL  I +      S  I+ + +    +K+
Sbjct: 62  ATPNEELQRSNGQIVHDCHAEVICLRAFNALLLKEICDLQNGQKSFLIEKSADG---YKV 118

Query: 127 KDNWELALYISKLPCGDASIDFL----NDNCKNDHDFPKIEDDDEFQYVNSSVKTILRGN 182
           KD W+ A+YIS++PCGDAS++ L       C+N      I  +   QYV+  + TI+RG 
Sbjct: 119 KDVWKFAMYISRIPCGDASMNLLEAEDKSECENCQQVGNIFING--QYVHPEIDTIIRGR 176

Query: 183 LNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVIPG 242
            N+  + VVRTKPGR DS ITLSKSCSDKL MK++ SI NAL + L   PV+L+++V+P 
Sbjct: 177 ANYKLRKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNALTWSLLQSPVYLEWIVLPK 236

Query: 243 LENEVKHVLKQSFHDRLPNANHETI-FMSCNTSFYDDKAGEEDVPSLMCSIKLFMNDHTN 301
                +  L+ +F  RL N       F+ CN +F  D+      PSL   + L+ ++   
Sbjct: 237 QYQYEQVQLEDTFWLRLKNQQFLPFKFLFCNETFSADRTNLSQQPSLSSCVSLYGSNEAV 296

Query: 302 EEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKRRT 361
            E ILNGVKNGFY K  KPLRK CQS++SR AQW  FK+I+       Y  FKSS   R 
Sbjct: 297 SEVILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKIKAMPSDTDYYGFKSSVVDRN 356

Query: 362 RLIIAIKDILSPDGWIPTKIDD 383
            +I   K  LS  GWI T  D+
Sbjct: 357 HIISKAKATLSASGWISTCRDN 378

>AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL243W (TAD1)
          Length = 385

 Score =  300 bits (767), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 163/386 (42%), Positives = 229/386 (59%), Gaps = 13/386 (3%)

Query: 2   LSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSM 61
           + +D+L + I  +VI +Y   KP  +P  R  G  EWTVLAG+V ++R+  T    ++S 
Sbjct: 1   MDDDKLAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVVLVDRQ--TAECRLVSA 58

Query: 62  ATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDF-IQSNDET 120
           ATGVKA+PD EL RS G+++HD HAEILALRG N VLL   K       ++  +    +T
Sbjct: 59  ATGVKALPDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKLVTDGRSAECDLVEQAKT 118

Query: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180
             RF+L   W+ ALYISK PCGD S+D  +D+       P    DD  QYV     T+LR
Sbjct: 119 QDRFRLASRWQAALYISKAPCGDCSMDMADDDADEMTFSP----DDPIQYVAEHNYTMLR 174

Query: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240
           G  N++RK V RTKPGR DS ITLSKSCSDKL  K + S+L+++ +ELF +PVFL Y+V+
Sbjct: 175 GRFNYSRKGVARTKPGRADSQITLSKSCSDKLASKTVMSLLSSMTWELFEEPVFLDYLVL 234

Query: 241 PGLENEVKHVLKQSFHDRLPN--ANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMND 298
           P          ++ F +RL      H    + C+T+F  D+A  +  P+L  S+ L +  
Sbjct: 235 P--HTIATAGFERCFAERLAGLEGTHMPRLLCCHTAFPGDRAAPQQPPALTASVYLNITA 292

Query: 299 HTN-EEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQ 357
             + E+A+LNGV+NG Y +  + L  H +++VSR A W +F Q+  +   +SY  FK  Q
Sbjct: 293 KKHVEQALLNGVRNGAYVRPPRALAAHAETIVSRAALWRVFMQLH-QAPPLSYAAFKRQQ 351

Query: 358 KRRTRLIIAIKDILSPDGWIPTKIDD 383
             R RL   ++  LSPDGW  T++DD
Sbjct: 352 HARNRLKRHVRHRLSPDGWPTTRVDD 377

>Smik_1.108 Chr1 complement(176076..176135,176139..176261) [183 bp,
           61 aa] {ON} YGL243W (REAL)
          Length = 61

 Score = 56.2 bits (134), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 30/48 (62%), Positives = 34/48 (70%), Gaps = 1/48 (2%)

Query: 88  ILALRGLNTVLLNHIKEYNPANGSDFIQSNDETPPRFKLKDNWELALY 135
           IL LRG N VLLN++K   PAN +DF  SN  TP RFKLK N ELAL+
Sbjct: 15  ILTLRGANKVLLNYVKGCKPANDNDFF-SNHGTPSRFKLKGNCELALF 61

>AAL099C Chr1 complement(165817..170208) [4392 bp, 1463 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL167C
           (REV3)
          Length = 1463

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 61/144 (42%), Gaps = 33/144 (22%)

Query: 243 LENEVKHVLKQSFHDRLPNANHETIFMSCNTSFYDDKAGEEDVPSLM--------CSIKL 294
           +EN   H+L    H+RLP   HET+     + F+  K+    +  ++        C+I+L
Sbjct: 799 IENVAYHLL----HERLPKFTHETL-----SGFWRTKSDRTSIKIVINYCLERVRCNIRL 849

Query: 295 F----MNDHTNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSY 350
                +   T E+A L G+   FY+  S+  +   +S+++R A+ E    I P       
Sbjct: 850 LNLKQVISRTVEQARLIGID--FYSVLSRGSQYRVESVLARLAKAEHLMLISP------- 900

Query: 351 LQFKSSQKRRTRLIIAIKDILSPD 374
                   R  R +  +  IL PD
Sbjct: 901 ---GKGDLRHQRALECVPLILEPD 921

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,712,834
Number of extensions: 2177701
Number of successful extensions: 6133
Number of sequences better than 10.0: 55
Number of HSP's gapped: 6270
Number of HSP's successfully gapped: 55
Length of query: 385
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 274
Effective length of database: 40,753,473
Effective search space: 11166451602
Effective search space used: 11166451602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)