Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_7.173.567ON56554424450.0
YGL244W (RTF1)3.567ON55854423060.0
Skud_7.233.567ON56454522370.0
Suva_7.173.567ON56954922180.0
NDAI0I032403.567ON56354815950.0
TDEL0D063503.567ON56554615930.0
TPHA0A060003.567ON54953715090.0
KNAG0I002303.567ON57155915080.0
ZYRO0E09526g3.567ON56054015030.0
CAGL0H07711g3.567ON56655614630.0
Kpol_507.103.567ON46146214070.0
AFR266W3.567ON56255413840.0
Ecym_25973.567ON56250613810.0
Kwal_47.192653.567ON56747913580.0
KAFR0J028803.567ON55531612731e-170
NCAS0E002603.567ON55831612111e-160
SAKL0F00814g3.567ON57431512061e-159
KLTH0G00726g3.567ON56131611631e-153
KLLA0A00737g3.567ON58231511051e-144
TBLA0E002203.567ON57031710981e-143
Skud_14.1112.16ON58297751.8
NDAI0J003407.535ON636133742.4
ZYRO0E00946g2.638ON414182723.0
ADL022C4.39ON3392137715.8
Kpol_1054.581.530ON40162688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_7.17
         (565 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)   946   0.0  
YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit ...   892   0.0  
Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)   866   0.0  
Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)   858   0.0  
NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {O...   619   0.0  
TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa] ...   618   0.0  
TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa] ...   585   0.0  
KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567...   585   0.0  
ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {...   583   0.0  
CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly...   568   0.0  
Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON} (57107..5...   546   0.0  
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...   537   0.0  
Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {O...   536   0.0  
Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]...   527   0.0  
KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {...   494   e-170
NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567...   471   e-160
SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar ...   469   e-159
KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar ...   452   e-153
KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar ...   430   e-144
TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567...   427   e-143
Skud_14.111 Chr14 complement(211532..213280) [1749 bp, 582 aa] {...    33   1.8  
NDAI0J00340 Chr10 complement(56120..58030) [1911 bp, 636 aa] {ON...    33   2.4  
ZYRO0E00946g Chr5 (63743..64987) [1245 bp, 414 aa] {ON} similar ...    32   3.0  
ADL022C Chr4 complement(660327..670505) [10179 bp, 3392 aa] {ON}...    32   5.8  
Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON} (1443...    31   8.8  

>Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)
          Length = 565

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/544 (86%), Positives = 473/544 (86%)

Query: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGNAXXXXXXXXXXXXXYNPYSVGNASYGSEEVEE 81
           QVLTTTSAKRAKNNDQSLSKKRRIEVGNA             YNPYSVGNASYGSEEVEE
Sbjct: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGNAEEDDEEDEDEEDDYNPYSVGNASYGSEEVEE 81

Query: 82  PNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR 141
           PNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR
Sbjct: 82  PNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR 141

Query: 142 AKNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHYSDNXXXXXXXXXXXXX 201
           AKNDED           HATGHSDIKASKLSQLKKQRARKNRHYSDN             
Sbjct: 142 AKNDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEGEVDDEDEYRED 201

Query: 202 XXXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXXXXXXXXXXISDFNKVRIGRSFV 261
                           NPFDRGDLYDKR                  ISDFNKVRIGRSFV
Sbjct: 202 DYKDDEGSEYGDDEEYNPFDRGDLYDKREEEVEWAEEEDELDREPEISDFNKVRIGRSFV 261

Query: 262 AKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGV 321
           AKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGV
Sbjct: 262 AKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGV 321

Query: 322 TQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTPLT 381
           TQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTPLT
Sbjct: 322 TQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTPLT 381

Query: 382 DKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRM 441
           DKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRM
Sbjct: 382 DKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRM 441

Query: 442 SVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLKTRT 501
           SVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLKTRT
Sbjct: 442 SVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLKTRT 501

Query: 502 KVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGELDIKF 561
           KVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGELDIKF
Sbjct: 502 KVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGELDIKF 561

Query: 562 DFKF 565
           DFKF
Sbjct: 562 DFKF 565

>YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit of
           RNAPII-associated chromatin remodeling Paf1 complex;
           regulates gene expression by directing cotranscriptional
           histone modification, influences transcription and
           chromatin structure through several independent
           functional domains; directly or indirectly regulates
           DNA-binding properties of Spt15p and relative activities
           of different TATA elements; involved in transcription
           elongation as demonstrated by the G-less-based run-on
           (GLRO) assay
          Length = 558

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/544 (82%), Positives = 462/544 (84%), Gaps = 7/544 (1%)

Query: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGNAXXXXXXXXXXXXXYNPYSVGNASYGSEEVEE 81
           QVLTTTSAKRAKNNDQSLSKKRRIEVG+              YNPYSVGNA YGSEE EE
Sbjct: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGSVEDDDEEDD-----YNPYSVGNADYGSEEEEE 76

Query: 82  PNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR 141
            NPFPLEGKYK+ESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR
Sbjct: 77  ANPFPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR 136

Query: 142 AKNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHYSDNXXXXXXXXXXXXX 201
           AKNDED           HATGHSDIKASKLSQLKKQRARKNRHYS +             
Sbjct: 137 AKNDEDSRKTRASTRSTHATGHSDIKASKLSQLKKQRARKNRHYS-DNEDEDDEEDYREE 195

Query: 202 XXXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXXXXXXXXXXISDFNKVRIGRSFV 261
                           NPFDR D YDKR                  ISDFNK+RIGRSFV
Sbjct: 196 DYKDDEGSEYGDDEEYNPFDRRDTYDKREEVEWAEEEDEQDREPE-ISDFNKLRIGRSFV 254

Query: 262 AKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGV 321
           AKFCFYPGFED VKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGV
Sbjct: 255 AKFCFYPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGV 314

Query: 322 TQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTPLT 381
           TQGKDRKVFQMNYFSDGLFA+DEYQRYLRALDNSQ++KPSLHSL+NKTKEVMDFVNTPLT
Sbjct: 315 TQGKDRKVFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNKTKEVMDFVNTPLT 374

Query: 382 DKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRM 441
           DKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRM
Sbjct: 375 DKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRM 434

Query: 442 SVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLKTRT 501
           SVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKED NNFDSKSDPFSRLKTRT
Sbjct: 435 SVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDSNNFDSKSDPFSRLKTRT 494

Query: 502 KVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGELDIKF 561
           KVYYQEIQKEENAKAKEIAQQEKLQEDK AK+KREKELL+AQFRRLGGLERM+GELDIKF
Sbjct: 495 KVYYQEIQKEENAKAKEIAQQEKLQEDKDAKDKREKELLVAQFRRLGGLERMVGELDIKF 554

Query: 562 DFKF 565
           D KF
Sbjct: 555 DLKF 558

>Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)
          Length = 564

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/545 (80%), Positives = 459/545 (84%), Gaps = 3/545 (0%)

Query: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGNAXXXXXXXXXXXXXYNPYSVGNASYGSEEVEE 81
           QVLT+TSAKRAKNNDQS+SKKRRIEV +A             YNPYSVGNA YGSE  EE
Sbjct: 22  QVLTSTSAKRAKNNDQSVSKKRRIEVDSAEEEDEEDEEEDD-YNPYSVGNAGYGSE-GEE 79

Query: 82  PNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR 141
            NPFPLEGK+K+E+DREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR
Sbjct: 80  ANPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR 139

Query: 142 AKNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHYSDNXXXXXXXXXXXXX 201
           AK+ ED           HATGHSDIKASKLSQLKKQRARKNR YSDN             
Sbjct: 140 AKDKEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDNEDEEDDEDEYRED 199

Query: 202 XXXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXXXXXXXXX-XISDFNKVRIGRSF 260
                           NPFDR DLYDKR                   ISD+NK+RIGRSF
Sbjct: 200 NYKNEEESEYEDDEEYNPFDRKDLYDKREEEVEWAEEGEDELDREPEISDYNKLRIGRSF 259

Query: 261 VAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFG 320
           VAKFCFYPGFEDVVKGCYGRVN+GTDKRTGKTSYRMVRIERVFLQKPY+MGKFYTNQYFG
Sbjct: 260 VAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFG 319

Query: 321 VTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTPL 380
           VTQGKDRKVFQMNYFSDG FADDEY+RY +ALDNS +VKPSLHSL+NKTKEVMDFVNTPL
Sbjct: 320 VTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPL 379

Query: 381 TDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKR 440
           TDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKR
Sbjct: 380 TDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKR 439

Query: 441 MSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLKTR 500
           MS+YEKHHENDQSDIK LGELTSKNRKLNMSNIRNAEHVKKED +NFDSKSDPFSRLKTR
Sbjct: 440 MSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTR 499

Query: 501 TKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGELDIK 560
           TKVYYQEIQKEENAKAKEIAQQEKLQEDK AK+KREKELLLAQFRRLGGLERMIGELDIK
Sbjct: 500 TKVYYQEIQKEENAKAKEIAQQEKLQEDKEAKDKREKELLLAQFRRLGGLERMIGELDIK 559

Query: 561 FDFKF 565
           FDFKF
Sbjct: 560 FDFKF 564

>Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)
          Length = 569

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/549 (79%), Positives = 460/549 (83%), Gaps = 6/549 (1%)

Query: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGNAXXXXXXXXXXXXXYNPYSVGNASYGSEEVEE 81
           QVLT+TSAKRAKNNDQS+SKKRRIEVG+A             YNPYSVGN  YGSEE EE
Sbjct: 22  QVLTSTSAKRAKNNDQSISKKRRIEVGSAEEEEEEDEEEDD-YNPYSVGNTGYGSEEEEE 80

Query: 82  --PNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQ 139
             PNPFPLEGKYK+ESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARG+DMKEQQ
Sbjct: 81  VEPNPFPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQ 140

Query: 140 QR--AKNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHYSDNXXXXXXXXX 197
           QR  A++DED           HATGHSDIKASKLSQLKKQRARKNR YSD+         
Sbjct: 141 QRKRARDDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDSEDEQDDQEE 200

Query: 198 XXXXXXXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXXXXXXXXXX-ISDFNKVRI 256
                               NPFDR  +YDKR                   ISDFNK+RI
Sbjct: 201 YREDDYKNDEGSEYGDDEEYNPFDRKGVYDKREEEVEWAEEEEDELDRDPEISDFNKLRI 260

Query: 257 GRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTN 316
           GRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIER+FLQKPYNMGKF+TN
Sbjct: 261 GRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTN 320

Query: 317 QYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFV 376
           QYFGVTQGKDRKVFQMNYFSDGLF DDEYQRY +ALD S +VKPSLH+L+NKTKEV+DFV
Sbjct: 321 QYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFV 380

Query: 377 NTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRN 436
           NTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRN
Sbjct: 381 NTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRN 440

Query: 437 FEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSR 496
           FEKRMSVYEKHHENDQSDIK LGELTSKNRKLN+SNIRNAEHVKKED +NFDSKSDPFSR
Sbjct: 441 FEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSR 500

Query: 497 LKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGE 556
           LKTRTKVYYQEIQKEENAKAKE+AQQEKLQED+ +KE+REKELLLAQFRRLGGLERMIGE
Sbjct: 501 LKTRTKVYYQEIQKEENAKAKEMAQQEKLQEDRESKERREKELLLAQFRRLGGLERMIGE 560

Query: 557 LDIKFDFKF 565
           LDIKFDFKF
Sbjct: 561 LDIKFDFKF 569

>NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {ON}
           Anc_3.567 YGL244W
          Length = 563

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/548 (59%), Positives = 387/548 (70%), Gaps = 18/548 (3%)

Query: 24  LTTTSAKRAKNNDQSLSKKRRIEVGNAXXXXXXXXXXXXXYNPYSVGNASYGSEEVEEPN 83
           L TTS KRAKN+DQ  SK+++IEV                YNPY  GN S   EE++EPN
Sbjct: 24  LLTTSGKRAKNHDQVGSKRKKIEV-----DSEAEEEEEDDYNPYG-GNQS-EEEEIDEPN 76

Query: 84  PFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAK 143
           PFPLE KYK+E DREHLESLPEMERETLLFERSQ+M+KYQERKLFR R R++KEQQ+R +
Sbjct: 77  PFPLENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKEQQERNE 136

Query: 144 NDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHYSDNXXXXXXXXXXX---- 199
            +E+           HATGHSD+KASKLSQLKKQR RK R    N               
Sbjct: 137 LEEEGKKTRSSTRATHATGHSDLKASKLSQLKKQRERKTRDQDYNDVEDEDDLDDYAPDD 196

Query: 200 --XXXXXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXXXXXXXXXXISDFNKVRIG 257
                               NP+     YD                    + DFNKV++G
Sbjct: 197 NYKHEDSEYEEEGEEDEEDYNPYATRKSYD--MDKDEVEWAEEQTDREAELDDFNKVKVG 254

Query: 258 RSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQ 317
           RSF+AK+CFYPGF D++KGCYGRVNVGTD+RTG +SYRMV+IE+VFL+ PY MG F+TNQ
Sbjct: 255 RSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQ 314

Query: 318 YFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVN 377
           Y GVTQG DRKV QMN FSDGLF   E+ RY RAL+NS + KPS+H L  K+KE+  FV+
Sbjct: 315 YLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVS 374

Query: 378 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 437
            PLT K TD +VR+RM FNKKLSGTNAVLEKTVL++KL+YA+E NNE+D+AKYS+QLRN 
Sbjct: 375 EPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNL 434

Query: 438 EKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRL 497
           EKRMSVYEKHHENDQ  + KLG LTSKNRK+NM  IRNAEH+KKED +  DSKSDPFSRL
Sbjct: 435 EKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKED-HGLDSKSDPFSRL 493

Query: 498 KTRTKVYYQEIQKEENAKAKEIAQ--QEKLQEDKVAKEKREKELLLAQFRRLGGLERMIG 555
           KTRTK+YYQE+QKEEN KA+ +A+  Q++LQE+K   E +EKELLLA+F+RLGGLE +I 
Sbjct: 494 KTRTKIYYQEVQKEENEKAQAMAEAKQKQLQENKALNEHKEKELLLARFKRLGGLENLIQ 553

Query: 556 ELDIKFDF 563
            LDI   F
Sbjct: 554 NLDINVTF 561

>TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa]
           {ON} Anc_3.567 YGL244W
          Length = 565

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/546 (59%), Positives = 390/546 (71%), Gaps = 11/546 (2%)

Query: 24  LTTTSAKRAKNNDQSLSKKRRIEVGNAXXXXXXXXXXXXXYNPYSVGNAS------YGSE 77
           + TTSAKR K +D + SK+R+I V  A             YNP +V   S         +
Sbjct: 23  VLTTSAKRNKTSDNASSKRRKIAVEGAEEDEDEDEDEEDDYNPAAVQTESGRYSEEDEED 82

Query: 78  EVEEPNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKE 137
           E EE NPFPLEGKYK+++DR HLE LPEMERETLLFERSQIMQKY +R+LFR RGR+MKE
Sbjct: 83  EEEEENPFPLEGKYKDDNDRAHLEGLPEMERETLLFERSQIMQKYHDRRLFRERGRNMKE 142

Query: 138 QQQRAKNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHYSDNXXXXXXXXX 197
           QQ+  +  E            HATGHSD+KASKLSQL+KQR +K   +  N         
Sbjct: 143 QQKNRQLREGNKTRSSARTT-HATGHSDLKASKLSQLRKQREQKG--HRANRDRDFEEEE 199

Query: 198 XXXXXXXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXXXXXXXXXXISDFNKVRIG 257
                               +P++R    D R                  I+DFNK++IG
Sbjct: 200 EEEEDRYEGSEYEDEDEEDYDPYNRKSHRDARKGRRSGMGRDQLDREAD-ITDFNKIKIG 258

Query: 258 RSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQ 317
           RSFVAKFCFYPGF DVVKG YGRVNVG DKR+G+T YRMV+IE+VF QKPYNMG F+TNQ
Sbjct: 259 RSFVAKFCFYPGFNDVVKGHYGRVNVGVDKRSGQTQYRMVKIEKVFFQKPYNMGNFFTNQ 318

Query: 318 YFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVN 377
           YFGVTQGKDRKVFQMN+FSDG F   EY RYLRALD   I KPS++SL+NK KE+  FV+
Sbjct: 319 YFGVTQGKDRKVFQMNFFSDGNFTQSEYDRYLRALDGVHITKPSMYSLDNKAKEMNAFVS 378

Query: 378 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 437
            PLTDK TD++VR+RM FNKKLSG+NAVLEKTVL+EKL+YA+ET N++DIAKYS+QLRN 
Sbjct: 379 QPLTDKLTDDIVRNRMLFNKKLSGSNAVLEKTVLKEKLRYAQETGNDRDIAKYSSQLRNL 438

Query: 438 EKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRL 497
            KRMS YEKHHE DQS IKKLG LTSKNRK+NM  IRNAEH+KKEDV NFD+KSDPFSRL
Sbjct: 439 VKRMSAYEKHHETDQSGIKKLGALTSKNRKVNMDRIRNAEHIKKEDV-NFDAKSDPFSRL 497

Query: 498 KTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGEL 557
           KTRTKVYYQEIQKEEN +A++IA+Q++L E + A  +REKELL + F+RLGGLER+IG++
Sbjct: 498 KTRTKVYYQEIQKEENERAQDIARQKQLDESEEAIARREKELLSSDFKRLGGLERVIGQM 557

Query: 558 DIKFDF 563
            + F F
Sbjct: 558 QLPFTF 563

>TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa]
           {ON} Anc_3.567 YGL244W
          Length = 549

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/537 (56%), Positives = 379/537 (70%), Gaps = 14/537 (2%)

Query: 23  VLTTTSAKRAKNNDQSLSKKRRIEVGNAXXXXXXXXXXXXXYNPYSVGNASYGSEEVEEP 82
           V+ ++++KR ++N+ S+SKKR I VG               YNP S G       + EE 
Sbjct: 23  VVISSTSKRGRSNEDSVSKKRHINVG---------EDDEDDYNPASAGLGDDDDNDDEEE 73

Query: 83  NPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA 142
            PFPLEGKY++E DR++LESLPEMERETLLFERSQ+MQKY++R LFR R R +K Q++ +
Sbjct: 74  APFPLEGKYRDERDRDYLESLPEMERETLLFERSQLMQKYKDRMLFRERQRTLKRQRESS 133

Query: 143 KNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHYSDNXXXXXXXXXXXXXX 202
           +N                TGHSD+K+SKLSQLKKQR RKN H+  +              
Sbjct: 134 EN----RKVRSSTRSSKVTGHSDVKSSKLSQLKKQRERKNNHHYSDEDDEDEYEEEENIY 189

Query: 203 XXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXXXXXXXXXXISDFNKVRIGRSFVA 262
                          +P+ R   Y                     ++DFNK++IGRSFVA
Sbjct: 190 EDKYEEGSEYEDESYDPYKRKSTY-AEESEEEDVKWADDTDRESNVNDFNKIKIGRSFVA 248

Query: 263 KFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGVT 322
           K+CFYPGF D+VK CYGRVNVG +K T +  YRMV+IE+VFLQKPY+MG F+TNQYFGVT
Sbjct: 249 KYCFYPGFNDIVKDCYGRVNVGVNKNTNQVMYRMVKIEKVFLQKPYSMGNFFTNQYFGVT 308

Query: 323 QGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTPLTD 382
           QGKDRKVFQM +FSDG    DEY+RY+RAL++S +  PS ++L+NK KEV +FVN P+T 
Sbjct: 309 QGKDRKVFQMKFFSDGAITQDEYERYVRALESSNLTIPSTYALSNKFKEVDEFVNEPMTV 368

Query: 383 KTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMS 442
           K TDEVVR+RM FNKKLSGTNAVLEKTVLREKL +AK+ N+E+DIAKYS+QLRN EKR+ 
Sbjct: 369 KLTDEVVRNRMIFNKKLSGTNAVLEKTVLREKLNFAKQNNSERDIAKYSSQLRNLEKRLM 428

Query: 443 VYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLKTRTK 502
            YEKHHENDQ   KKLG+LTSKNRKLNM  I+  E+VK++   +FD K+DPFSRLKTRTK
Sbjct: 429 TYEKHHENDQQGAKKLGKLTSKNRKLNMDKIKYGENVKEDRDESFDIKTDPFSRLKTRTK 488

Query: 503 VYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGELDI 559
           VYYQEIQ+EEN KAKE+A+Q+K+QE+K A E++E+ELLLA+FRRLGGLE ++  LDI
Sbjct: 489 VYYQEIQEEENEKAKELARQKKMQENKEAIEQKERELLLAKFRRLGGLESIVHNLDI 545

>KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567
           YGL244W
          Length = 571

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/559 (55%), Positives = 382/559 (68%), Gaps = 28/559 (5%)

Query: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGNAXX----XXXXXXXXXXXYNPYSVGNASYGSE 77
           +VLT+T +KR+K +D + SKKRRI  G+                  YNP+ VGN   G +
Sbjct: 22  RVLTSTVSKRSKQSDATASKKRRIYEGSEEEVYDDEADDVDEEEDDYNPHEVGNYDTGDD 81

Query: 78  EVE--EPNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDM 135
           E E  E NPFPL+GKYK+E DRE+LESLPE+ERET+LF+RSQ M+KYQERKLFR R R  
Sbjct: 82  EAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRERKR-- 139

Query: 136 KEQQQRAKNDEDXXXXXXXXXXXHATGH--------SDIKASKLSQLKKQRARKNRHYSD 187
              QQ AK               H+TGH        S +K  +  +L +QR+       +
Sbjct: 140 ---QQEAK------PTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQRSDDEYEEDE 190

Query: 188 NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXXXXXX-XXX 246
                                         NP      YD+                   
Sbjct: 191 EEEEEDDYNGYGDDLNEDAEYQEDEDEEDYNPLAIKSKYDELEEEEDDDVKWAEDNDRVS 250

Query: 247 XISDFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQK 306
            ++DFNK+RIGRSFVAKFCFYPGF D+V GCYGRVNVG DKR+G+T YRMV+IE+VFLQK
Sbjct: 251 ELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQK 310

Query: 307 PYNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLN 366
           PYNMGKFYTNQYFGVTQGKDRKVFQMN+FSDG F  +EY+RYLR+L+ + I +PS H L+
Sbjct: 311 PYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHILS 370

Query: 367 NKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKD 426
           NK+KE++ F+  PLT+K TDE+VR+RM FNKKLSGTNAVLEKTVLR KLQYA+E+NNE+D
Sbjct: 371 NKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNERD 430

Query: 427 IAKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVN- 485
           +AKYSAQLRNFEKRM+ YEKHHEND +  KKLG LTSKNRK+NM   +N +H KKED   
Sbjct: 431 VAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDSAG 490

Query: 486 -NFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQF 544
              DSKSDPFSRLKTRTK+YYQE+QKEEN KAK +AQQ++++++K A E++EKELLLAQF
Sbjct: 491 PTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELLLAQF 550

Query: 545 RRLGGLERMIGELDIKFDF 563
           RRLGGLE MI ++++ FD 
Sbjct: 551 RRLGGLENMISKINVNFDI 569

>ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244W RTF1 Subunit of the RNA polymerase II-associated
           Paf1 complex directly or indirectly regulates
           DNA-binding properties of Spt15p (TATA box-binding
           protein) and relative activities of different TATA
           elements
          Length = 560

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/540 (56%), Positives = 383/540 (70%), Gaps = 8/540 (1%)

Query: 24  LTTTSAKRAKNNDQSLSKKRRIEVGNAXXXXXXXXXXXXXYNPYS--VGNASYGSEEVEE 81
           +  +SAKR+  +D++ SKKRRIE                 YNP +   G   Y  EE EE
Sbjct: 23  VLASSAKRSGKSDRASSKKRRIE---VEGGEDDEDEDEDDYNPAASGAGTGDYDDEEEEE 79

Query: 82  PNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR 141
            NPFPLEGKYK+E+DR++L  LPEMERET+LFERSQIMQKYQ+RK+FR RG+++KEQQQR
Sbjct: 80  ENPFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLKEQQQR 139

Query: 142 AKNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHYSDNXXXXXXXXXXXXX 201
           +K  E+            ATGHSDIKASKLSQL+KQR +K+++   +             
Sbjct: 140 SKQQEEGKKTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPYSDEEEEGEDEGDDY 199

Query: 202 XXXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXXXXXXXXXXISDFNKVRIGRSFV 261
                           +P+ R   +++                   ++DFNK +IGRSFV
Sbjct: 200 GYEDKKYSDEEDEEEYDPYSRRSRFEE--DEDEVQWAEEALDREANVADFNKAKIGRSFV 257

Query: 262 AKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGV 321
           A FCFYPGF D+V+G YGRVNVGTDKR+G+T YRMV+IE+VFLQKPYNMGKF TNQYFGV
Sbjct: 258 ANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGV 317

Query: 322 TQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTPLT 381
           TQGKDRKVFQM YFSDG     E++RY+ AL+   I  PS++SL NK KE+  FV+ PLT
Sbjct: 318 TQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLT 377

Query: 382 DKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRM 441
           ++ T+++VR+RM FNKKLSG NAVLEKTVL+EKLQYA ET NE+DIAKYS+QLR+FEKRM
Sbjct: 378 EQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRM 437

Query: 442 SVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLKTRT 501
           S YEK HEND+  I KL  LT+KNR++N+  ++NAE VKKED  +FDSKSDPFSRLKTRT
Sbjct: 438 STYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDT-SFDSKSDPFSRLKTRT 496

Query: 502 KVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGELDIKF 561
           K YYQEIQKEEN KAK  A+Q++L+ED+   E+++ ELL A+FRRLGGL+++IG +D +F
Sbjct: 497 KFYYQEIQKEENEKAKNDAEQKQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQF 556

>CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244w RTF1
          Length = 566

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/556 (58%), Positives = 395/556 (71%), Gaps = 26/556 (4%)

Query: 23  VLTTTSAKRAKNNDQSLSKKRRIEVGNAXXXXXXXXXXXXXYNP---YSVGNASYGSEEV 79
           VLTTT+ KR K +  S  KKRRIEV +              YNP   Y   + S   EE 
Sbjct: 22  VLTTTN-KRTKGSSNSQVKKRRIEVDSEDEEDD--------YNPDDGYEPVDVSDKEEEE 72

Query: 80  EEPNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQ 139
           EE NPFPLEGKYK+ +DR+HLESLPEMERET+LFERSQ+M+KYQERKLFR RGR++K  Q
Sbjct: 73  EEENPFPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK--Q 130

Query: 140 QRAKNDEDXXXXXXXXXXXHATGHSDIKASKLSQLK-----KQRARKNRHYSDNXXXXXX 194
           Q+ +  ED            ATGHSDIKASKLSQLK     K + R++  Y ++      
Sbjct: 131 QKIQAGEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYG 190

Query: 195 XXXXXXX---XXXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXXXXXX--XXXXIS 249
                                     +P+ R   Y +                     + 
Sbjct: 191 DEDEFKDDFIEEDSDYKENDDDEEGYDPYARKSKYAQDNDEEEDEEVEWAEQLDRDAEVQ 250

Query: 250 DFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYN 309
           DFNK+RIGRSFVAK+CFYPGF ++++GCYGRVNVG DKRTG  +YRMV+IE+VFLQKPYN
Sbjct: 251 DFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYN 310

Query: 310 MGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKT 369
           MGKF+TNQYFGVTQGKDRKVFQMN+FSDG F + E++RYL+ALD+S I KPS +++  K 
Sbjct: 311 MGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKF 370

Query: 370 KEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAK 429
           KE+ +F++ PLT+K TDE+VR+RM  NKKLSGTNAVLEKT+L++KL+YAKE  NE DIAK
Sbjct: 371 KEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAK 430

Query: 430 YSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDS 489
           YS QLRNFEKRM++YEKHHENDQ+DIKKL  LTSKNRKLNM+ IRNAE +KKE+  NFDS
Sbjct: 431 YSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDS 490

Query: 490 KSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGG 549
           KSDPFSRLKTRTKVYYQEIQKEEN KAKE A QE+L+ D+  K+++EK+L+LA+FRRLGG
Sbjct: 491 KSDPFSRLKTRTKVYYQEIQKEENEKAKEEAAQEQLKIDEETKKEKEKQLMLAEFRRLGG 550

Query: 550 LERMIGEL--DIKFDF 563
           L+++IG +  DIK D 
Sbjct: 551 LQKIIGSINVDIKLDI 566

>Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON}
           (57107..58492) [1386 nt, 462 aa]
          Length = 461

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/462 (59%), Positives = 339/462 (73%), Gaps = 5/462 (1%)

Query: 106 MERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKNDEDXXXXXXXXXXXHATGHSD 165
           MERETLLFERSQ+MQKYQ+RKLFR R R++K QQ+   + ++            ATGHSD
Sbjct: 1   MERETLLFERSQLMQKYQDRKLFRERQRNLKRQQRNNTSAQEGKKTRTSTRSTQATGHSD 60

Query: 166 IKASKLSQLKKQRAR-KNRHYSDNXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXNPFD 221
           +KASKLSQLK+QR + KNR YS++                                +P+ 
Sbjct: 61  VKASKLSQLKRQREKNKNRQYSESEGEYEEEEDEDDYDTGYKYDGSEYEEDDEEEYDPYS 120

Query: 222 RGDLYDKRXXXXXXXXXXXXXXXXXXISDFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRV 281
           R   Y +                   + DFNK++IGRSFVA++CF+P F ++VKGCYGRV
Sbjct: 121 RKPRYREEEEEEDVKWAEESTNRESQVDDFNKIKIGRSFVARYCFHPDFNEIVKGCYGRV 180

Query: 282 NVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFA 341
           NVG D+RT +T+YRMV+IE+VFLQKPYNMGKF+TNQYFGVTQGKDRKVFQMN+FSDG   
Sbjct: 181 NVGVDRRTNQTAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPIT 240

Query: 342 DDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSG 401
            +E+ RY R+LD S   KPS++SL  K KE+ +FV+ P+TDK TDE+VR+RM FNKKLSG
Sbjct: 241 IEEFDRYQRSLDASNASKPSVYSLTQKLKEINEFVSEPMTDKLTDEIVRNRMVFNKKLSG 300

Query: 402 TNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGEL 461
           TNAVLEKTVLR KLQYAKE NNE+DIAKYS QLRN EKR+S YEKHHENDQ+  +KLG L
Sbjct: 301 TNAVLEKTVLRGKLQYAKENNNERDIAKYSTQLRNLEKRLSTYEKHHENDQAGARKLGAL 360

Query: 462 TSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQ 521
           TSKNRK+NM   +N EHVK+ED+ NFDSK+DPFSRLKTRTK+YYQE+QKEEN KAKE+AQ
Sbjct: 361 TSKNRKVNMDKAKNVEHVKEEDI-NFDSKADPFSRLKTRTKIYYQEVQKEENEKAKELAQ 419

Query: 522 QEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGELDIKFDF 563
           Q+KL+ED+ A  K+E+ELLLA+FRRLGGLE +I  +DI+   
Sbjct: 420 QKKLEEDREAIAKKERELLLAKFRRLGGLESIISSIDIELSI 461

>AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL244W (RTF1)
          Length = 562

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/554 (54%), Positives = 376/554 (67%), Gaps = 35/554 (6%)

Query: 26  TTSAKRAKNNDQSLSKKRRI---EVG----NAXXXXXXXXXXXXXYNPYSVGNASYGSEE 78
            TS KR+K+ D S SKKRR+   E G    N              YNP       YG +E
Sbjct: 26  VTSQKRSKH-DSSGSKKRRVMDEESGDDEDNDNDAGDEEDEDEDDYNP----GTEYGFDE 80

Query: 79  --------VEEPNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRA 130
                   VEE NP+PL GKY++++DREH+E++PEMERETLLFERSQ MQKYQERK+ R 
Sbjct: 81  GHEASEDEVEEENPYPLLGKYRDDADREHIENMPEMERETLLFERSQEMQKYQERKVLRE 140

Query: 131 RGRDMKEQQQRAKNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHYSDNXX 190
           R ++++ QQQR +  +D             TGHSD++ SKLS+L+KQRA+K+ +Y     
Sbjct: 141 RAKNIRAQQQRRQQ-KDGSALRSSGRSTRTTGHSDLRDSKLSELRKQRAKKSGNYD---- 195

Query: 191 XXXXXXXXXXXXXXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXXXXXXXXXXISD 250
                                      +P D   LY  R                  + D
Sbjct: 196 ----YSAGEDDSDHSDDYVDSDNEDDYDPHDGRQLY--REEADEVKWAEDDLDRDAELDD 249

Query: 251 FNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNM 310
           FNK+++GRSFVAKFCFYP F   V+GCYGRVN+G DK TG+  YRMV+IE+VFLQKPYNM
Sbjct: 250 FNKIKVGRSFVAKFCFYPEFNQRVQGCYGRVNIGVDKHTGQAMYRMVKIEKVFLQKPYNM 309

Query: 311 GKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTK 370
           GKF+TNQYFGVTQGKDRKVFQMN+FSDG     EY+RYL  +    I KPSL++LNNK K
Sbjct: 310 GKFFTNQYFGVTQGKDRKVFQMNFFSDGPILQPEYERYLNQIAKHDINKPSLYTLNNKAK 369

Query: 371 EVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKY 430
           ++ +FV+ P+T K TD++VR+RMQFNKKL+GTNAVLEKTVLR+KLQYA++TNNEKDIAKY
Sbjct: 370 DLTNFVSQPMTPKLTDQIVRNRMQFNKKLTGTNAVLEKTVLRDKLQYARDTNNEKDIAKY 429

Query: 431 SAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSK 490
           S+QL+N EKRMS YEKHHENDQ+ I+KL  LTSKNRK+N+  IR+ E+VKKED    + K
Sbjct: 430 SSQLKNLEKRMSSYEKHHENDQTGIRKLDALTSKNRKVNLDKIRHVENVKKEDSATLNVK 489

Query: 491 SDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGL 550
           +DPFSRLKTRTK+YYQEIQ+EEN KA+E+A+Q K Q+DK  K  R K+ LLA+FRRLGGL
Sbjct: 490 TDPFSRLKTRTKIYYQEIQQEENEKAQELAKQ-KQQQDKEEKHDR-KQQLLAKFRRLGGL 547

Query: 551 ERMIGELD--IKFD 562
           E  + +LD  IK D
Sbjct: 548 EDALSKLDFRIKLD 561

>Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR266W
          Length = 562

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/506 (54%), Positives = 353/506 (69%), Gaps = 14/506 (2%)

Query: 64  YNPYSV----GNASYGSEEVEEPNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIM 119
           YNP +     GN     +E EE NP+PLEGKYK+E DR  ++ +PEMERETLLFERSQ M
Sbjct: 67  YNPGTQYDFEGNDDGSGDEQEERNPYPLEGKYKDEEDRNRIQDMPEMERETLLFERSQEM 126

Query: 120 QKYQERKLFRARGRDMKEQQQRAKNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRA 179
           QKYQERK+ R R + ++ QQQ+ +  +D             TGHS+++ SKLS+L+KQRA
Sbjct: 127 QKYQERKVLRQRAKSIRAQQQQRQLQKDSTKRSSGRST-RTTGHSELRTSKLSELRKQRA 185

Query: 180 RKNRHYSDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXX 239
           +K+ +Y D                              + F   D               
Sbjct: 186 KKSGNY-DYSESEEDESDQSDNYAESDNDDYDPHHGHKDGFSDHD--------NEVKWAE 236

Query: 240 XXXXXXXXISDFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRI 299
                   + DFNKV+IGRSFVAKFCFYP F + V+ CYGRVN+G DK TG   YRMV+I
Sbjct: 237 EDLDRDAELEDFNKVKIGRSFVAKFCFYPDFAERVQACYGRVNIGLDKHTGLPMYRMVKI 296

Query: 300 ERVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVK 359
           ERVFLQKPY+MGKF+TNQYFGVTQGKDRKVFQMNYFSDG     E++RYL  +    + K
Sbjct: 297 ERVFLQKPYSMGKFFTNQYFGVTQGKDRKVFQMNYFSDGPITQPEFERYLNQMAKYDMNK 356

Query: 360 PSLHSLNNKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAK 419
           PSL++LNNK KE+ +FV+ P+T K TD++VR+RM FNKKL+GTNAVLEK+VL++KLQYAK
Sbjct: 357 PSLYTLNNKAKELFNFVSQPMTMKLTDQIVRNRMVFNKKLTGTNAVLEKSVLKDKLQYAK 416

Query: 420 ETNNEKDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHV 479
           +TNNE  +AKY+AQL+N EKRMS YEKHHENDQ+ I+KLG LTSKNRK+NM  IR AE+V
Sbjct: 417 DTNNESAVAKYAAQLKNLEKRMSSYEKHHENDQTGIRKLGALTSKNRKVNMDKIRLAENV 476

Query: 480 KKEDVNNFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKEL 539
           +KED +N D+KSDPFSRLKTRTK+YYQEIQ+EEN KA E+A+Q+  ++DK  +E +E++L
Sbjct: 477 RKEDSSNVDAKSDPFSRLKTRTKIYYQEIQQEENEKAMELAKQKHQEQDKETQENKERQL 536

Query: 540 LLAQFRRLGGLERMIGELDIKFDFKF 565
           LLA+FRRLGGLE ++  +  K +  F
Sbjct: 537 LLAKFRRLGGLEEIVSSIPFKIELGF 562

>Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]
           {ON} YGL244W (RTF1) - Nuclear protein [contig 344] FULL
          Length = 567

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/479 (56%), Positives = 346/479 (72%), Gaps = 2/479 (0%)

Query: 83  NPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA 142
           NPFPLEGKYK+E DRE+LESLPEMERETLLF+RSQ MQKY+ER++ + R R+++ QQQ+ 
Sbjct: 87  NPFPLEGKYKDERDREYLESLPEMERETLLFDRSQEMQKYRERRVLKERARNIRAQQQKR 146

Query: 143 KNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHYSDNXXXXXXXXXXXXXX 202
           +  ++             TGHSD+K S+LS+LKKQRA+K+  Y  +              
Sbjct: 147 QLQQESTKTRSSTRSTRTTGHSDLKESRLSELKKQRAKKSGTYDYSEDEDDGGRDEEDDY 206

Query: 203 XXXXXXXXXXXXXXXNPFDRGDLYDKRXXXXXXXXXXXXXXXXXXISDFNKVRIGRSFVA 262
                           P  + D  D+                   +SDFNKV+IGRSFVA
Sbjct: 207 GYDDQDEEEESEDDYQPGYKKDKIDE-DDEEVKWAEEDDLDRDPELSDFNKVKIGRSFVA 265

Query: 263 KFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGVT 322
           KFCFYP F D+++GCYGRVNVG DKR  +T YRMV+IERVFLQKPYNMGKF+TNQYFGVT
Sbjct: 266 KFCFYPEFNDLIRGCYGRVNVGVDKRNNQTLYRMVKIERVFLQKPYNMGKFFTNQYFGVT 325

Query: 323 QGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTPLTD 382
           QGKDRKVFQMN+FSDG     E++RY+++LD S I  PSL++LNNK+ E+  FV+ P+T 
Sbjct: 326 QGKDRKVFQMNFFSDGAITQPEFERYMKSLDASGINPPSLYTLNNKSNEINGFVSQPVTP 385

Query: 383 KTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMS 442
           K TDE+VR+RM FNKKLSGTNAVLEKT+LR+KLQYAKET +E+D+AKYS+QLR+ E+R++
Sbjct: 386 KLTDELVRNRMLFNKKLSGTNAVLEKTILRDKLQYAKETGSERDVAKYSSQLRSLERRLT 445

Query: 443 VYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLKTRTK 502
            YEKHHENDQ+  KKLG LTS+NR+ NM   +N +  KKED   FD+K+DPFSRLKTRTK
Sbjct: 446 SYEKHHENDQAGSKKLGALTSRNRRANMDKGKNVDTTKKEDT-PFDAKTDPFSRLKTRTK 504

Query: 503 VYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGELDIKF 561
           +YYQEIQKEEN KAKE+A+ E+L++      ++E++LLLA+F+ LGGLE ++  +D K 
Sbjct: 505 IYYQEIQKEENEKAKELARIEQLEKGNSDLAEKERKLLLARFKNLGGLEEVVSGIDFKL 563

>KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {ON}
           Anc_3.567 YGL244W
          Length = 555

 Score =  494 bits (1273), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 230/316 (72%), Positives = 285/316 (90%), Gaps = 2/316 (0%)

Query: 248 ISDFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKP 307
           ++DFNK+RIGRSFVAKFCFYP F ++VKGCYGRVNVG DKRTG+TSYRMV+IER+FLQKP
Sbjct: 240 LNDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKP 299

Query: 308 YNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNN 367
           Y+MGKF+TNQYFGVTQGKDRKVFQM++FSDGL    EY+RY+R+L++S I KP++++L +
Sbjct: 300 YSMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKS 359

Query: 368 KTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 427
           K+KE++ FV+ PLT+K T+E+VR+RM FNKKLSGTNAVLEKTVL+EKLQYA+ETNNE+D+
Sbjct: 360 KSKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDV 419

Query: 428 AKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNF 487
           AKYSAQLRNFEKRM++YEKHHENDQ+  KKLG LTSKN+K+NM  +RNAEHVKKED+   
Sbjct: 420 AKYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLP-- 477

Query: 488 DSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRL 547
             KSDPFSRLKTRTK+YYQEIQKEEN +AK +AQQ+K++E++ A +++EKELLLAQFRRL
Sbjct: 478 IDKSDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRL 537

Query: 548 GGLERMIGELDIKFDF 563
           GGLE+MI  L+I+FD 
Sbjct: 538 GGLEKMISGLNIEFDL 553

>NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567
           YGL244W
          Length = 558

 Score =  471 bits (1211), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 215/316 (68%), Positives = 271/316 (85%), Gaps = 1/316 (0%)

Query: 248 ISDFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKP 307
           + DFNKV+IGRSFVAK+CFYPGF +++KGCYG+VNVGTD+RTG TSYRMV+IE++FLQKP
Sbjct: 242 LDDFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKP 301

Query: 308 YNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNN 367
           Y MG+F+TNQYFGVTQG +RKVFQMN+FSDGLF  DE++RY+R+LD S I KPS+++L N
Sbjct: 302 YRMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKN 361

Query: 368 KTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 427
           K KE+  F++ PLT++  D +VR+RM FNKKLSGTNAVLEKTVLR+KL+YA+E NNE+D+
Sbjct: 362 KAKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDV 421

Query: 428 AKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNF 487
           AKYS+QLRN EKR+SVYEKHHENDQ    KLG LTSKNRK+NM  I+N  H KKE++  F
Sbjct: 422 AKYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEI-GF 480

Query: 488 DSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRL 547
           DSKSDPFSRLKTRTK+YYQE+Q+EEN KAK +A +++L+E+  A+ ++E ELLLA+FRRL
Sbjct: 481 DSKSDPFSRLKTRTKIYYQEVQQEENEKAKALAAEKQLKENNEAQARKENELLLAKFRRL 540

Query: 548 GGLERMIGELDIKFDF 563
           GGLE MI  L++  +F
Sbjct: 541 GGLENMINSLNLDVNF 556

>SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 574

 Score =  469 bits (1206), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 220/315 (69%), Positives = 277/315 (87%), Gaps = 1/315 (0%)

Query: 248 ISDFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKP 307
           ++DFNKV+IGRSFVAKFCFYPGF ++V+  YGRVNVG DK TG+T+YRMV+IE+VFLQKP
Sbjct: 258 LADFNKVKIGRSFVAKFCFYPGFNELVQNSYGRVNVGIDKHTGQTAYRMVKIEKVFLQKP 317

Query: 308 YNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNN 367
           YNMGKF+TNQYFGVTQGKDRKVFQMN+FSDG     EY+RYL++L+   I KPS+++LNN
Sbjct: 318 YNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGAITQVEYERYLKSLEKYGINKPSVYNLNN 377

Query: 368 KTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 427
           K+KE+ +FV+ P+T K TD++VR+RM FNKKLSGTNAVLEKTVL+EKLQYAKET+NE+DI
Sbjct: 378 KSKEISEFVSQPMTSKLTDDIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYAKETSNERDI 437

Query: 428 AKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNF 487
           AKYS+QL+N EKR+S YEKHHENDQ+ IKKLG LTSKNRKLN+  I++AE V+K+DV NF
Sbjct: 438 AKYSSQLKNLEKRISSYEKHHENDQAGIKKLGVLTSKNRKLNIDRIKHAELVQKDDV-NF 496

Query: 488 DSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRL 547
           D+KSDPFSRLKTRTK+YY+E+Q++EN KAKE A+Q++L+EDK    ++E ELLLA+FR L
Sbjct: 497 DAKSDPFSRLKTRTKIYYKEVQQQENEKAKEAARQKQLEEDKGTATRKENELLLAKFRSL 556

Query: 548 GGLERMIGELDIKFD 562
           GGLE +IG +D++ +
Sbjct: 557 GGLEEIIGGIDLQIN 571

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (75%)

Query: 83  NPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA 142
           NPFPLEGKYK+E DR  LESLPEMERE+LLFERSQIMQ+YQER+  + R +++++QQQ+ 
Sbjct: 93  NPFPLEGKYKDEQDRTQLESLPEMERESLLFERSQIMQQYQERRFLKQRAKNIRDQQQKR 152

Query: 143 KNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHY 185
           +  ++            ATGHSD+K SKLS+LKKQRA+K+  Y
Sbjct: 153 QQQQEGKQVRSSTRTTRATGHSDVKTSKLSELKKQRAKKSGTY 195

>KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II- associated Paf1
           complex directly or indirectly regulates DNA-binding
           properties of Spt15p (TATA box-binding protein) and
           relative activities of different TATA elements
          Length = 561

 Score =  452 bits (1163), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 210/316 (66%), Positives = 268/316 (84%), Gaps = 1/316 (0%)

Query: 248 ISDFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKP 307
           + DFN+++IGRSFVAKFCFYP F D++KGCYGRVNVG DKR+G+T YRMV+IE+VFLQKP
Sbjct: 245 LGDFNRIKIGRSFVAKFCFYPEFNDMIKGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKP 304

Query: 308 YNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNN 367
           YNMGKF+TNQYFGVTQGK+RKVFQMN+FSDG     E++RYLR+L+ S+I KPSL+ +NN
Sbjct: 305 YNMGKFFTNQYFGVTQGKNRKVFQMNFFSDGAITQPEFERYLRSLETSEINKPSLYIINN 364

Query: 368 KTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 427
           K+ E+  FV+ P+T K TDE+VR+RM FNKKLSGTNAVLEKT+L++KLQYAKE+ +E+D+
Sbjct: 365 KSNEINSFVSQPVTSKLTDELVRNRMIFNKKLSGTNAVLEKTILKDKLQYAKESGSERDV 424

Query: 428 AKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNF 487
           AKYS+QLRN EKR+S YEKHHENDQ+  KKLG LTSKNR++N+   +N E  KKED   F
Sbjct: 425 AKYSSQLRNLEKRLSSYEKHHENDQAGSKKLGALTSKNRRVNLDKGKNVEVTKKEDT-PF 483

Query: 488 DSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRL 547
           D+K+DPFSRLKTRTK+YYQEIQ+EEN KAKE+A+QE+LQ+D +   ++E++LLLA+F+ L
Sbjct: 484 DAKTDPFSRLKTRTKIYYQEIQREENEKAKELARQEQLQKDDLNLVEKERKLLLAKFKNL 543

Query: 548 GGLERMIGELDIKFDF 563
           GGLE +I  +D +   
Sbjct: 544 GGLEDIISNMDFQVSL 559

 Score =  122 bits (307), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 105/167 (62%), Gaps = 8/167 (4%)

Query: 23  VLTTTSAKRAKNNDQSLSKKRRIEVGNAXXXXXXXXXXXXXYNPYSVGNASYGSEEVEE- 81
           V   +S KR++++ QS S KRRI   +              YNP +   ASY  +  E+ 
Sbjct: 24  VQIGSSKKRSRSDHQS-SSKRRIVDEDEEQDDDEEEGEEDDYNPEA---ASYDMDSEEDE 79

Query: 82  ---PNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQ 138
              PNPFPLEGKYKNE DR +LESLPEMERET+LFERSQ MQKYQER++ + R +++++Q
Sbjct: 80  DEEPNPFPLEGKYKNEEDRSYLESLPEMERETMLFERSQTMQKYQERRVLKERAKNIRDQ 139

Query: 139 QQRAKNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHY 185
           QQ+ +  ++             TGHSD+K S+LS+LKKQRA+K   Y
Sbjct: 140 QQKRQLQQEGKKTRSSTRSTRTTGHSDLKESRLSELKKQRAKKKGTY 186

>KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 582

 Score =  430 bits (1105), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 205/315 (65%), Positives = 261/315 (82%), Gaps = 2/315 (0%)

Query: 248 ISDFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKP 307
           + D+NK++IGRSFVAKFCFYP F  +V+GCYGRVN+G DK TG + YRMV+IERVFLQKP
Sbjct: 265 LDDYNKIQIGRSFVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNSMYRMVKIERVFLQKP 324

Query: 308 YNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNN 367
           YNMGKF+TNQYFGVTQGKDRK+FQM+YFSD      EY+RYL +L+   I +PS + LNN
Sbjct: 325 YNMGKFFTNQYFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSLEKYDITQPSPYILNN 384

Query: 368 KTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDI 427
           K+K V +FV  PLT K  D++VR+RM FNKKLSGTNAV+EK VL+EKLQ++K++ + +  
Sbjct: 385 KSKAVNEFVCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLKEKLQFSKQSGDIESE 444

Query: 428 AKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKED-VNN 486
           +KY+ QL+  EKR+S YEKHHENDQ+DIK LG LTSKNRKLN+  IR+AE +K+E+ VN 
Sbjct: 445 SKYANQLKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDRIRHAETIKREEGVNK 504

Query: 487 FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRR 546
            D+KSDPFSRLKTRTK+YYQEIQ+EEN KA+E A+++ L+ D+ A+E+++KELLLA+FRR
Sbjct: 505 VDAKSDPFSRLKTRTKIYYQEIQQEENEKAREEAKRQ-LEVDQEAEEQKKKELLLAKFRR 563

Query: 547 LGGLERMIGELDIKF 561
           LGGLE +IG LD+K 
Sbjct: 564 LGGLEEIIGSLDLKL 578

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/107 (59%), Positives = 75/107 (70%), Gaps = 4/107 (3%)

Query: 84  PFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAK 143
           PFPLEGKYK+E DRE LE LPEMERE++LFERSQ MQKYQERKL R   + +K+QQQ  +
Sbjct: 89  PFPLEGKYKDEKDREKLELLPEMERESILFERSQQMQKYQERKLLRQHAKSIKQQQQLQR 148

Query: 144 NDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARK--NRHYSDN 188
             E              TGHSD+K SKLS+LKKQRA+K  N  +SDN
Sbjct: 149 --EGSKSTRASTRSSRTTGHSDLKQSKLSELKKQRAKKSGNYEFSDN 193

>TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567
           YGL244W
          Length = 570

 Score =  427 bits (1098), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 203/317 (64%), Positives = 255/317 (80%), Gaps = 4/317 (1%)

Query: 248 ISDFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQK- 306
           + DFNK++IGRSF  KFCFYP F D+VK CY +VNV  D+   K  YRMV+IE+VFL K 
Sbjct: 255 VQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVFLDKR 312

Query: 307 PYNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLN 366
           P++MGKF+TNQ FGVTQG +RKV+ M YFSD      E+ RY+R L++  I +PS++++N
Sbjct: 313 PHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSVYAIN 372

Query: 367 NKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKD 426
           NK KE+  F   PLTDK TD++VR+RM+FNKKLSGTNAVLEKTVLR KLQ+AKET NE+D
Sbjct: 373 NKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETGNERD 432

Query: 427 IAKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNN 486
           + KYSAQLRN EKR+S+YEKHHENDQ+  KKLG+LTS+NRKLNM   RN EH KK ++  
Sbjct: 433 VTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEH-KKVELAG 491

Query: 487 FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRR 546
           FD+K+DPFSRLKTRTK+YYQEIQKEEN KA+E+A +++L+ED  AK + EKE LLA+F+ 
Sbjct: 492 FDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLLAEFKC 551

Query: 547 LGGLERMIGELDIKFDF 563
           LGGLE+M+G L+ KFDF
Sbjct: 552 LGGLEKMVGSLNFKFDF 568

 Score =  134 bits (337), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 104/172 (60%), Gaps = 18/172 (10%)

Query: 23  VLTTTSAKRAKNNDQSLSKKRRIEVGNAXXXXXXXXXXXXXYNPY-------SVGNASYG 75
            L  +S KRA+NND S SK+R+IEV N              YNP        S  N   G
Sbjct: 22  TLMVSSKKRARNNDSS-SKRRKIEVDNEDEEEEDD------YNPVFNEDNNQSTYNTMDG 74

Query: 76  SEEVEEPNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDM 135
             E EEPNPFPLEGKYK+E DRE +ES+PEMERETLLFERSQIMQKYQERK+FR R R  
Sbjct: 75  --EREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR-- 130

Query: 136 KEQQQRAKNDEDXXXXXXXXXXXHATGHSDIKASKLSQLKKQRARKNRHYSD 187
           K+      ++             H TG SD K+SKLSQLK+QR R+N+  S+
Sbjct: 131 KQMSLNNNSNLTGQKTRTSTRVTHTTGLSDAKSSKLSQLKRQRERRNKGQSN 182

>Skud_14.111 Chr14 complement(211532..213280) [1749 bp, 582 aa] {ON}
           YNL225C (REAL)
          Length = 582

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query: 367 NKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKT--VLREKLQYAKETNNE 424
           N T E+ D  N     KT  + +R R   N  L GTN  L K    L EK  + K +N+E
Sbjct: 325 NATSEINDLRNELENKKTEIQTMRER---NNNLLGTNKTLSKQNKALCEK--FDKLSNDE 379

Query: 425 KDIAK-----YSAQLRNFEKRMSVYEKHHENDQSDIK 456
           K+I K        +L +  +R+  +EK  EN ++ +K
Sbjct: 380 KNILKGCNEEIKIKLESLNERLGSWEKSKENYEASLK 416

>NDAI0J00340 Chr10 complement(56120..58030) [1911 bp, 636 aa] {ON}
           Anc_7.535
          Length = 636

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 66/133 (49%), Gaps = 2/133 (1%)

Query: 423 NEKDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKK- 481
           N   + K   ++ N+++ +S  E+  E    D+ + G   +K R+L +S +   + ++K 
Sbjct: 470 NTDSVNKMEKEISNYKEIISKLERQFEKHLQDLGEKGGDYNKLRELYVSKLEVCDAIEKS 529

Query: 482 EDVNNF-DSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELL 540
           EDVN F +S+++   +   R +    ++QKE  +   EI   E   ++ + K   EK+ L
Sbjct: 530 EDVNKFRESENEYMQKEIERAEKSIADLQKETESTVHEITTSEISIKETIDKNAMEKDGL 589

Query: 541 LAQFRRLGGLERM 553
           L +   +  + R+
Sbjct: 590 LQKIDEMQNVLRI 602

>ZYRO0E00946g Chr5 (63743..64987) [1245 bp, 414 aa] {ON} similar to
           uniprot|P54730 Saccharomyces cerevisiae YMR067C UBX4 UBX
           (ubiquitin regulatory X) domain- containing protein that
           interacts with Cdc48p
          Length = 414

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 80/182 (43%), Gaps = 18/182 (9%)

Query: 379 PLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFE 438
           PL+D   D++++ R+Q     +   +V     LR  LQ   E+ N   I    A+L+ F 
Sbjct: 75  PLSDDGGDKIIKVRVQAPGYSAKVESVSINANLRTFLQQLSESANWP-IQDPGAKLQFFT 133

Query: 439 KRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLK 498
           K + + E    NDQ+ +K LG + S + +L   +    +      +    + +    +  
Sbjct: 134 KTIPISEL---NDQT-LKSLGIMESLSIRLIFPSSTTTDASASMPIPAGTTPAR--EQED 187

Query: 499 TRTKVYYQEIQKEENAKA-----KEIAQQEKLQED------KVAKEKREKELLLAQFRRL 547
           T  KV  ++I +     A     K IA Q  +QE+       VA  +R ++++L Q   L
Sbjct: 188 THRKVESRKIHQLHQVSAYIPSEKTIASQLNIQEENDDPELTVAHARRYQQMVLRQTGGL 247

Query: 548 GG 549
           GG
Sbjct: 248 GG 249

>ADL022C Chr4 complement(660327..670505) [10179 bp, 3392 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL021W
           (SPA2) and YLR313C
          Length = 3392

 Score = 32.0 bits (71), Expect = 5.8,   Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 59/137 (43%), Gaps = 28/137 (20%)

Query: 353 DNSQIVKPSLHSLNNKTKEVMDFVNTPLTDKT---------TDEVVRHRM--QFNKKLSG 401
           D   +++  + +L N+  E + F N  LT K           D  V   M   F +KLS 
Sbjct: 424 DAGVVLQQQISALTNQVNE-LTFENEALTQKNLTLTTQLADQDATVGRSMGDSFKEKLSA 482

Query: 402 TNAVLE------KTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVYEKHHENDQSDI 455
            N+ LE      +T+   K + A + + ++DI    +   NF+K+MSV            
Sbjct: 483 LNSQLEELITQNQTLKLSKAELAAKLSKQQDIIASRSVDDNFQKQMSVL----------T 532

Query: 456 KKLGELTSKNRKLNMSN 472
            +L +L+ +N  L  SN
Sbjct: 533 NQLNDLSIENETLKQSN 549

>Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON}
           (144394..145599) [1206 nt, 402 aa]
          Length = 401

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 374 DFVNTPLTDKT--TDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYS 431
           + ++  LT++T   DE+V+ R    KK++    + E   LREKL Y  E N  +    Y 
Sbjct: 77  ELISDVLTEQTRQADELVKQRKLLEKKVAELKQMPESGSLREKLAYTFEYNTARKFPAYI 136

Query: 432 AQ 433
            Q
Sbjct: 137 WQ 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,934,364
Number of extensions: 2325402
Number of successful extensions: 15179
Number of sequences better than 10.0: 703
Number of HSP's gapped: 15113
Number of HSP's successfully gapped: 858
Length of query: 565
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 450
Effective length of database: 40,294,809
Effective search space: 18132664050
Effective search space used: 18132664050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)