Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_7.163.569ON70870835230.0
YGL245W (GUS1)3.569ON70870834430.0
Skud_7.223.569ON70870834030.0
Suva_7.163.569ON70870833680.0
NCAS0E002503.569ON70870831540.0
NDAI0I032503.569ON70970630490.0
KAFR0J028903.569ON70670830140.0
TDEL0D063703.569ON70670629770.0
KNAG0I002203.569ON70770629730.0
Kpol_507.83.569ON70770829440.0
CAGL0C01947g3.569ON70570929130.0
TPHA0A060203.569ON70770828890.0
SAKL0F00748g3.569ON70770828630.0
KLLA0A00682g3.569ON70870928580.0
Kwal_47.192723.569ON70470628430.0
AFR264W3.569ON70770828190.0
ZYRO0E09570g3.569ON70670428110.0
TBLA0E001903.569ON70770827830.0
KLTH0G00682g3.569ON70470627720.0
YOR168W (GLN4)6.51ON8093355713e-62
KNAG0M011006.51ON7993355651e-61
ZYRO0C07018g6.51ON8033745616e-61
Skud_15.3326.51ON8093355616e-61
Smik_15.3486.51ON8103355591e-60
TDEL0G041906.51ON8093345554e-60
CAGL0L04532g6.51ON7953385492e-59
KAFR0G026106.51ON7943315483e-59
SAKL0E02134g6.51ON8013315475e-59
NDAI0K028606.51ON8143315432e-58
TPHA0J005506.51ON8083425404e-58
Kpol_1037.386.51ON8083315395e-58
TBLA0G004506.51ON8083315387e-58
Suva_8.2236.51ON8213355397e-58
Kwal_56.225596.51ON8003355361e-57
AGR259C6.51ON7983355324e-57
KLTH0C10340g6.51ON8003315325e-57
NCAS0F002406.51ON8113355318e-57
Ecym_31356.51ON8043525291e-56
KLLA0F20449g6.51ON8043255254e-56
KNAG0L006207.100ON5172322037e-16
NDAI0A084607.100ON5293531814e-13
NCAS0I005607.100ON5273361742e-12
TPHA0L005907.100ON5582751629e-11
TBLA0E021807.100ON5312791582e-10
YOL033W (MSE1)7.100ON5362201564e-10
CAGL0F01133g7.100ON5323391555e-10
Kpol_1044.127.100ON5362281547e-10
KAFR0D013207.100ON5142311502e-09
Suva_15.1347.100ON5353481466e-09
Skud_15.1227.100ON5323211441e-08
Ecym_26267.100ON5732311413e-08
TDEL0H035007.100ON5342251403e-08
KLLA0F07975g7.100ON5422761386e-08
SAKL0B09548g7.100ON5541691352e-07
AEL338C7.100ON5332321323e-07
Smik_15.1327.100ON5353441323e-07
KLTH0D02794g7.100ON5462261297e-07
ZYRO0D05808g7.100ON5331151243e-06
Kwal_26.72027.100ON5672231234e-06
Smik_12.4694.236ON89565810.50
NDAI0J017304.136ON154688743.1
Skud_4.6905.519ON85531743.3
TBLA0I028804.236ON892144734.0
Suva_13.198na 1ON38262699.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_7.16
         (708 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1361   0.0  
YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}  GUS1Glutamyl...  1330   0.0  
Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1315   0.0  
Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1301   0.0  
NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569     1219   0.0  
NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {O...  1179   0.0  
KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {...  1165   0.0  
TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa] ...  1151   0.0  
KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569...  1149   0.0  
Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON} (51597..53...  1138   0.0  
CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly...  1126   0.0  
TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa] ...  1117   0.0  
SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...  1107   0.0  
KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly s...  1105   0.0  
Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]...  1099   0.0  
AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic ho...  1090   0.0  
ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {...  1087   0.0  
TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569...  1076   0.0  
KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly s...  1072   0.0  
YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}  GLN4Gluta...   224   3e-62
KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6....   222   1e-61
ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly...   220   6e-61
Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168...   220   6e-61
Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168...   219   1e-60
TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.5...   218   4e-60
CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highl...   216   2e-59
KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.5...   215   3e-59
SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {...   215   5e-59
NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6....   213   2e-58
TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {...   212   4e-58
Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {O...   212   5e-58
TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}...   211   7e-58
Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W ...   212   7e-58
Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {...   211   1e-57
AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}...   209   4e-57
KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly...   209   5e-57
NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}...   209   8e-57
Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar t...   208   1e-56
KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} high...   206   4e-56
KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON...    83   7e-16
NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON} Anc_7...    74   4e-13
NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}...    72   2e-12
TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {...    67   9e-11
TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {O...    65   2e-10
YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}  MSE1Mitoc...    65   4e-10
CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {...    64   5e-10
Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {O...    64   7e-10
KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {O...    62   2e-09
Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033...    61   6e-09
Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033...    60   1e-08
Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar...    59   3e-08
TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.1...    59   3e-08
KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {...    58   6e-08
SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} simila...    57   2e-07
AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON} Syn...    55   3e-07
Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033...    55   3e-07
KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {...    54   7e-07
ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {...    52   3e-06
Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {O...    52   4e-06
Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {...    36   0.50 
NDAI0J01730 Chr10 complement(421402..426042) [4641 bp, 1546 aa] ...    33   3.1  
Skud_4.690 Chr4 (1220089..1222656) [2568 bp, 855 aa] {ON} YDR416...    33   3.3  
TBLA0I02880 Chr9 complement(680214..682892) [2679 bp, 892 aa] {O...    33   4.0  
Suva_13.198 Chr13 (321195..322343) [1149 bp, 382 aa] {ON}  YMR03...    31   9.1  

>Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1361 bits (3523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/708 (94%), Positives = 666/708 (94%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60
           MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT
Sbjct: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60

Query: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120
           GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA
Sbjct: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180
           DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180

Query: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300

Query: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360
           EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV
Sbjct: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXX 540
           LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQ          
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKPKH 540

Query: 541 XXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600
             NPAVGE                      EEITLMDWGNVIITKKNEDGSMIAKLNLEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}
           GUS1Glutamyl-tRNA synthetase (GluRS), forms a complex
           with methionyl-tRNA synthetase (Mes1p) and Arc1p;
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1330 bits (3443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/708 (91%), Positives = 660/708 (93%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60
           MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAI  VDDKKAPAA LDDATEDVF+KIT
Sbjct: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIKLVDDKKAPAAKLDDATEDVFNKIT 60

Query: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120
            KFAAIFDNGDKEQ+AKWV+LAQKELV+KNFAKLSQSLE LDSQLNLRTFILGGLKYSAA
Sbjct: 61  SKFAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180
           DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSL ELKKSANVG
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSANVG 180

Query: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLP+AK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDLDLLGIKGD+ITYSSDYFQEMYDYC+QMIKDGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300

Query: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360
           EKMREERMDG+AS+RRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV
Sbjct: 301 EKMREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQYDWMLQALRL
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXX 540
           LSQGPSRNVINLEWNLIWAFNKK+IDPIAPRHTAIVNPVKIHLEGSEAPQ          
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKPKH 540

Query: 541 XXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600
             NPAVGE                      EE+TLMDWGNVIITKKN+DGSM+AKLNLEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNLEG 600

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1315 bits (3403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/708 (89%), Positives = 659/708 (93%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60
           MPSTLT+NGKAP VAYAELIAARIVNALAPNSIAI FVDDKKAPAA LDDATE VF+KIT
Sbjct: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVDDKKAPAAKLDDATEGVFNKIT 60

Query: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120
           GKFAAIFDNGDKEQ+++W DLA+KELVVKNFAKLSQSLE LDSQLN+RTFILGGLKYSAA
Sbjct: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180
           DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFL+KSLQELKKSANVG
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180

Query: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLP+AK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEM+DYC+QMIKDGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300

Query: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360
           E+MREERMDGIAS+RR+RSVEENLR+FTEEMKNGTEEGLKNCVRAKIDY+ALNKTLRDPV
Sbjct: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRN QYDWMLQALRL
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXX 540
           LSQGPSRNVINLEWNLIWAFNKK+IDPIAPRHTAIVNPVKIHLEG+EAPQ          
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540

Query: 541 XXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600
             NPAVGE                      EE+TLMDWGNVIITKKN+DGSM+AKL+LEG
Sbjct: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMK+GDIIQFERKGYYRLDALPK+GKPYVFFTIPDGKSVN+YGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708

>Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1301 bits (3368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/708 (87%), Positives = 657/708 (92%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60
           MPSTLTINGKAP VAYAELIAARIVNALAPNSIA+ FVDDKKAPAA LDDATEDVF+KIT
Sbjct: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVDDKKAPAAKLDDATEDVFNKIT 60

Query: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120
           GKFAAIFDNG KE++AKWV LAQ+ELVVKNF KLSQSLE LD+QLNLRTFILGGLKYSAA
Sbjct: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180
           DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAH+FL+KSLQE+KK+ANVG
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180

Query: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLP+AK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRF
Sbjct: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDL+LLGIKGD+ITYSSDYFQEMYDYC+QMIKDGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300

Query: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360
           EKMREERMDGIAS+RRDRSVEENLRIFTEEMKNGTE GLKNCVRAKIDY+ALNKTLRDPV
Sbjct: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQYDWMLQALRL
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFARINFVRTLLSKRKLQWMVDK+LVGNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXX 540
           LSQGPSRNVINLEWNLIWAFNKK+IDPIAPRHTA+VNPVKIHLEG+EAPQ          
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540

Query: 541 XXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600
             NPAVGE                      EE+TLMDWGNV+ITKKN DGSM+AKL+LEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHLEG 600

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHKLTWLADTKD+VPVDLVDFDHL+TKD+LEEDESFEDFLTP+TEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660

Query: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMK+GDI+QFERKGY+RLDALPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569
          Length = 708

 Score = 1219 bits (3154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/708 (81%), Positives = 625/708 (88%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60
           M +TL INGKAP+VAYAELIAARIVN   PNSI+I FVDDKKA  A  +   +D F KI 
Sbjct: 1   MSATLVINGKAPVVAYAELIAARIVNETKPNSISIEFVDDKKAAPATFNGDNKDAFLKIV 60

Query: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120
            +F+ +F N  +E + +WV +A +ELV+KNF KLS+SL  LD+ LNLRTFILGGLKYSAA
Sbjct: 61  AQFSDVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180
           D+ACWGALRSNGMCGSIIKNKV+VNVSRWYTLLEMDPIFG  H+FL+KSLQELKK+AN G
Sbjct: 121 DIACWGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTANAG 180

Query: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLP+AK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEFQDSILEDL+LLGIKGD+IT+SSDYFQEMYDYCIQMIK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDTPT 300

Query: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360
           EKMREERMDGIAS+RRDRSVEENL+IFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV
Sbjct: 301 EKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQY+WMLQAL L
Sbjct: 361 IYRCNLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQALNL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXX 540
           LSQGPSRNVINLEWNLIWAFNKK+IDP+APRHTAIVNPVKIHLEG + PQ          
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKPKH 540

Query: 541 XXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600
             NPAVGE                      EE+T+MDWGNVIIT+KN DGS++ KL+LEG
Sbjct: 541 KKNPAVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHLEG 600

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHKLTWLADT DVVPVDLVDFDHLITKD+LEEDESFEDFLTP TEFHTDAIADLN
Sbjct: 601 DFKKTKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIADLN 660

Query: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMK+GDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {ON}
           Anc_3.569 YGL245W
          Length = 709

 Score = 1179 bits (3049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/706 (79%), Positives = 614/706 (86%)

Query: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKITGK 62
           +TL INGKAP+VAY +LIAARI+N   P SI I FVDDKK+  ++ + +++  F KI   
Sbjct: 4   NTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEG 63

Query: 63  FAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAADV 122
           F  IF   +K+ +A+W  +A +ELVVKNF KLS+SL  LD+QLNLRTFILGGLKYSAAD+
Sbjct: 64  FPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADI 123

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVGKK 182
           ACWGALRSNGMCGSI+KNKVDVNVSRWY+LLEMDP FG  H+ L+KSLQELKK +N GKK
Sbjct: 124 ACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKK 183

Query: 183 KETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242
           KETHKANFEIDLP+AK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRFDD
Sbjct: 184 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDD 243

Query: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEK 302
           TNPSKEKEEFQDSILEDL+LLGIKGD+ITYSSDYFQ+MY+ C++MIK+GKAYCDDTPTEK
Sbjct: 244 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEK 303

Query: 303 MREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362
           MREERMDGIAS+RRDRSVEENLRIF EEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY
Sbjct: 304 MREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 363

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
           RCNLTPHHRTG+TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQYDWML A+ LRK
Sbjct: 364 RCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRK 423

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 483

Query: 483 QGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXXXX 542
           QGPSRNVINLEWNLIWAFNKK+IDP+A RHTAIV+PVKIHLEG + PQ            
Sbjct: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKK 543

Query: 543 NPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEGDF 602
           NPAVGE                      EE+T+MDWGNVIITKKN DGSM+ KL+L+GDF
Sbjct: 544 NPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDF 603

Query: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662
           KKTKHKLTWLADT+DVVPVDLVDFDHLI+KD+LEEDESFEDFLTP TEFHT AIADLNVK
Sbjct: 604 KKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVK 663

Query: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           DMK+GDIIQFERKGYYRLDA+ KDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 664 DMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709

>KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {ON}
           Anc_3.569 YGL245W
          Length = 706

 Score = 1165 bits (3014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/708 (77%), Positives = 613/708 (86%), Gaps = 2/708 (0%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60
           M +TL INGKAP+VAY  LIAAR+VNA  P++I I FVDDKK+  A  + ++E  F+KI 
Sbjct: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60

Query: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120
             F   F N +    ++W+++A +E +VKNF KL+QSLE LD+ LNLRTFI GGL+YSAA
Sbjct: 61  AAFPDAFRNAN--VASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAA 118

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180
           D+A WGALRSNGM GSIIKNKV VNVSRWY+LLEMDP+FG  H+FL+KSLQELKK+A+ G
Sbjct: 119 DIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAG 178

Query: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLP+AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 179 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 238

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300
           DDTNPSKEK EFQDSILEDL+LLGIKGD++TYSSDYFQEMYD C+Q+IK+G AYCDDTPT
Sbjct: 239 DDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPT 298

Query: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360
           EKMREERMDGIAS+RRDR+VEENLRIFTEEMKNGTEEGLKNCVRAKIDY ALNKTLRDPV
Sbjct: 299 EKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 358

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQY+WML AL L
Sbjct: 359 IYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHL 418

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFV
Sbjct: 419 RKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 478

Query: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXX 540
           LSQGPSRNVINLEWN+IWAFNKK+IDP+APRHTA+VNPVKIHL G +AP+          
Sbjct: 479 LSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKH 538

Query: 541 XXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600
             NPAVGE                      EE+TLMDWGN+IITKKN DGSM AK++LEG
Sbjct: 539 KKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEG 598

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKT HKLTWLADT+DVVPVDLVDFDHLI+KD+LEEDESFEDFLTP+TEFHT AIADLN
Sbjct: 599 DFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 658

Query: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VK+MK+GD+IQFERKGY+RLD+LPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 659 VKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706

>TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa]
           {ON} Anc_3.569 YGL245W
          Length = 706

 Score = 1151 bits (2977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/706 (78%), Positives = 606/706 (85%), Gaps = 1/706 (0%)

Query: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKITGK 62
           + L INGKAP+VAYAELIAAR+VN + P SI + FVDDKKA  A+LD  +E VF KI   
Sbjct: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61

Query: 63  FAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAADV 122
           F  IF  G  E++A WV  A  + V+KNF KLS SLE LD+ LNLRT+ILGGLKYSAAD+
Sbjct: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVGKK 182
           ACWGALRSNGM GSIIKNKVDVNVSRWYTLLE D  FG AH+FL+KS+Q+LKK++NVGKK
Sbjct: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181

Query: 183 KETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242
           KE HKANFEIDLP+AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241

Query: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEK 302
           TNPSKEKEEFQDSI+EDL LLGI+GD++T+SSDYFQEMYD C++MIK+GKAYCDDT TEK
Sbjct: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301

Query: 303 MREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362
           MREERMDGIAS+RRDR VEENLRIFT+EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
           RCNLTPHHRTG+T K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQYDWML A+ LRK
Sbjct: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 483 QGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXXXX 542
           QGPSRNVINLEWNLIWAFNKK+IDP+APR TA+VNPVK+HL+G +APQ            
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540

Query: 543 NPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEGDF 602
           NP VGE                      EE+TLMDWGNVIITKKN DGS+  KLNL+GDF
Sbjct: 541 NPDVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600

Query: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662
           KKTKHKLTWLADT+DV PVDLVDFDHLI+KD+LEEDESFEDFLTP+TEFHT AIADLNVK
Sbjct: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660

Query: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           D+K+GDIIQFERKGYYRLDAL KDGKPYVFFTIPDGKSVN+YGAKK
Sbjct: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706

>KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1149 bits (2973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/706 (77%), Positives = 599/706 (84%), Gaps = 2/706 (0%)

Query: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKITGK 62
           +TL INGKAPIVAY  LIAARI N+   +S+AI FVDDK A  A+ +  +EDV SKI  +
Sbjct: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63

Query: 63  FAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAADV 122
           F  +F   +   +A WV  A  E VVKNFAKL++SL  LD+ LNLRTF+LGGLKYS AD+
Sbjct: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVGKK 182
           ACWGALRSNGM GSIIKNKV VNVSRWYTL EM P F  AH+FL+KS+QELKK++  GKK
Sbjct: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183

Query: 183 KETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242
           KE+HKANFEIDLP+AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD
Sbjct: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243

Query: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEK 302
           TNPSKEKEEFQDSILEDL LLGIKGD++TYSSDYFQ+MYD CIQ+IK+G AYCDDTPTEK
Sbjct: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303

Query: 303 MREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362
           MREERMDGIAS+RRDRSVEENL+IFTEEMKNGTEEGLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
           RCNLTPHHRTG TWK+YPTYDFCVPIVD+VEGVTHALRTIEYRDRN QYDWML AL LRK
Sbjct: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRNFVLS 483

Query: 483 QGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXXXX 542
           QGPSRNVINLEWNLIWAFNKK+IDP+APRHTA+V+PVK+H+EG  AP+            
Sbjct: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHKK 541

Query: 543 NPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEGDF 602
           NPAVGE                      EE+TLMDWGNVIITK++ DGS+  KL+LEGDF
Sbjct: 542 NPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDF 601

Query: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662
           KKTKHKLTWLADT+DVVPVDLVDFDHLI KDRLEE ESFEDFLTPQTEF T AIADLNVK
Sbjct: 602 KKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVK 661

Query: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
            MK+GDIIQFERKGYYRLD+LPKDGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 662 HMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707

>Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON}
           (51597..53720) [2124 nt, 708 aa]
          Length = 707

 Score = 1138 bits (2944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/708 (76%), Positives = 607/708 (85%), Gaps = 1/708 (0%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60
           M +TL I GKAP+VAYAELIAARIVN+  P+SI I FV+DKKA  A L+  + DV SKI 
Sbjct: 1   MSATLVIGGKAPVVAYAELIAARIVNSSKPDSIKIEFVEDKKASPATLNGDSVDVLSKIV 60

Query: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120
              + +F  G      +W+ +A +ELVVKNF +L++SLE LD+ LNLRT+I GGL ++ A
Sbjct: 61  TANSDVFPEGAANS-TEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFTVA 119

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180
           D+ACWGALRSNGM GSIIKNKV+VNVSRWYTLLE + +FG  H+FL+KSLQELKK++  G
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKASTAG 179

Query: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLP+AK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 180 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300
           DDTNPSKE  EFQDSILEDL+LLGIKGD+IT+SSDYFQEMYDYC+Q+IKDGKAYCDDTPT
Sbjct: 240 DDTNPSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDTPT 299

Query: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360
           EKMR+ERM+GIAS RRDRSVEENL+IFTEEMKNGTEEGLKNCVRAKIDY+ALNKTLRDPV
Sbjct: 300 EKMRDERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 359

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           I+RCNLTPHHRTGS WK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQY+WML AL+L
Sbjct: 360 IFRCNLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NW+DPRFPT        MTVEGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRNFV 479

Query: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXX 540
           LSQGPSRNVINLEWNLIW+FNKK+IDP+ PR TA+V+PVKIHLEG +APQ          
Sbjct: 480 LSQGPSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKPKH 539

Query: 541 XXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600
             NP VGE                      EEITLM+WGN IITKKN DGS+ AKL+LEG
Sbjct: 540 PKNPVVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHLEG 599

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHK+TWLADT+DVV VDLVDFDHLI+KD+LEEDESFEDFLTP+TEFHT AIADLN
Sbjct: 600 DFKKTKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLN 659

Query: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMK+GDIIQFERKGYYRLD+L  DGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 660 VKDMKVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK 707

>CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245w
          Length = 705

 Score = 1126 bits (2913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/709 (77%), Positives = 606/709 (85%), Gaps = 5/709 (0%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVN-ALAPNSIAIVFVDDKKAPAAILDDATEDVFSKI 59
           M STL INGKAP+VAYAELIAAR+VN + +  S+ + FVDDKK+ AA  D  +++    I
Sbjct: 1   MSSTLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEAI 60

Query: 60  TGKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSA 119
             KF  I   G  E+   W+ LA +ELV+KNF KL+QSLE LD+QLN RT+I GGLK+ +
Sbjct: 61  VAKFPEIL--GANEESKPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFDS 118

Query: 120 ADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANV 179
           AD+ACWGALRSNGM GSIIKNKV VNVSRWY LLE +P FG++H+FL+KSLQELKK+AN 
Sbjct: 119 ADIACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAANA 178

Query: 180 GKKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 239
           GKKKE+HKANFEIDLP+AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR
Sbjct: 179 GKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 238

Query: 240 FDDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTP 299
           FDDTNPSKEK EFQDSILEDL+LLGIKGD+ITYSSDYFQEMY+ C+++IK+GKAYCDDTP
Sbjct: 239 FDDTNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDTP 298

Query: 300 TEKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 359
           TEKMREERMDGIAS+RR+RSVEENL+IFTE+MKNGTEEGLKNCVRAKIDY ALNKTLRDP
Sbjct: 299 TEKMREERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRDP 358

Query: 360 VIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALR 419
           VIYRCNLTPHHRTGS WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQYDW L  L 
Sbjct: 359 VIYRCNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNLN 418

Query: 420 LRKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNF 479
           LRKVHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NWDDPRFPT        MTVEGLRNF
Sbjct: 419 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNF 478

Query: 480 VLSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXX 539
           VLSQGPSRNVINLEWNLIWAFNKK+IDP+APRHTAIVNPVKIH+EG  AP+         
Sbjct: 479 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHIEG--APESPKTEMKPK 536

Query: 540 XXXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLE 599
              NPAVGE                      EE+TLMDWGN+IITKKN DGSM AKL+LE
Sbjct: 537 HKKNPAVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHLE 596

Query: 600 GDFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADL 659
           GDFKKTKHKLTWLADT D V VDLVDFDHLI+KD+LEEDESFEDFLTPQTEFHT+AIADL
Sbjct: 597 GDFKKTKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIADL 656

Query: 660 NVKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           NVKDM +GDIIQFERKGYYRLDA  KDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 657 NVKDMIVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK 705

>TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa]
           {ON} Anc_3.569 YGL245W
          Length = 707

 Score = 1117 bits (2889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/708 (75%), Positives = 608/708 (85%), Gaps = 1/708 (0%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60
           MP+TL I GK+ +VAY+ELIAARIVN++ P+SI I FV+DKKA AA L+  T+DV SKI 
Sbjct: 1   MPATLIIGGKSSVVAYSELIAARIVNSVKPDSITIEFVEDKKAAAASLNGETDDVLSKIV 60

Query: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120
              A +F  G      +WV LA  ELV+KNF KL+ SL+ LD+ LNLRTFI GGL YS A
Sbjct: 61  SANADVFPEGVTGS-EEWVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYSIA 119

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180
           D+ACWGALRSNGM GSIIKNKV+VNVSRWYTL E +PIFGEA++FL+KSLQELKK+++ G
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASSAG 179

Query: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLP+AK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFA AYKGKLIIRF
Sbjct: 180 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLIIRF 239

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300
           DDTNPSKEK EFQ+SILEDL LLGIKGD+IT+SSDYFQEMYDYCIQ+IK+GKAYCDDTP 
Sbjct: 240 DDTNPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDTPV 299

Query: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360
           +KMREERMDGIAS+RR+RSVEENL+IFTEEM+NGTEEGL+NCVRAKIDY+ALNKTLRDPV
Sbjct: 300 DKMREERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRDPV 359

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNL PHHRTG+ WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQY+WML A+ L
Sbjct: 360 IYRCNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAMNL 419

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK+LV NWDDPRFPT        MT+EGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479

Query: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXX 540
           +SQGPSRNVINLEWNLIWAFNKK+IDP+APR T ++NP+KIHL G++AP+          
Sbjct: 480 ISQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKPKH 539

Query: 541 XXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600
             NPAVGE                      EEITLM+WGN II KKN DGS+ A L+LEG
Sbjct: 540 PKNPAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHLEG 599

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHK+TWLA+T+DV  VDLVDFDHLITKD+LEEDESFE+FLTP TEFHTDAIAD+N
Sbjct: 600 DFKKTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIADVN 659

Query: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMK+GDIIQFERKGYYRLDALPKDGKPY+FFTIPDGK+VNKYGAKK
Sbjct: 660 VKDMKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK 707

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 1107 bits (2863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/708 (75%), Positives = 594/708 (83%), Gaps = 1/708 (0%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60
           M + L INGKAP+VAYAELIAARIVNA   ++I I FVDDKKA  A  +   +  FSKI 
Sbjct: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60

Query: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120
             +  +F  G +   ++W  LA +E ++KNF KLS SL  LDS+LNLRT+IL     + A
Sbjct: 61  NAYQDVFSEGVQGS-SEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPA 119

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180
           D+ACWGALRSNGM GSIIKNKV VNVSRWYT+LE+DP+F  AH+FL+KSLQELKK++N  
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSN 179

Query: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEI LP+AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 180 KKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300
           DDTNPSKEK EFQDSILEDLDLLGIKGDKITYSSDYF+EMY  C+Q+IK+GKAYCDDTPT
Sbjct: 240 DDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPT 299

Query: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360
           EKMREERMDGIAS+RRDRSVEENLRIF EEMKNGTEEGLKNCVRAKIDYKALNK LRDPV
Sbjct: 300 EKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPV 359

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           I+RCNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WML AL L
Sbjct: 360 IFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHL 419

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK  V NWDDPRFPT        MTVEGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 479

Query: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXX 540
           LSQGPSRNVINLEWNLIWAFNKK+IDP+APRHTA+V PVK+HLEG + PQ          
Sbjct: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKH 539

Query: 541 XXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600
             NP VGE                      EE+TLMDWGNVIITKKN DGS++ KL+LEG
Sbjct: 540 KKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEG 599

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTK KLTWLADT+D V VDLVDFDHLI+KD+LEE ++FEDFLTP+TEFHT AIADLN
Sbjct: 600 DFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLN 659

Query: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMK+GD+IQFERKGYYRLD+L KDGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 660 VKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707

>KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/709 (74%), Positives = 596/709 (84%), Gaps = 2/709 (0%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVNAL-APNSIAIVFVDDKKAPAAILDDATEDVFSKI 59
           M ++L I  KAP++AY ELIAAR VNA    N+I I FV+DKKA AA  +  TEDV +K+
Sbjct: 1   MSASLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTKL 60

Query: 60  TGKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSA 119
           +  +  I  N + +  A+W++   K+LV+KNF +L++SL  L++ LNLRT+IL  L+ S 
Sbjct: 61  SAAYPDIL-NDNSDSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPSL 119

Query: 120 ADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANV 179
           AD+A WG LRSNGM GSIIKNKV +NVSRWY+  E+ P FG+AH+FL+KSLQELKK++NV
Sbjct: 120 ADIAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASNV 179

Query: 180 GKKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 239
            KKKETHKANFEI LP+AK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR
Sbjct: 180 NKKKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 239

Query: 240 FDDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTP 299
           FDDTNPSKEKEEFQDSILEDL+LLGIKGD+ITYSSDYFQEMYDYC+QMIK+GKAYCDDTP
Sbjct: 240 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDTP 299

Query: 300 TEKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 359
           TE+MREER +GI SSRR+R+VEENL+IFTEEMKNGTEEGLKNCVRAKIDY+ALNK +RDP
Sbjct: 300 TERMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRDP 359

Query: 360 VIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALR 419
           VIYRCNLTPHHRTG+ WKIYPTYDFCVPIVD++EGVTHALRTIEYRDRN QYDWML AL 
Sbjct: 360 VIYRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNALH 419

Query: 420 LRKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNF 479
           LRKVHIWDFAR+NFVRTLLSKRKLQW+VDKD+V NWDDPRFPT        MT+EGLRNF
Sbjct: 420 LRKVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRNF 479

Query: 480 VLSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXX 539
           VLSQGPSRNVINLEWNLIW+FNKK+IDP+APRHTAIV+PVK+HLEG + PQ         
Sbjct: 480 VLSQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKLK 539

Query: 540 XXXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLE 599
              NPA+GE                      EE+TLMDWGN IITKKN+DGS  AKL+LE
Sbjct: 540 HKKNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHLE 599

Query: 600 GDFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADL 659
           GDFK TK KLTWLADT D V  DLVDFDHLI+KD+LEE E+FEDFLTP+TEFHT A ADL
Sbjct: 600 GDFKTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYADL 659

Query: 660 NVKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           NVKDMK+GDIIQFERKGY+RLD+LPKDGKPYVFFTIPDGKSVNKYGAKK
Sbjct: 660 NVKDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]
           {ON} YGL245W - Protein required for cell viability
           [contig 344] FULL
          Length = 704

 Score = 1099 bits (2843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/706 (75%), Positives = 586/706 (83%), Gaps = 3/706 (0%)

Query: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKITGK 62
           + LT+  KAP+VAY+ELIAAR+ NA+ P +I I FV+DKKA  A  +  + DV   I   
Sbjct: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61

Query: 63  FAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAADV 122
           F   F  G  +   KW   A +ELVVKNF KLS SL+ LD+QLNLRTF+LGG  YS AD+
Sbjct: 62  FPEAFKGG-FDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVGKK 182
           ACWG+LRSNGM GSIIKN+V VNVSRWYTLLE  P FG AH+FL+K++QELKK++   KK
Sbjct: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180

Query: 183 KETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242
           KETHKANFEIDLP+AKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDD
Sbjct: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240

Query: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEK 302
           TNPSKEKEEFQDSILEDL+LLGIKGD++TYSSDYFQEMY+ C++MI++GKAYCDDT TE+
Sbjct: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300

Query: 303 MREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362
           MREERMDGIAS+RRDRSVEENLRIFT EMKNGTEEGLKNCVRAKIDY+A NKTLRDPVIY
Sbjct: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
           RCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQYDWML AL LRK
Sbjct: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDKDLV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 483 QGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXXXX 542
           QGPSRNVINLEWNLIWAFNKK+IDP+APRHTA+VNPVK H++G  APQ            
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKK 538

Query: 543 NPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEGDF 602
           NPAVGE                      EE+TLMDWGNVI+TKKN DGS+  KL+LEGDF
Sbjct: 539 NPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDF 598

Query: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662
           KKTK K+TWLADT D V VDLVDFDHLI+KD+LEE E F DFLTP+TEFH  AIADLNVK
Sbjct: 599 KKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVK 658

Query: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           DMK GDIIQFERKGYYRLDA+    KPYVFF+IPDGKSVNKYGAKK
Sbjct: 659 DMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704

>AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL245W (GUS1)
          Length = 707

 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/708 (73%), Positives = 588/708 (83%), Gaps = 1/708 (0%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60
           M STL I  K+P VAYAELIAAR VN    +++AI F + K+A AA  D  +++   ++ 
Sbjct: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60

Query: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120
            K+  +  +   E+ A W+  A+ +LVVK+F KLS SLE LD+ LNLRTF+LGG++ + A
Sbjct: 61  EKYPDVLGSV-PEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVA 119

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180
           DVA WGALRSNG  GSIIKNKV VNVSRWYT LE+ P FG AH+FL+KSL+ELK + NV 
Sbjct: 120 DVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVN 179

Query: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKETHKANFEIDLP+AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 180 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300
           DDTNPSKE+ EFQDSILEDL+LLGIKGD+IT+SSDYFQEMYDYC+QMIK+GKAYCDDTPT
Sbjct: 240 DDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPT 299

Query: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360
           E+MREERM+GIAS+RR+RSVEENL+IFTEEMKNGTEEGLKNCVRAK DY ALNKTL+DPV
Sbjct: 300 ERMREERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPV 359

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           +YRCNLTPHHRTG+ WKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQY+WML AL+L
Sbjct: 360 LYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           RKVHIWDFAR+NFVRTLLSKRKLQW+VDK +V NWDDPRFPT        MT+EGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479

Query: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXX 540
           LSQGPSRNVINLEWNLIWAFNKK+IDPIAPRHT + NPVK+HL G++ PQ          
Sbjct: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKH 539

Query: 541 XXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600
             NPAVGE                      EE+TLMDWGN II  KN+DGS+ A LNLEG
Sbjct: 540 KKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEG 599

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTK KLTWLADT D VPVDLVDFDHLI+KDRLEE+++FEDFLTP+TEFHT AIADLN
Sbjct: 600 DFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLN 659

Query: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMK+GD+IQFER GYYRLD +    KP+VFFTIPDGK+VNKYGAKK
Sbjct: 660 VKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707

>ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {ON}
           highly similar to uniprot|P46655 Saccharomyces
           cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
           forms a complex with methionyl-tRNA synthetase (Mes1p)
           and Arc1p complex formation increases the catalytic
           efficiency of both tRNA synthetases and ensures their
           correct localization to the cytoplasm
          Length = 706

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/704 (72%), Positives = 590/704 (83%), Gaps = 1/704 (0%)

Query: 5   LTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKITGKFA 64
           L INGKAP+VAYAELIA+RIVNA   ++I + FVD+K A   + + +++D F+KI   + 
Sbjct: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63

Query: 65  AIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAADVAC 124
            +F +   E++A W+ +A+++LVVKNF +LSQSLE LD+ LNLRTFILGGLK SAAD+ C
Sbjct: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123

Query: 125 WGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVGKKKE 184
           WGALRSNGM GSIIKNKV VNVSRWYTLLE++P FG AH++L+KS+Q +KK+   GKKKE
Sbjct: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183

Query: 185 THKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 244
            HKANFEIDLP+AK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDTN
Sbjct: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243

Query: 245 PSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMR 304
           PSKE+ EFQD+ILEDL+L+GIKGDKITYSSDYFQEMYD C+Q+IK+GKAYCDDT  EKMR
Sbjct: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303

Query: 305 EERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 364
           EERM+GI S++RD SVEENLRIFTEEMKNGTE G KNCVRAKIDYKA NKTLRDPVIYRC
Sbjct: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363

Query: 365 NLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVH 424
           NLTPHHRT   WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQYDWML+ALRLRKVH
Sbjct: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423

Query: 425 IWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQG 484
           IWDFAR+NF+RTLLSKRKLQWMVD  LV NWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVISQG 483

Query: 485 PSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXXXXNP 544
           PS+NVINLEWNLIWA NKKIIDP+APRHTA+V+PV+I LEG  AP+            NP
Sbjct: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543

Query: 545 AVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEGDFKK 604
           AVGE                      EE+TLMDWGN+IIT KN DGS++AK NL GDFKK
Sbjct: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603

Query: 605 TKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVKDM 664
           TKHK+TWLA+T D VPV++VDFDHLITKD+LEEDE+F DF+TPQTEFHT A+ D+NVKDM
Sbjct: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662

Query: 665 KIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           K+GDIIQFERKGY RLD+  +  KPY+FFTIPDGKSVN+YGAKK
Sbjct: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706

>TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1076 bits (2783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/708 (75%), Positives = 600/708 (84%), Gaps = 1/708 (0%)

Query: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60
           M + L ++GKA  VAY ELIAARIVN  + N++ I FV+DKKA  A LD +++DV +KI 
Sbjct: 1   MSTKLILSGKAQAVAYGELIAARIVNNSSANAVDISFVEDKKAAPATLDGSSDDVLAKIV 60

Query: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120
               + F +  KE +A W  LAQ++LVVKNF +L+Q+LE LD+QLNLR+F+LGGL +SAA
Sbjct: 61  ALSPSSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFSAA 120

Query: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180
           DVA WGALRSNGM GSIIKNKV VNVSRWY+ LE++P FGE+H+FL+KSLQELKK+AN G
Sbjct: 121 DVAVWGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAANAG 180

Query: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240
           KKKE+HKANFEIDL +AK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRF
Sbjct: 181 KKKESHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 240

Query: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300
           DDTNPSKEKEEF++SI+EDL LLGIKGD++T+SSDYFQEMYDYCIQMIK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDTPT 300

Query: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360
           EKMREERM+G  S+RR+RSVEENL+IFTE+M NGTEEGLKNCVRAKIDYKALNKTLRDPV
Sbjct: 301 EKMREERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420
           IYRCNLTPHH TG  WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQY+WML AL+L
Sbjct: 361 IYRCNLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDALKL 420

Query: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFV 480
           R VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        M++EGLRNFV
Sbjct: 421 RHVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRNFV 480

Query: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXX 540
           LSQGPSRNVINLEWNLIWAFNKK+IDP APRHTA+VNP K+HLEGSE PQ          
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKPKH 540

Query: 541 XXNPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600
             NP VGE                      EE TLMDWGN IITKK+ + S+ AKL+LEG
Sbjct: 541 KKNPDVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIITKKDAN-SITAKLHLEG 599

Query: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660
           DFKKTKHK+TWLADTKDVV VDLVDFDHL+ KDR+EE ESFEDFLT +TEFHT AIADLN
Sbjct: 600 DFKKTKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIADLN 659

Query: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           VKDMKIGD IQFERKGYYRLD+LPK+G PYVFFTIPDGK+VNKYGAKK
Sbjct: 660 VKDMKIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK 707

>KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 704

 Score = 1072 bits (2772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/706 (75%), Positives = 583/706 (82%), Gaps = 3/706 (0%)

Query: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKITGK 62
           + L I  KAP+VAY+ELIAAR+VN+   ++I I FV+DKK+  A  +D+ +DV  +I   
Sbjct: 2   AKLIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSPATFEDSCDDVLKRIVQT 61

Query: 63  FAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAADV 122
           +  +F +G  E   +W  LA +EL VKNF KLS SL  LD+ LN RTFILGG  +SAAD+
Sbjct: 62  YPEVFKHG-FENCDEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFSAADI 120

Query: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVGKK 182
           ACWG+LRSNGM GSIIKNKV VNVSRWYTLLE  P FG AH+FL K+LQELKK++   KK
Sbjct: 121 ACWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKASTSNKK 180

Query: 183 KETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242
           KETHKANFEIDL +AK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDD
Sbjct: 181 KETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240

Query: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEK 302
           TNPSKEKEEFQDSILEDL+LLGIKGD++TYSSDYFQEMYD C++MI++G AYCDDTPT+K
Sbjct: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDTPTDK 300

Query: 303 MREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362
           MREERMDG+AS+RRDRSVEENLRIFT+EMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY
Sbjct: 301 MREERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 360

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
           RCNLTPHHRTGSTWKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQY WML AL LRK
Sbjct: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDALHLRK 420

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
           VHIWDFAR+NFVRTLLSKRKLQWMVDKDLV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 483 QGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQXXXXXXXXXXXX 542
           QGPSRNVINLEWNLIWAFNKK+IDP+APRHTAIV PVK H+EG  APQ            
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHVEG--APQTPDVQIKLKHKK 538

Query: 543 NPAVGEXXXXXXXXXXXXXXXXXXXXXXEEITLMDWGNVIITKKNEDGSMIAKLNLEGDF 602
           NPAVGE                      EE+TLMDWGN I+TKKN DGS+  KL+LEGDF
Sbjct: 539 NPAVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHLEGDF 598

Query: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662
           KKTK KLTWLADT D V VDLVDFDHLITKD+LEE E F D+LTPQTEFH  A+ADLNVK
Sbjct: 599 KKTKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVADLNVK 658

Query: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708
           DMK GDIIQFERKGYYRLD+     KPYVFF IPDGKSVNKYGAKK
Sbjct: 659 DMKKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK 704

>YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}
           GLN4Glutamine tRNA synthetase, monomeric class I tRNA
           synthetase that catalyzes the specific glutaminylation
           of tRNA(Glu); N-terminal domain proposed to be involved
           in enzyme-tRNA interactions
          Length = 809

 Score =  224 bits (571), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 122/335 (36%), Positives = 192/335 (57%), Gaps = 10/335 (2%)

Query: 196 EAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDS 255
           E   G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +S
Sbjct: 246 EVTGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFES 305

Query: 256 ILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMREER---MDGI- 311
           I   +  LG K  KITYSSDYF E+Y     +IK+GKAY      E+++  R    DG  
Sbjct: 306 IKRMVSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTP 365

Query: 312 -----ASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNL 366
                A   RD+S+E+NL+ F  +M++G  +  +  +R K D  + +  + D + YR   
Sbjct: 366 GGERYACKHRDQSIEQNLQEF-RDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAYRVLN 424

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIW 426
            PH RTG+ W+IYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    
Sbjct: 425 APHPRTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQR 484

Query: 427 DFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPS 486
           ++ R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G +
Sbjct: 485 EYGRLNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVT 544

Query: 487 RNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
            +  N++     +  +K ++   PR   +++PV++
Sbjct: 545 TSTTNIQVVRFESAVRKYLEDTTPRLMFVLDPVEV 579

>KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6.51
           YOR168W
          Length = 799

 Score =  222 bits (565), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 120/335 (35%), Positives = 190/335 (56%), Gaps = 10/335 (2%)

Query: 196 EAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDS 255
           +A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +S
Sbjct: 245 KATAGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFES 304

Query: 256 ILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMREER---MDG-- 310
           I   +  LG +  KITYSSDYF ++Y+    +IK+GK Y      E++R  R    DG  
Sbjct: 305 IKRMVSWLGFEPWKITYSSDYFDKLYELAKVLIKNGKGYICHCTAEEIRRGRGIKEDGQP 364

Query: 311 ----IASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNL 366
                    R+ S+E+NL  F E MK G  +  +  +R K D+ + +  + D + YR   
Sbjct: 365 GGERFGCKHRENSIEKNLEEF-ENMKEGKYQPGEATLRMKQDFSSPSPQMWDLIAYRVLN 423

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIW 426
            PH RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    
Sbjct: 424 APHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQR 483

Query: 427 DFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPS 486
           ++ R+N   T+LSKRK+  +V++ +V  WDDPR  T        +    + +F+ + G +
Sbjct: 484 EYGRLNITGTILSKRKIAKLVEEKIVRGWDDPRLYTLEAIRRRGVPPGAILSFINTLGVT 543

Query: 487 RNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
            +V N++     +  +K ++   PR   +++P+++
Sbjct: 544 TSVTNIQAVRFESAIRKYLEETTPRLMFVLDPIEV 578

>ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 803

 Score =  220 bits (561), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 132/374 (35%), Positives = 200/374 (53%), Gaps = 27/374 (7%)

Query: 174 KKSANVGKKKETHKANFEIDL----------PE-------AKIGEVVTRFPPEPSGYLHI 216
           KK A  G K+      F  DL          PE       A  G V TRFPPEP+GYLHI
Sbjct: 206 KKDATAGPKRTMFSEGFLGDLHTVEDNPQNNPEHLVNHLKATHGLVHTRFPPEPNGYLHI 265

Query: 217 GHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDY 276
           GH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI+  ++ LG    KITYSSDY
Sbjct: 266 GHSKAIMVNFGYAKFHGGHCYLRFDDTNPEAEAPEYFESIIRMVNWLGFHPWKITYSSDY 325

Query: 277 FQEMYDYCIQMIKDGKAYCDDTPTEKMREER---MDGI------ASSRRDRSVEENLRIF 327
           F ++Y+   ++I  GK Y  +   E+++  R    DG       A   R RSVEENL  F
Sbjct: 326 FDQLYELAERLISKGKGYVCNCAAEEIKASRGIKPDGTPGGERHACKHRSRSVEENLTEF 385

Query: 328 TEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVP 387
             +MK+G  +  +  +R K D  + +  + D + YR    PH RTG+ W+IYPTYDF   
Sbjct: 386 -RKMKDGHYQPGEATLRMKQDLSSPSPQMWDLIAYRVLNAPHPRTGNKWRIYPTYDFTHC 444

Query: 388 IVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFARINFVRTLLSKRKLQWMV 447
           +VD+ E +TH+L T E+      Y+W+   + + +    ++ R+N   T+LSKRK+  +V
Sbjct: 445 LVDSFENITHSLCTTEFYLSRESYEWLCDQVDVFRPTQREYGRLNITGTVLSKRKIAKLV 504

Query: 448 DKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKIIDP 507
           D+  V  WDDPR  T        +    + +F+ + G + +V N++     +  +K ++ 
Sbjct: 505 DEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSVTNIQLVRFESAIRKYLED 564

Query: 508 IAPRHTAIVNPVKI 521
             PR   I++PV++
Sbjct: 565 TTPRLMFILDPVEV 578

>Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168W
           (REAL)
          Length = 809

 Score =  220 bits (561), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 120/335 (35%), Positives = 189/335 (56%), Gaps = 10/335 (2%)

Query: 196 EAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDS 255
           E   G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +S
Sbjct: 246 EVTGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYARYHNGTCYLRFDDTNPEKEAPEYFES 305

Query: 256 ILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREERMDG-- 310
           I   +  LG K  KITYSSDYF E+Y     +I +GK Y   C     ++ R  + DG  
Sbjct: 306 IKRMVSWLGFKPWKITYSSDYFDELYGLAEVLINNGKGYVCHCTGEEIKRSRGIKEDGTP 365

Query: 311 ----IASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNL 366
                A   RD+S+E NL+ F  +M++G  +  +  +R K D  + +  + D + YR   
Sbjct: 366 GGERFACKHRDQSIELNLKEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLN 424

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIW 426
            PH RTG+ WKIYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    
Sbjct: 425 APHPRTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQR 484

Query: 427 DFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPS 486
           ++ R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G +
Sbjct: 485 EYGRLNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVT 544

Query: 487 RNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
            +  N++     +  +K ++   PR   +++P+++
Sbjct: 545 TSTTNIQVIRFESAVRKYLEDTTPRLMFVLDPIEV 579

>Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168W
           (REAL)
          Length = 810

 Score =  219 bits (559), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 189/335 (56%), Gaps = 10/335 (2%)

Query: 196 EAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDS 255
           E   G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +S
Sbjct: 247 EVTGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFES 306

Query: 256 ILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMREER---MDG-- 310
           I   +  LG    KITYSSDYF E+Y     +IK+GK Y      E+++  R    DG  
Sbjct: 307 IKRMVSWLGFMPWKITYSSDYFDELYGLAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTP 366

Query: 311 ----IASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNL 366
                A   RD+S+E NL+ F  +M++G  +  +  +R K D  + +  + D + YR   
Sbjct: 367 GGQRFACKHRDQSIELNLQEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLN 425

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIW 426
            PH RTG+ WKIYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    
Sbjct: 426 APHPRTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQR 485

Query: 427 DFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPS 486
           ++ R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G +
Sbjct: 486 EYGRLNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVT 545

Query: 487 RNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
            +  N++     +  +K ++   PR   +++PV++
Sbjct: 546 TSTTNIQVVRFESAVRKYLEDTTPRLMFVLDPVEV 580

>TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.51
           YOR168W
          Length = 809

 Score =  218 bits (555), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 123/334 (36%), Positives = 189/334 (56%), Gaps = 10/334 (2%)

Query: 200 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G+  +RFDDTNP  E  E+ +SI   
Sbjct: 252 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNGGETYLRFDDTNPEAEAPEYFESIKRM 311

Query: 260 LDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMREER---MDG------ 310
           +  LG K  KITYSSDYF ++Y+    +IK GK Y     +E+++  R    DG      
Sbjct: 312 VSWLGFKPFKITYSSDYFDKLYELAEVLIKSGKGYVCHCTSEEVKAGRGIKEDGTPGGER 371

Query: 311 IASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 370
            A   RDRS+EE L  F  +M+NG  +  +  +R K D  + +  + D V YR    PH 
Sbjct: 372 FACKDRDRSIEETLDEF-RKMRNGFYKPGEATLRMKQDLSSPSPQMWDLVAYRVLNAPHP 430

Query: 371 RTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 431 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGR 490

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 491 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 550

Query: 491 NLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLE 524
           N++     +  +K ++   PR   +++PV++ L+
Sbjct: 551 NIQVVRFESAIRKYLEDSTPRLMFVLDPVEVVLD 584

>CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168w GLN4
          Length = 795

 Score =  216 bits (549), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 120/338 (35%), Positives = 192/338 (56%), Gaps = 10/338 (2%)

Query: 196 EAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDS 255
           +A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +S
Sbjct: 237 KATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFES 296

Query: 256 ILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMREER---MDGI- 311
           I   +  LG K  K+TYSSDYF ++Y+    +IK+GK Y      E+++  R    DG  
Sbjct: 297 IKRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTP 356

Query: 312 -----ASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNL 366
                A   RD+SVE+NL  F   M++G  +  +  +R K + ++ +  + D + YR   
Sbjct: 357 GGERHACKHRDQSVEKNLEEF-RAMRDGKYKPGEAILRMKQNLESPSPQMWDLIAYRVLN 415

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIW 426
            PH RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    
Sbjct: 416 APHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQR 475

Query: 427 DFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPS 486
           ++ R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G +
Sbjct: 476 EYGRLNITGTVLSKRKIAKLVDEHFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVT 535

Query: 487 RNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLE 524
            +  N++     +  +K ++   PR   I++P+++ +E
Sbjct: 536 TSTTNIQVVRFESAIRKYLEDSTPRLMMILDPIEVVVE 573

>KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.51
           YOR168W
          Length = 794

 Score =  215 bits (548), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 122/331 (36%), Positives = 184/331 (55%), Gaps = 10/331 (3%)

Query: 200 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + GK  +RFDDTNP  E  E+ +SI   
Sbjct: 247 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHFGGKCYLRFDDTNPEAEAPEYFESIKRM 306

Query: 260 LDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREERMDGI----- 311
           +  LG K  KITYSSDYF ++YD    +IK  K Y   C     ++ R  + DG      
Sbjct: 307 VSWLGFKPWKITYSSDYFDKLYDLAEFLIKSDKGYICHCTAEEIKRGRGIKEDGTPGGER 366

Query: 312 -ASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 370
            A + R R +EE+L  F  +MK+G  E  K  +R K D ++ N  + D + YR    PH 
Sbjct: 367 SACAHRSRPIEESLAEF-RKMKDGFYEPGKAILRMKQDLQSPNPQMWDLIAYRVLNAPHP 425

Query: 371 RTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG  W+IYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 426 RTGDKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 485

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 486 LNITGTILSKRKIAKLVELHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSDT 545

Query: 491 NLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
           N++        +K ++   PR   I++P++I
Sbjct: 546 NIQVARFETAVRKYLEETTPRLMFILDPIEI 576

>SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {ON}
           highly similar to uniprot|P13188 Saccharomyces
           cerevisiae YOR168W GLN4 Glutamine tRNA synthetase
           monomeric class I tRNA synthetase that catalyzes the
           specific glutaminylation of tRNA(Glu) N-terminal domain
           proposed to be involved in enzyme-tRNA interactions
          Length = 801

 Score =  215 bits (547), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 188/331 (56%), Gaps = 10/331 (3%)

Query: 200 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 246 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGVCYLRFDDTNPEAEAPEYFESIKRM 305

Query: 260 LDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMREER---MDG------ 310
           +  LG +  KITYSSDYF ++YD    +IK+GKAY      E+++  R    DG      
Sbjct: 306 VSWLGFEPWKITYSSDYFDKLYDLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 365

Query: 311 IASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 370
           +A   RDR +EENL  F  +M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 366 VACVHRDRPIEENLEEF-RKMRDGVYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 424

Query: 371 RTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG  WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 425 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 484

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V++ +V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 485 LNITGTVLSKRKIAKLVNEGIVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 544

Query: 491 NLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
           N++     +  +K ++    R   +++PV+I
Sbjct: 545 NIQVVRFESAIRKYLEDTTARLMFVLDPVEI 575

>NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6.51
           YOR168W
          Length = 814

 Score =  213 bits (543), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 118/331 (35%), Positives = 184/331 (55%), Gaps = 10/331 (3%)

Query: 200 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 255 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 314

Query: 260 LDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREERMDGI----- 311
           +  LG    KITYSSDYF ++YD    +I +GK Y   C     ++ R  + DG      
Sbjct: 315 VHWLGFTPWKITYSSDYFDKLYDLAELLINNGKGYICHCTAEEIKRGRGIKEDGTPGGER 374

Query: 312 -ASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 370
            A   RDR +EENL+ F   M++G  +  +  +R K D  + +  + D + YR     H 
Sbjct: 375 HACKHRDRPIEENLQEF-RNMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAAHP 433

Query: 371 RTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 434 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 493

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 494 LNITGTVLSKRKIAKLVDEKFVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 553

Query: 491 NLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
           N++     +  +K ++   PR   I++P+++
Sbjct: 554 NIQVVRFESAIRKYLEDTTPRLMFILDPIEV 584

>TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  212 bits (540), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 118/342 (34%), Positives = 189/342 (55%), Gaps = 10/342 (2%)

Query: 192 IDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEE 251
           I+  +A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E
Sbjct: 243 IEHLKATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYWNGVCYLRFDDTNPEAEAPE 302

Query: 252 FQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREERM 308
           + +SI   +  LG K  K+TYSSDYF ++Y+    +IK+ K Y   C     ++ R  + 
Sbjct: 303 YFESIQRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNDKGYICHCTAEEIKRGRGIKE 362

Query: 309 DGI------ASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362
           DG       A   RDR +EE+L+ F   M+ G  +  +  +R K D  + +  + D + Y
Sbjct: 363 DGTPGGERSACKHRDRPIEESLQEF-RNMREGKYQPGEAILRMKQDLTSPSPQMWDLIAY 421

Query: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
           R   +PH RTG  WKIYPTYDF   +VD+ E ++H+L T E+      Y+W+   + + +
Sbjct: 422 RVLNSPHPRTGDKWKIYPTYDFTHCLVDSFENISHSLCTTEFYLSRESYEWLCDQVHVFR 481

Query: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 482
               ++ R+N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ +
Sbjct: 482 PAQREYGRLNITGTVLSKRKIAKLVEGSYVRGWDDPRLYTLEAIRRRGIPPGAILSFINT 541

Query: 483 QGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLE 524
            G + +  N++     +  +K ++   PR   I++P+++ +E
Sbjct: 542 LGVTTSTTNIQVARFESAIRKFLEDTTPRLMFILDPIEVIVE 583

>Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {ON}
           complement(93063..95489) [2427 nt, 809 aa]
          Length = 808

 Score =  212 bits (539), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 116/331 (35%), Positives = 186/331 (56%), Gaps = 10/331 (3%)

Query: 200 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYWDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 260 LDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREERMDGI----- 311
           +  LG K  KITYSSDYF ++Y+    +I++ + Y   C     ++ R  + DG      
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEILIQNDRGYICHCTAEEIKRGRGIKEDGTPGGER 370

Query: 312 -ASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 370
            A   RDR VEE+L+ F   M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 SACKHRDRPVEESLKEF-RNMRDGVYQPGEATLRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 371 RTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTGS WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 430 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V+ + V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEGNYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 491 NLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
           N++     +  +K ++   PR   +++P+++
Sbjct: 550 NIQVVRFESAVRKFLEDTTPRLMFVLDPIEV 580

>TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  211 bits (538), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 115/331 (34%), Positives = 184/331 (55%), Gaps = 10/331 (3%)

Query: 200 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 260 LDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMREERM---------DG 310
           +  LG K  KITYSSDYF ++Y+    +I + K Y      E+++  R          D 
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGDR 370

Query: 311 IASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 370
            A   R+R +EENL+ F   M++G  +  +  +R K D  + +  + D + YR    PH 
Sbjct: 371 FACVHRNRPIEENLKEF-RSMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 371 RTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 549

Query: 491 NLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
           N++     +  +K ++   PR   I++P+++
Sbjct: 550 NIQVTRFESAIRKYLEDSTPRLMFILDPIEV 580

>Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W
           (REAL)
          Length = 821

 Score =  212 bits (539), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 117/335 (34%), Positives = 186/335 (55%), Gaps = 10/335 (2%)

Query: 196 EAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDS 255
           E   G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +S
Sbjct: 246 EVTGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGTCYLRFDDTNPEKEAPEYFES 305

Query: 256 ILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREERMDG-- 310
           I   +  LG +  KITYSSDYF E+Y     +I + K Y   C     ++ R  + DG  
Sbjct: 306 IKRMVSWLGFEPWKITYSSDYFDELYRLAEVLINNDKGYICHCTAEEIKRGRGIKEDGTP 365

Query: 311 ----IASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNL 366
                A   RD+ +E NL+ F   M++G  +  +  +R K D  + +  + D + YR   
Sbjct: 366 GGERFACKHRDQPIELNLQEF-RNMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLN 424

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIW 426
            PH RTG+ WKIYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    
Sbjct: 425 APHPRTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQR 484

Query: 427 DFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPS 486
           ++ R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G +
Sbjct: 485 EYGRLNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVT 544

Query: 487 RNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
            +  N++     +  +K ++   PR   +++P+++
Sbjct: 545 TSTTNIQVVRFESAIRKYLEDTTPRLMFVLDPIEV 579

>Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {ON}
           YOR168W (GLN4) - glutaminyl-tRNA synthetase [contig 185]
           FULL
          Length = 800

 Score =  211 bits (536), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 187/335 (55%), Gaps = 10/335 (2%)

Query: 196 EAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDS 255
           +A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +S
Sbjct: 241 KATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFES 300

Query: 256 ILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREERMDGI- 311
           I   +  LG K  KITYSSDYF ++Y+    +I + KAY   C     ++ R  + DG  
Sbjct: 301 IKNMVAWLGFKPWKITYSSDYFDKLYELAEVLISNSKAYVCHCSGEEIKRGRGIKEDGTP 360

Query: 312 -----ASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNL 366
                A   R RSVEENL  F  +M++G  +  +  +R K D ++ +  + D + YR   
Sbjct: 361 GGERRACVHRSRSVEENLTEF-RKMRDGHYKPGEAILRMKQDLESPSPQMWDLIAYRVLN 419

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIW 426
            PH RTG  WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    
Sbjct: 420 APHPRTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQR 479

Query: 427 DFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPS 486
           ++ R+N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G +
Sbjct: 480 EYGRLNITGTVLSKRKIAKLVNEHYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVT 539

Query: 487 RNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
            +  N++     +  +K ++   PR   I++PV++
Sbjct: 540 TSTTNIQVVRFESAIRKYLEDNTPRLMMILDPVEV 574

>AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR168W
           (GLN4)
          Length = 798

 Score =  209 bits (532), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 117/335 (34%), Positives = 186/335 (55%), Gaps = 10/335 (2%)

Query: 196 EAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDS 255
           +A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +S
Sbjct: 241 KATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHHGGVCYLRFDDTNPEAEAPEYFES 300

Query: 256 ILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMREER---MDG-- 310
           I   +  LG    KITYSSDYF ++Y+    +IK+GK Y      E++R  R    DG  
Sbjct: 301 IERMVAWLGFSPWKITYSSDYFDQLYELAEVLIKNGKGYICHCTAEEIRRGRGIKEDGTP 360

Query: 311 ----IASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNL 366
               +  + R+R +EENL  F   M++G     +  +R K D  + +  + D V YR   
Sbjct: 361 GGERLPCAHRERPIEENLAEF-RNMRDGKYAPGEAILRMKQDLSSPSPQMWDLVAYRVLN 419

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIW 426
            PH RTGS W+IYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    
Sbjct: 420 APHPRTGSKWRIYPTYDFTHCLVDSLENITHSLCTAEFYLSRESYEWLCDQVHVFRPAQR 479

Query: 427 DFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPS 486
           ++ R+N   T+LSKRK+  +V +  V  WDDPR  T        +    + +F+ + G +
Sbjct: 480 EYGRLNITGTVLSKRKIAKLVHEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVT 539

Query: 487 RNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
            +  N++     +  +K ++    R   +++P+++
Sbjct: 540 TSTTNIQVVRFESAIRKYLEDTTARLMFVLDPIEV 574

>KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 800

 Score =  209 bits (532), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 118/331 (35%), Positives = 186/331 (56%), Gaps = 10/331 (3%)

Query: 200 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 259
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKSM 304

Query: 260 LDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMREER---MDGI----- 311
           +  LG K  KITYSSDYF ++Y+   ++I +GKAY      E+++  R    DG      
Sbjct: 305 VSWLGFKPWKITYSSDYFDKLYELAEKLITNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 364

Query: 312 -ASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHH 370
            A   R RSVEENL  F  +M++G  +  +  +R K D ++ +  + D + YR     H 
Sbjct: 365 HACVHRGRSVEENLAEF-RKMRDGAYKPGEATLRMKQDLESPSPQMWDLIAYRVLNASHP 423

Query: 371 RTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFAR 430
           RTG  WKIYPTYDF   +VD+ E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 431 INFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 490
           +N   T+LSKRK+  +V++  V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTILSKRKIAKLVNEHYVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 491 NLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
           N++     +  +K ++   PR   +++PV++
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMVLDPVEV 574

>NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}
           Anc_6.51 YOR168W
          Length = 811

 Score =  209 bits (531), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 119/335 (35%), Positives = 184/335 (54%), Gaps = 10/335 (2%)

Query: 196 EAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDS 255
           +A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G  I+RFDDTNP  E  E+ +S
Sbjct: 250 KATGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNDGVCILRFDDTNPEAEAPEYFES 309

Query: 256 ILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREERMDGI- 311
           I   +  LG    KITYSSDYF ++YD    +I + + Y   C     ++ R  + DG  
Sbjct: 310 IKRMVSWLGFVPWKITYSSDYFDKLYDLAEVLINNDRGYICHCTAEEIKRGRGIKEDGTP 369

Query: 312 -----ASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNL 366
                A   R  S+E NL+ F   M++G  +  +  +R K D  + +  + D + YR   
Sbjct: 370 GGERSACVHRSNSIETNLKEF-RNMRDGVYKPGEATLRMKQDLTSPSPQMWDLIAYRVLN 428

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIW 426
            PH RTG+ WKIYPTYDF   +VD+ E +TH+L T E+R     Y+W+   + + +    
Sbjct: 429 APHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFRLSRESYEWLCDQVHVFRPAQR 488

Query: 427 DFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPS 486
           ++ R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G +
Sbjct: 489 EYGRLNITGTVLSKRKIAKLVDEHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVT 548

Query: 487 RNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
            +  N++        +K ++   PR   I++P++I
Sbjct: 549 TSTTNIQVARFENSIRKYLEDSTPRLMFILDPIEI 583

>Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar to
           Ashbya gossypii AGR259C
          Length = 804

 Score =  208 bits (529), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 121/352 (34%), Positives = 193/352 (54%), Gaps = 11/352 (3%)

Query: 179 VGKKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII 238
           VG+  + +    E  L +A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +
Sbjct: 231 VGENPQAYPELMEEHL-KATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGICYL 289

Query: 239 RFDDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAY---C 295
           RFDDTNP  E  E+ +SI   +  LG K  KITYSSDYF ++YD    +I++ K Y   C
Sbjct: 290 RFDDTNPEAEAPEYFESIERMVTWLGFKPWKITYSSDYFDQLYDLAEVLIQNNKGYVCHC 349

Query: 296 DDTPTEKMREERMDGI------ASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDY 349
                ++ R  + DG       + S R+RS+ ENL  F  +M++G  +  +  +R K D 
Sbjct: 350 TGEEIKRGRGIKEDGTPGGERKSCSHRERSITENLAAF-RKMRDGFYKPGEAILRMKQDL 408

Query: 350 KALNKTLRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNA 409
            + +  + D + YR    PH RTGS WKIYPTYDF   +VD+ E +TH+L T E+     
Sbjct: 409 NSPSPQMWDLIAYRVLDAPHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRE 468

Query: 410 QYDWMLQALRLRKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXX 469
            Y+W+   + + +    ++ R+N   T+LSKRK+  +V++  V  WDDPR  T       
Sbjct: 469 SYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIARLVNEKYVRGWDDPRLFTLEAIRRR 528

Query: 470 XMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKI 521
            +    + +F+ + G +    N++     +  +K ++    R   +++P+++
Sbjct: 529 GIPPGAILSFINTLGVTTTTTNIQVVRFESAIRKYLEDTTARLMFLLDPIEV 580

>KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 804

 Score =  206 bits (525), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 117/325 (36%), Positives = 179/325 (55%), Gaps = 10/325 (3%)

Query: 196 EAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDS 255
           +A  G+V TRFPPEP+GYLHIGH+KA ++N  FA+ + G   +RFDDTNP  E  E+ +S
Sbjct: 245 KATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGFAKYHNGVCYLRFDDTNPEAEAPEYFES 304

Query: 256 ILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREERMDGI- 311
           I   +  LG K  K TYSSDYF E+Y     +IK+GKAY   C     ++ R  + DG  
Sbjct: 305 IKSMVSWLGFKPWKTTYSSDYFDELYQLAETLIKNGKAYVCHCSAEEIKRGRGIKEDGTP 364

Query: 312 -----ASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNL 366
                A   R+R +EE+L  F  +M++G  +  +  +R K D  + +  + D + YR   
Sbjct: 365 GGERKACVSRERPIEESLTEF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLD 423

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIW 426
            PH RTG  WKIYPTYDF   +VD++E +TH+L T E+      Y+W+   + + +    
Sbjct: 424 APHPRTGDKWKIYPTYDFTHCLVDSLENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQR 483

Query: 427 DFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPS 486
           ++ R+N   T+LSKRK+  +V    V  W+DPR  T        +    + +F+ + G +
Sbjct: 484 EYGRLNITGTVLSKRKIAKLVTGGYVSGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVT 543

Query: 487 RNVINLEWNLIWAFNKKIIDPIAPR 511
            +  N++     +  +K ++   PR
Sbjct: 544 TSTTNIQVVRFESAIRKYLEDTTPR 568

>KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON}
           Anc_7.100 YOL033W
          Length = 517

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 104/232 (44%), Gaps = 26/232 (11%)

Query: 199 IGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILE 258
           +  VVTRF P P+G LH+G  + AL N   A+   GK I+R +DT+  +   E + +IL+
Sbjct: 38  VAPVVTRFAPSPTGLLHLGSLRTALYNYLLAKNTGGKFILRLEDTDRKRYHAEAEQNILD 97

Query: 259 DLDLLGIKGDKITY-SSDYFQE-MYD-YCIQMIKDGKAY---CDDTPTEKMREERMDGIA 312
            LD   IK D   Y  SD  +E +Y  Y  Q++K G AY   C       +REE  D   
Sbjct: 98  TLDWCHIKWDGPMYRQSDRAREGLYTRYAEQLVKGGFAYKCFCSKERLNNLREEGYDRHC 157

Query: 313 SSRRDRSVEE------NLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNL 366
           +   D+ V         +R    E+ +  ++ L   VR  I  +       DPV+ + + 
Sbjct: 158 THLSDQEVNAFQGTPYVIRFKAPEVYDAVDDLLHGSVR--IQPRRDRHGFDDPVLLKSDR 215

Query: 367 TPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQAL 418
                       +PTY     + D + GVTH +R  E+     ++  M +A 
Sbjct: 216 ------------FPTYHLANVVDDHLMGVTHVIRGEEWLPSTPKHIAMYKAF 255

>NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON}
           Anc_7.100 YOL033W
          Length = 529

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 87/353 (24%), Positives = 142/353 (40%), Gaps = 70/353 (19%)

Query: 203 VTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDL 262
           +TRF P P+G LH+G  + AL N   A++  GK I+R +DT+ S+   E   +I E L  
Sbjct: 43  ITRFAPSPTGLLHLGSLRTALYNYLLARSTNGKFILRLEDTDQSRIHPEAISNIYETLKW 102

Query: 263 LGIKGDK-ITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREERMDGIASSRRDR 318
            GI  D+     SD     + Y   ++  G AY   C     E++R +  +   S   DR
Sbjct: 103 CGINYDEGFIKQSDRLPIYHKYIKILLDSGAAYHCFCTKDRLEQLRRKNSNTPNSPSYDR 162

Query: 319 S--------VEENLRI---FTEEMKNGTE-EGLKNCVRAKIDYKALNKTLR-----DPVI 361
           +        VE NL     +T  +K+        + +  ++D + LN+  R     DP++
Sbjct: 163 NCYHLDTEIVESNLTANLPYTIRLKSPDRYPPFTDLLHGQVDIQ-LNQKERGVWFDDPIL 221

Query: 362 YRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLR 421
            + +             YPTY F   + D + G+TH +R  E+     ++  + Q     
Sbjct: 222 IKSD------------GYPTYHFANVVDDHLMGITHVIRGEEWLPSTPKHVALYQLFG-- 267

Query: 422 KVHIWDFARINFVRTL-------LSKRKLQW--------------MVDKDLVGNWDDPRF 460
               WD  +   +  L       LSKRK  +              +V+   +  W  PR 
Sbjct: 268 ----WDMPKFIHIPLLTSIDDKKLSKRKGDFSVLSLKEKGVLPEALVNFCALLGWSPPRD 323

Query: 461 PTXXXXXXXXMT-VEGLRNFVLSQGPSRNVINLEWNLIWAFNK-----KIIDP 507
                     M  +E L N       ++  + +++  +W FNK     KI DP
Sbjct: 324 IAKANHECFTMNEIEKLFNL---NHLTKGNVKVDYKKLWFFNKHFLREKIKDP 373

>NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}
           Anc_7.100 YOL033W
          Length = 527

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/336 (23%), Positives = 139/336 (41%), Gaps = 51/336 (15%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V+TRF P P+G LH+G  + AL N   A+   GK I+R +DT+ ++   E   +I + L 
Sbjct: 46  VITRFAPSPTGLLHLGSLRTALYNYLLAKNTNGKFILRLEDTDQTRLHPEALKNIFDTLK 105

Query: 262 LLGIKGDKITYSSDYFQEMY-DYCIQMIKDGKAYCDDTPTEKMREERMDGIA--SSRRDR 318
              ++ D+          +Y +Y  +++K G AY      E++ + R   +A  S   DR
Sbjct: 106 WCNMEYDEGPIEQSQRLPIYQEYIKKLLKSGHAYYCFCSRERLEQLRTGNMAPGSLSYDR 165

Query: 319 SVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY-----RCNLTPHHRTG 373
                + +  E +K   ++G+   +R K          R P+I+       N+ P++R G
Sbjct: 166 KC---IHLDEETIKVNLDKGIPYTIRMK-------SPERYPLIHDLLHGELNIQPNNREG 215

Query: 374 STW---------KIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVH 424
             W           +PTY F   + D +  VTH +R  E+     ++  + Q        
Sbjct: 216 -MWFDDPILIKSDGFPTYHFANVVDDHLMKVTHVIRGEEWLPSTPKHVALYQYFGWA--- 271

Query: 425 IWDFARINFVRTL----LSKR---------KLQWMVDKDLVG-----NWDDPRFPTXXXX 466
           I  F  I  + ++    LSKR         K Q ++ + L+       W  PR       
Sbjct: 272 IPKFIHIPLLTSIDDKKLSKRKGDFSVFGLKEQGILPEALINFCALLGWSPPR--NVAQE 329

Query: 467 XXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK 502
                T++ L         ++  + +++  +W FNK
Sbjct: 330 THECFTLDELERLFNLNHLTKGNVKVDYKKLWFFNK 365

>TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {ON}
           Anc_7.100 YOL033W
          Length = 558

 Score = 67.0 bits (162), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 125/275 (45%), Gaps = 48/275 (17%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G++H+G  + AL N   A++  G+ ++R +DT+  +  E  ++ I E L 
Sbjct: 46  VRTRFAPSPTGFMHLGSLRTALYNYLLAKSTGGQFLLRLEDTDQKRLVEGAEEDIYETLK 105

Query: 262 LLGIKGDK-ITYSSDYF--------QEMYDYCIQ-MIKDGKAY---CDDTPTEKMRE--E 306
             GI+ D+    +S+ +         ++Y   I+ ++++G AY   C     ++M+E  +
Sbjct: 106 WCGIEYDEGPNVNSEAYGPFRQSERTKIYAKHIKVLLENGDAYKCFCTKERLDEMKESAQ 165

Query: 307 RMDGIASSRRDRSV----EE------------NLRIFTEEMKNGTEEGLKNCVRAKIDYK 350
           +++  +S+  DR      EE             +R+ + E     E+ L   +  +I Y 
Sbjct: 166 KLNPPSSASYDRHCLHLNEEEIKQKELLNSPYTIRLKSPEKYPEFEDLLHGKLSIQIQYN 225

Query: 351 ALNKTLRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQ 410
              KT  DP++ + +              PTY F   + D +  +TH +R  E+     +
Sbjct: 226 PHKKTYDDPILIKSD------------GLPTYHFANVVDDHLMKITHVIRGEEWLPSTPK 273

Query: 411 YDWMLQAL---RLRKVHIWDFARINFVRTLLSKRK 442
           +  M  AL     + +HI     IN  +  LSKRK
Sbjct: 274 HISMYNALGWQAPKYIHIPLLTSINDKK--LSKRK 306

>TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {ON}
           Anc_7.100 YOL033W
          Length = 531

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 123/279 (44%), Gaps = 56/279 (20%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+  +  +  +++I   L 
Sbjct: 44  VRTRFAPSPTGSLHLGSLRTALYNYLLARNTGGQFILRIEDTDQKRLVKGAEENIYSSLK 103

Query: 262 LLGIKGD-------------KITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMRE 305
            LG++ D             K +  S  +Q+   Y  +++ +GKAY   C       ++E
Sbjct: 104 WLGLQFDEGPNGINGPYGPYKQSERSSIYQK---YINELLDNGKAYRCFCSKERLTGLKE 160

Query: 306 --ERMDGIASSRRDR--------SVEENL--------RIFTEEMKNGTEEGLKNCVRAKI 347
             +++    ++  DR         +EENL        R+ + ++    E+ L   +  + 
Sbjct: 161 SAQKLKPPTTASYDRKCTNLTKSQIEENLKNKVPYTVRLLSPDLYPAFEDLLHGKLNIQP 220

Query: 348 DYKALNKTLRDPVIYRC-NLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRD 406
            Y ++++   DPV+ +  NL             PTY F   + D +  ++H +R  E+  
Sbjct: 221 QYNSIDRRFDDPVLMKSDNL-------------PTYHFANVVDDHLMKISHVIRGEEWLP 267

Query: 407 RNAQYDWMLQALRLRK---VHIWDFARINFVRTLLSKRK 442
              ++  + +A   +    +HI     +N  +  LSKRK
Sbjct: 268 STPKHIAIYEAFGWKPPKYIHIPLLTTLNDKK--LSKRK 304

>YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}
           MSE1Mitochondrial glutamyl-tRNA synthetase, predicted to
           be palmitoylated
          Length = 536

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 97/220 (44%), Gaps = 24/220 (10%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +  E  +++I E L 
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILK 104

Query: 262 LLGIKGDKITYSSDYFQEMYD-YCIQMIKDGKAYCDDTPTEKMREERMDGI-----ASSR 315
              I  D+        + +YD Y   ++  GKAY      E++ + R   +     + + 
Sbjct: 105 WCNINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 316 RDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHHRTGST 375
            DR       +  EE+K+   +G+   VR K   +    T  D +  + NL P  +    
Sbjct: 165 YDRCCAH---LGEEEIKSKLAQGIPFTVRFKSPERY--PTFTDLLHGQINLQP--QVNFN 217

Query: 376 WKIY-----------PTYDFCVPIVDAVEGVTHALRTIEY 404
            K Y           PTY     + D + G+TH +R  E+
Sbjct: 218 DKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEW 257

>CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033w MSE1
          Length = 532

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 71/339 (20%), Positives = 137/339 (40%), Gaps = 47/339 (13%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
            VTRF P P+G LH+G  + AL N   A+   GK I+R +DT+ S+ K+   D+I   L 
Sbjct: 46  AVTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYNSLK 105

Query: 262 LLGIKGDKITY----SSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMREERMDGIASSRRD 317
              +K D+  Y     +D +++  ++ I+  +  + +C     + +R+  +  +  +  +
Sbjct: 106 WCNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCTKERLDDLRQSALRLVPPT--N 163

Query: 318 RSVEENLRIFTE-EMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHHRTGSTW 376
            S + +    +E E+K+  ++G+   VR K   K       D +  + +L P        
Sbjct: 164 VSYDRHCAHLSEGEIKSKLDQGIPFTVRFKAPEKY--PPFEDLLHGKIDLQPQQNPSDIR 221

Query: 377 ---------KIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWD 427
                      YPTY     I D    ++H +R  E+     ++  + +A        W+
Sbjct: 222 YDDPILMKSDNYPTYHLANVIDDHDMKISHVIRGEEWLPSTPKHIALYEAFG------WE 275

Query: 428 ---FARINFVRTL----LSKRK--------------LQWMVDKDLVGNWDDPRFPTXXXX 466
              F  +  + T     LSKR+               + +V+  ++  W  PR       
Sbjct: 276 PPKFTHLPLLTTTEDKKLSKRRNDMSVMSLKEQGILPEALVNFSVLFGWSPPR--ELASK 333

Query: 467 XXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKII 505
                T++   N       ++    ++   +W FNK+ +
Sbjct: 334 NHECFTLQEFENLFDLDSLTKGNAKVDMKKLWFFNKQFL 372

>Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {ON}
           complement(21668..23278) [1611 nt, 537 aa]
          Length = 536

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 100/228 (43%), Gaps = 25/228 (10%)

Query: 199 IGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILE 258
           I  V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +  ++ +++I E
Sbjct: 38  ISPVRTRFAPSPTGFLHLGSLRTALYNYLLAKNTGGQFLLRLEDTDRKRLVKDAEENIYE 97

Query: 259 DLDLLGIKGDKITYS----------SDYFQEMYDYCIQMIKDGKAYCDDTPTEKM----- 303
            L   GI  D+   S          SD  +    Y  +++ +G AY    P E++     
Sbjct: 98  SLKWCGIDYDEGPNSQNQQFGPYRQSDRTKIYQKYIDKLLDNGHAYRCFCPKERLDSLRD 157

Query: 304 REERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKID--YKALNKTLRDPVI 361
             +++    +   DR+    L +  +E++N    G+   VR K    Y   +  L   + 
Sbjct: 158 SAQKLQPPTTVSYDRNC---LHLNHDEIQNNINNGVSYTVRMKSPEIYPPFDDLLHGHIN 214

Query: 362 YRCNLTPHHRTGSTWKIY-----PTYDFCVPIVDAVEGVTHALRTIEY 404
            +  +  + R      +      PTY F   I D +  +TH +R  E+
Sbjct: 215 IQPQINSNDRRYDDPILMKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {ON}
           Anc_7.100 YOL033W
          Length = 514

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 95/231 (41%), Gaps = 27/231 (11%)

Query: 201 EVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDL 260
            VVTRF P P+G LHIG  + AL N   A++  GK I+R +DT+ ++ K   +  I + L
Sbjct: 39  RVVTRFAPSPTGLLHIGSLRTALYNFLLARSTNGKFILRIEDTDRTRLKSGAEQDICDIL 98

Query: 261 DLLGIKGD-KITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREERMDGIASSRR 316
           +   +K D      SD      +Y  ++++ G AY   C       MR    D       
Sbjct: 99  NWCNLKYDVGPIRQSDRIPIYEEYANKLLETGAAYRCFCTKDRLSTMRAHGYDRHCLHLS 158

Query: 317 DRSVEE---------NLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLT 367
           D  V            LR+ +    +  ++ L   V   I  +       DP++ + +  
Sbjct: 159 DNDVRRLFDAGHTRPVLRLKSPNKYDSFQDMLHGTV--NIQERKDRVGFDDPILMKSD-- 214

Query: 368 PHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQAL 418
                      +PTY F   + D +  VTH +R  E+     ++  + +AL
Sbjct: 215 ----------GFPTYHFANVVDDHLMEVTHVIRGDEWLPSTPKHIALYKAL 255

>Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 79/348 (22%), Positives = 136/348 (39%), Gaps = 54/348 (15%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G+LH+G  + AL N   A+  KG+ ++R +DT+  +     +++I E L 
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTKGQFLLRLEDTDQKRLVPGAEENIYEVLK 104

Query: 262 LLGIKGDKITYSSDYFQEMYD-YCIQMIKDGKAYCDDTPTEKMREERMDGI-----ASSR 315
              I  D+        + +YD Y   ++  G AY      E++ + R   +     + + 
Sbjct: 105 WCKISYDETPVKQSERKSVYDKYVKILLSSGMAYRCFCSKERLNDLRRSAMELKPPSMAS 164

Query: 316 RDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPH-----H 370
            DR       +  EE+++   + +   VR K   +    T  D +    NL P       
Sbjct: 165 YDRCCAH---LAKEEIESKLAQDMPFTVRFKSPEQY--PTFTDVLHGEINLQPQVNYNDR 219

Query: 371 RTGSTWKI----YPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIW 426
           R      +     PTY     + D + G+TH +R  E+     ++  +  A        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 427 DFARINFVRTL-------LSKRKL---------QWMVDKDLVG-----NWDDPRFPTXXX 465
           D+ +   +  L       LSKRK          Q ++ + LV       W  PR      
Sbjct: 274 DYPKFIHIPLLTTVGDKKLSKRKGDMSISSLKNQGILPEALVNFCALFGWSPPR--DLAS 331

Query: 466 XXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK-----KIIDPI 508
                 ++E L       G ++    ++   +W FNK     +I DP+
Sbjct: 332 KKHECFSMEDLEKLFNLNGLTKGNAKVDDKKLWFFNKHFLQERISDPV 379

>Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033W
           (REAL)
          Length = 532

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 127/321 (39%), Gaps = 50/321 (15%)

Query: 144 VNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVGKKKETHKANFEIDLPEAKIGEVV 203
           + + R +  L + P  G     L+KSL   K       K++ H ++            V 
Sbjct: 4   LRIPRRFYCLSLKPTKGVGPSSLNKSLLSRKT------KEDIHPSS-----------PVR 46

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDLL 263
           TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     +++I + L   
Sbjct: 47  TRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIPGAEENIYDVLKWC 106

Query: 264 GIKGDKITYSSDYFQEMYD-YCIQMIKDGKAYCDDTPTEKMREERMDGI-----ASSRRD 317
            I  D+        + +YD Y   ++  G AY      E++ E R   +     + +  D
Sbjct: 107 KINYDETAVKQSERKPIYDKYVKILLSSGMAYRCFCSKERLNELRRSAMELKPPSMASYD 166

Query: 318 RSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPH-----HRT 372
           R       +  EE+ +   +G+   VR K   K       D +    NL P       R 
Sbjct: 167 RCCS---YLGEEEVNSKLSQGMPFTVRFKSPEKY--PLFADLLHGEINLQPQVNFNDRRY 221

Query: 373 GSTWKI----YPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWD- 427
                +     PTY     + D + G+TH +R  E+     ++  +  A        WD 
Sbjct: 222 DDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------WDC 275

Query: 428 --FARINFVRTL----LSKRK 442
             F  I  + T+    LSKRK
Sbjct: 276 PKFIHIPLLTTVGDKKLSKRK 296

>Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AEL338C
          Length = 573

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 96/231 (41%), Gaps = 42/231 (18%)

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDLL 263
           TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+ ++     + ++ +    L
Sbjct: 62  TRFAPSPTGFLHLGSLRTALFNYLLAKKTGGQFLLRLEDTDRTRLVPGSEQNLYDSFKWL 121

Query: 264 GIKGDK-----ITY----SSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMREERMDGIA-- 312
           GI+ D+      TY     SD  +    Y  Q+I  G AY      E+++  R   +A  
Sbjct: 122 GIQYDEGPGVNETYGPYRQSDRTEIYKKYSDQLISTGHAYRCFCSKERLKGLRDSAMALK 181

Query: 313 -------------------SSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALN 353
                               S+    V   +R+ + E+    E+ L N +  +     ++
Sbjct: 182 PPTNVTYDRHCAKLSKEDIRSKIKMGVPYTIRLKSPEIYEPFEDLLHNEINLQPQINPID 241

Query: 354 KTLRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEY 404
               DP++ +        +G      PTY F   I D +  +TH +R  E+
Sbjct: 242 VRYDDPILIKS-------SG-----LPTYHFAHVIDDHLMEITHVIRGQEW 280

>TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.100
           YOL033W
          Length = 534

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 102/225 (45%), Gaps = 25/225 (11%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G LHIG  + AL N   A+  +G+ ++R +DT+ ++  +  +++I + L 
Sbjct: 41  VRTRFAPSPTGMLHIGSLRTALYNYLLAKNTRGQFLLRLEDTDQNRLIQGAEENIYDSLK 100

Query: 262 LLGIKGDKITYSSD-----YFQ----EMYDYCIQ-MIKDGKAY---CDDTPTEKMRE--E 306
             GI+ D+    +D     Y Q    E+Y   +  ++K G AY   C     + +RE  +
Sbjct: 101 WCGIEYDEGPGVNDEKFGPYRQSERTEIYQQHVDGLLKSGHAYRCFCSKERLDGLRESAK 160

Query: 307 RMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKID--YKALNKTLRDPVIYRC 364
           R+    +   DR  E    +   E++    + + + +R K    Y A +  L   V  + 
Sbjct: 161 RLKPPTTVTYDRKCES---LSQGEIEERLAQQIPHTIRLKAPERYPAFHDLLHGTVDIQP 217

Query: 365 NLTPHHRTGSTWKI-----YPTYDFCVPIVDAVEGVTHALRTIEY 404
            +  + R      +      PTY F   I D +  +TH +R  E+
Sbjct: 218 QVNVNDRRYDDPILIKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 542

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 113/276 (40%), Gaps = 51/276 (18%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     + S+ + L 
Sbjct: 51  VRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAEQSLYDALK 110

Query: 262 LLGIKGDK---------ITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREE--- 306
              IK D+             SD  +   +Y   +++ G AY   C     + +RE    
Sbjct: 111 WCNIKYDEGPGVNEIYGPYRQSDRTKIYQEYINTLVEKGDAYKCFCSKERLDALRESAQK 170

Query: 307 -------RMDGIASSRRDRSVEENLRI---FTEEMKNGTE-EGLKNCVRAKIDYK----A 351
                    D   S   D+ VE NL+    FT   K+  +    ++ +  K+D +     
Sbjct: 171 LQPPTTVSYDRHCSKLSDQEVEANLKAGIPFTVRFKSPDKYPPFEDLLHGKLDIQPQVNP 230

Query: 352 LNKTLRDPVIYRC-NLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQ 410
           L+    DP++ +  NL             PTY F   I D +  +TH +R  E+     +
Sbjct: 231 LDIRYDDPILMKSDNL-------------PTYHFANVIDDHLMKITHVIRGEEWLPSTPK 277

Query: 411 YDWMLQALRLRKVHIWDFARINFVRTL----LSKRK 442
           +  + +A      H   +  I  + T     LSKRK
Sbjct: 278 HTALYEAYGWTPPH---YVHIPLLTTTSDKKLSKRK 310

>SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} similar
           to uniprot|P48525 Saccharomyces cerevisiae YOL033W MSE1
           Mitochondrial glutamyl-tRNA synthetase encoded by a
           nuclear gene
          Length = 554

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 75/169 (44%), Gaps = 24/169 (14%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G LH+G  + AL N   A++  G+ ++R +DT+  +     + +I + L 
Sbjct: 61  VRTRFAPSPTGLLHMGSLRTALYNYLLARSTGGQFLLRLEDTDQKRLVPGAEQNIYDSLK 120

Query: 262 LLGIKGDK---------ITYSSDYFQEMYDYCI-QMIKDGKAY---CDDTPTEKMREERM 308
             G++ D+           Y      E+Y + I Q++  G AY   C         +ER+
Sbjct: 121 WCGVEYDEGPGVNEDKFGPYRQSDRTEIYQHYIKQLLNSGHAYRCFCS--------KERL 172

Query: 309 DGIASSRRDRSVEENL---RIFTEEMKNGTEEGLKNCVRAKIDYKALNK 354
           DG+ SS +           R  TE  ++   E LK  V   +  KA  K
Sbjct: 173 DGLRSSAQQLQPPTTASYDRHCTELTEDEIAENLKKGVPCTVRLKAPKK 221

>AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL033W
           (MSE1)
          Length = 533

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 94/232 (40%), Gaps = 44/232 (18%)

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDLL 263
           TRF P P+GYLH+G  + AL N   A+   G+ ++R +DT+  +   + + +I + L  L
Sbjct: 45  TRFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQWL 104

Query: 264 GIKGDK---------ITYSSDYFQEMYDYCIQMIKDGKAY---CDDTPTEKMREERM--- 308
           GI+ D+             SD       +  +++  G AY   C     E +R   M   
Sbjct: 105 GIQFDEGPGVNEVYGPYRQSDRSAIYKAHADKLLASGHAYRCFCSKERLENLRTSAMALQ 164

Query: 309 -----------DGIASSRRDRSVEENLRIFTEEMKN-GTEEGLKNCVRAKIDYKALNKT- 355
                        ++    D  +++N+  FT   K+    E  ++ +  ++D +      
Sbjct: 165 PPTNVSYDRECANLSQEHIDHKLDQNVP-FTLRFKSPAVYEPFEDLLHGRVDLQPQTNPN 223

Query: 356 ---LRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEY 404
                DPV+ + +              PTY F   + D +  +TH +R  E+
Sbjct: 224 DIRYDDPVLMKSD------------GLPTYHFANVVDDHLMKITHVIRGEEW 263

>Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 78/344 (22%), Positives = 131/344 (38%), Gaps = 57/344 (16%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G LH+G  + AL N   A+   G+ ++R +DT+  +     +  I + L+
Sbjct: 45  VRTRFAPSPTGLLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVPGAEKDIYDVLN 104

Query: 262 LLGIKGDKITYSSDYFQEMYD-YCIQMIKDGKAYCDDTPTEKMREERMDGI-----ASSR 315
              I+ D+        + +YD Y   ++  G AY      E++ + R   +     + + 
Sbjct: 105 WCKIEYDETVVRQSERKLVYDKYVKILLSSGMAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 316 RDRSVEENLRIFTEEMKNGTEEGLKNCVRAKI--DYKALNKTLRDPVIYRCNLTPHHRTG 373
            DR       +  EE+ +   +G+   VR K    Y      L   V    NL P  +  
Sbjct: 165 YDRCCAH---LKEEEINSNLTQGIPFTVRFKSPEQYPVFTDLLHGEV----NLQP--QVN 215

Query: 374 STWKIY-----------PTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422
              K Y           PTY     + D + G+TH +R  E+     ++  +  A     
Sbjct: 216 FNDKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG--- 272

Query: 423 VHIW---DFARINFVRTL----LSKR---------KLQWMVDKDLVG-----NWDDPRFP 461
              W    F  I  + T+    LSKR         K Q ++ + L+       W  PR  
Sbjct: 273 ---WVCPKFIHIPLLTTVGDKKLSKRKGDMSISSLKKQGVLPEALINFCALFGWSPPR-- 327

Query: 462 TXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKII 505
                     ++E L N     G ++    ++   +W FNK  +
Sbjct: 328 DLASKRHECFSMEELENLFNLNGLTKGNAKVDDKKLWFFNKHFL 371

>KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 546

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 95/226 (42%), Gaps = 31/226 (13%)

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDLL 263
           TRF P P+G LHIG  + AL N   A++  G  ++R +DT+ ++     + +I E L   
Sbjct: 47  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLSWC 106

Query: 264 GIKGDKIT----------YSSDYFQEMYDYCIQMIKDGKAY-CDDTPTEKMREERMDGIA 312
           GI  D+              SD  +    Y  +++  G AY C  T      +ER+DG+ 
Sbjct: 107 GIHYDEGPGVNDKKNGPFRQSDRTEIYQQYTNKLLDSGHAYRCFCT------KERLDGLR 160

Query: 313 SSRRD------RSVEENLRIFTE-EMKNGTEEGLKNCVRAKID--YKALNKTLRDPVIYR 363
            S +        S + +    +E E++   ++ +   +R K    Y      L   +  +
Sbjct: 161 ESAQKLQPPTTASYDRHCSHLSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQ 220

Query: 364 CNLTPHHRTGSTWKI-----YPTYDFCVPIVDAVEGVTHALRTIEY 404
             + P+ R      +      PTY F   + D +  +TH +R  E+
Sbjct: 221 PQVNPNDRRYDDPILVKSDALPTYHFANVVDDHLMDITHVVRGEEW 266

>ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 533

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 9/115 (7%)

Query: 202 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLD 261
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+ S+  E  +++I + L 
Sbjct: 40  VRTRFAPSPTGLLHMGSLRTALYNYLLAKNTGGQFILRLEDTDQSRLVEGAEENIYDSLR 99

Query: 262 LLGIKGDK--------ITYSSDYFQEMY-DYCIQMIKDGKAYCDDTPTEKMREER 307
              +  D+          Y      E+Y  Y   +++ G AY    P E++ + R
Sbjct: 100 WCKLHYDEGPMVGGPFGPYRQSERTEIYRSYIGTLLESGHAYRCFCPKERLEDLR 154

>Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {ON}
           YOL033W (MSE1) - Mitochondrial glutamyl-tRNA synthetase
           [contig 47] FULL
          Length = 567

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 92/223 (41%), Gaps = 25/223 (11%)

Query: 204 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLDLL 263
           TRF P P+G LHIG  + AL N   A++  G+ ++R +DT+  +     ++SI E L   
Sbjct: 54  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGEFLLRLEDTDQKRLVPGAEESIYESLKWC 113

Query: 264 GIKGDKIT----------YSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKM-----REERM 308
           G+  D+              SD  +    Y  +++  G AY    P E++       +++
Sbjct: 114 GLSFDEGPGVNDAEFGPFRQSDRTKIYQSYINKLLDLGVAYRCFCPKERLDNLRDSAQKL 173

Query: 309 DGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKI--DYKALNKTLRDPVIYRCNL 366
               +   DR    +    TE+++   ++ +   VR K    Y      L   +  +  +
Sbjct: 174 QPPTTVSYDRHCAHH---STEKIQEQLDQKIPFTVRLKSPQKYPPFEDLLHGSIDMQPQV 230

Query: 367 TPHHRTGSTWKIY-----PTYDFCVPIVDAVEGVTHALRTIEY 404
            P+        +      PTY F   + D +  +TH +R  E+
Sbjct: 231 NPNDMRYDDPILMKSDGLPTYHFANVVDDHLMKITHVVRGEEW 273

>Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {ON}
           YLR382C (REAL)
          Length = 895

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 173 LKKSANVGKK--KETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQ 230
           +KK   +GKK  ++T +   E D P+     ++ +FP  PSG LHIGH +  +++    +
Sbjct: 21  VKKLIAIGKKWKQKTIRGPIEHDTPKKGSKYILCQFP-YPSGALHIGHLRVYVISDSLNR 79

Query: 231 AYKGK 235
            YK +
Sbjct: 80  FYKQR 84

>NDAI0J01730 Chr10 complement(421402..426042) [4641 bp, 1546 aa]
           {ON} Anc_4.136 YLR320W
          Length = 1546

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 9/88 (10%)

Query: 378 IYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVHIWDFARI--NFVR 435
           ++ +Y   V IV  ++   H    +E +  ++Q   ++  L   +  IW   RI  +F+ 
Sbjct: 786 LFESYHILVTIVQLLDRKQHLWEALEKQSYSSQIALIILNLFPTRKTIWSLLRIEPSFIS 845

Query: 436 TLL-------SKRKLQWMVDKDLVGNWD 456
            +        S  +  W+VDKDL+ N D
Sbjct: 846 LVYTFKFIGYSTSQCNWIVDKDLIINLD 873

>Skud_4.690 Chr4 (1220089..1222656) [2568 bp, 855 aa] {ON} YDR416W
           (REAL)
          Length = 855

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 24/31 (77%)

Query: 624 VDFDHLITKDRLEEDESFEDFLTPQTEFHTD 654
           ++F++LIT ++L EDE +E+F++  +E + D
Sbjct: 266 LNFNYLITLEKLGEDEQYEEFMSQMSEIYPD 296

>TBLA0I02880 Chr9 complement(680214..682892) [2679 bp, 892 aa] {ON}
           Anc_4.236 YLR382C
          Length = 892

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 59/144 (40%), Gaps = 29/144 (20%)

Query: 208 PEPSGYLHIGHAKAALLNQYFAQAYK--GKLIIR---FD-------------DTNPS--- 246
           P PSG LH+GH +  +++   ++ YK  G  +I    +D             D NPS   
Sbjct: 66  PYPSGVLHLGHLRVYVISDSLSRFYKQRGYDVIHPMGWDAFGLPAENAAIDRDCNPSTWT 125

Query: 247 -----KEKEEFQDSILE---DLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDT 298
                K KE+ ++ +     D +L     D   ++   F E+Y + +   K+ +   D  
Sbjct: 126 YDNIAKMKEQMKNMLANFDWDRELTTCSKDYYKFTQMIFLELYKHGLAYHKEAEINWDPV 185

Query: 299 PTEKMREERMDGIASSRRDRSVEE 322
               +  E++D    S R  ++ E
Sbjct: 186 DKTVLANEQVDSTGHSWRSGALVE 209

>Suva_13.198 Chr13 (321195..322343) [1149 bp, 382 aa] {ON}  YMR030W
           (REAL)
          Length = 382

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 272 YSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMREERMDGIASSRRDRSVEENLRIFTEEM 331
           ++S  FQ  Y+Y   ++ D  A  +  P EK R++  D   S+R D  + +NL    E+ 
Sbjct: 233 HNSPLFQRYYNYQSMLMNDLLAEPETKPKEKKRKQAED---STRNDSDIGQNLNYCQEQQ 289

Query: 332 KN 333
            N
Sbjct: 290 HN 291

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,645,028
Number of extensions: 3238718
Number of successful extensions: 9827
Number of sequences better than 10.0: 73
Number of HSP's gapped: 10025
Number of HSP's successfully gapped: 73
Length of query: 708
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 591
Effective length of database: 40,065,477
Effective search space: 23678696907
Effective search space used: 23678696907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)