Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.4848.841ON32532515840.0
YPL273W (SAM4)8.841ON32532515170.0
Suva_13.515na 1ON32532514430.0
SAKL0D01452g8.841ON32732412521e-174
NCAS0D049408.841ON32732612501e-174
KAFR0B00210singletonON32632312351e-171
TPHA0G03760singletonON33132312271e-170
Kwal_27.102558.841ON32932612171e-168
KLTH0C03850g8.841ON32932612161e-168
NDAI0F00250singletonON32932612081e-167
Suva_64.1singletonON27327311961e-166
KNAG0B06970singletonON33231411891e-164
KLLA0D01551g8.841ON33132311841e-163
TDEL0E05690singletonON32832411811e-163
Suva_16.328.841ON25924911361e-157
Ecym_46128.841ON32632411371e-156
Suva_16.17singletonON32432511071e-152
TDEL0E00240singletonON32832511031e-151
Smik_12.1na 2ON32432510631e-145
Skud_12.4na 2ON32532410441e-142
YLL062C (MHT1)na 2ON32432510331e-141
KAFR0L00150singletonON3263259841e-133
Skud_101.1singletonON2002009541e-130
Skud_100.1singletonON2002009361e-128
ABL125W8.841ON3363259431e-127
KAFR0F04420singletonON3263259301e-125
TBLA0B032608.841ON3263218271e-109
TPHA0I002608.841ON3233208211e-108
ZYRO0G14212g8.841ON3253287911e-104
Kpol_1068.78.841ON3233227641e-100
SAKL0D09306gna 3ON3263366552e-83
Kwal_0.322na 3ON3323355943e-74
KLTH0H12716gna 3ON3483375529e-68
AFR410WsingletonON3703185434e-66
YMR321Cna 1ON1051055152e-65
Skud_47.2singletonON96964047e-49
TPHA0O006301.386ON59450703.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.484
         (325 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   614   0.0  
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   588   0.0  
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   560   0.0  
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   486   e-174
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               486   e-174
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       480   e-171
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     477   e-170
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   473   e-168
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   473   e-168
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       469   e-167
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        465   e-166
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             462   e-164
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   460   e-163
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   459   e-163
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   442   e-157
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   442   e-156
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   431   e-152
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       429   e-151
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   414   e-145
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   406   e-142
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   402   e-141
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      383   e-133
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   372   e-130
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   365   e-128
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   367   e-127
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               362   e-125
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   323   e-109
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   320   e-108
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   309   e-104
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   298   e-100
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   256   2e-83
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   233   3e-74
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   217   9e-68
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   213   4e-66
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   202   2e-65
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      160   7e-49
TPHA0O00630 Chr15 complement(115953..117737) [1785 bp, 594 aa] {...    32   3.0  

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/325 (92%), Positives = 301/325 (92%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFI            RK
Sbjct: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSSSRK 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK
Sbjct: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQ            IGFETIPNIHE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV
Sbjct: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA
Sbjct: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325
           RIIGGCCRTSPKDIQEIFTAVKKYT
Sbjct: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/325 (87%), Positives = 293/325 (90%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           MARLPLKQ LADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFI            RK
Sbjct: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IVKEMFNDFL+AGAEILMTTTYQTSYKSVSENTPI+TLSEYNNLL RIVDFSR CIGEDK
Sbjct: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIGCIGPWGAHICREFTGDYGA PE+IDFYQYFKPQ            IGFETIPNIHE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSWDES+LS+PFYIGLSVHEHGVLRDGTTM+E+A+VIKDLGDKINPNFS LGINCV
Sbjct: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SFNQSPDILESLHQALP+MALLAYPNSGEVYDTEKKIWLPNSDKLNSWD VVK+YISSGA
Sbjct: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325
           RIIGGCCRTSPKDIQEI  AVKKYT
Sbjct: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 288/325 (88%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           MAR+PLKQLLAD+PKKVLVLDGGQGTELENRGIKVANPVWSTIPFI            RK
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IVKEMFNDFL AGAEILMT TYQTS+KSVSENTPIKTL+ Y+NLLTRIVDFSR CIGE+K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           +LIGCIGPWGAH+C EFTG+YG NPESIDFYQYFKPQ            +GFETIPNIHE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSWDES+LSKPFYIGLSVHEHGVLRDGTTM+ VAKVIKDLGDKINPNF LLGINCV
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SFNQSPDILESLH+ALP+M LLAYPNSGEVYDTEKKIW+PNSDKLNSWD VVK+YI SGA
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSDKLNSWDTVVKQYIGSGA 300

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325
           RIIGGCCRT+PKDIQE+  AVKKYT
Sbjct: 301 RIIGGCCRTTPKDIQEVSAAVKKYT 325

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  486 bits (1252), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 228/324 (70%), Positives = 262/324 (80%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           MAR P+KQ   ++P ++LV+DGGQGTELENRGIKVANPVWSTIPFI            R+
Sbjct: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IVKEMF+DF+  G+ ILMTTTYQTS+KSVSENTPIKTL EYN LL RIV FSR CIGEDK
Sbjct: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIGCIG WGAH+C EFTGDYGANPE IDF +YF+PQ            IGFETIPN+HE
Sbjct: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSWDES++SKPFYIGLSVHE+GVLRDGTTM+EVA +IK LGDK+NPN  LLGINCV
Sbjct: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SFN S  IL SLH+ LPDM ++ YPNSGE+YDT KKIWL N ++  +WD VVK YI +GA
Sbjct: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKY 324
           RIIGGCCRTSP+DI++I  A++KY
Sbjct: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  486 bits (1250), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 232/326 (71%), Positives = 261/326 (80%), Gaps = 1/326 (0%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R  +K+ L  NP KVLVLDGGQGTELENRGI VANPVWSTIPF+            R+
Sbjct: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IVKEMF DFL AGAEILMTTTYQTS+KSVSENT IKTL EYN LL RIV FSR CIGE K
Sbjct: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIGCIGPWGAH+C EF GDYGA+PE+ID+YQYFKPQ            IGFET+PN++E
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSWDE +LSKPFYIGLSVHE+GVLRDGTTM+E+  + K LG+K+NPN  LLGINCV
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLP-NSDKLNSWDAVVKRYISSG 299
           SFN SP ILE +H+ LPDM L+AYPNSGEVYDT KKIWLP NS+   +W+ VVKRYI +G
Sbjct: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300

Query: 300 ARIIGGCCRTSPKDIQEIFTAVKKYT 325
           ARIIGGCCRT+PKDI EI  AVKK++
Sbjct: 301 ARIIGGCCRTTPKDILEISKAVKKFS 326

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  480 bits (1235), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/323 (70%), Positives = 258/323 (79%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R P+K+ L +NPKKVLVLDGGQGTELENRGI VANPVWSTIPFI            R+
Sbjct: 1   MPRQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWSNASSKDRE 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IVK MF DFLDAGA+ILMT TYQTS+KSV+ENTPIKTL EYN LL RIV FSR CIG++K
Sbjct: 61  IVKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIGCIGPWGAH+C EF GDYG +PE+ID+Y YFKPQ            IGFET+PN HE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSWD+++LSKPFYIGLSVHE+GVLRDGTTM E+   IK LG KINPNF LLGINCV
Sbjct: 181 LKAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCV 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SF+ SPDILES+H+ LPDM L+AYPNSGE+YDT KKIWLPN     +W+ VV RYI +GA
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDITWNDVVNRYIKAGA 300

Query: 301 RIIGGCCRTSPKDIQEIFTAVKK 323
           RIIGGCCRT P DI+++  AVKK
Sbjct: 301 RIIGGCCRTMPDDIEQVSAAVKK 323

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  477 bits (1227), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 222/323 (68%), Positives = 261/323 (80%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           MAR  +K  L +NP KVLV+DGGQGTELENRGIKVANPVWSTIPFI            RK
Sbjct: 1   MARQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWSDQSSEDRK 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IVKEMFNDF++AGAEILMTTTYQTS+KSVSENTPIK    YN LL RI+DFSR CIGE++
Sbjct: 61  IVKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEER 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIGCIG WGAHIC EF GDYG +PE+IDFY+YFKPQ            IGFET+PNIHE
Sbjct: 121 YLIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSWDE +LSKPFYIGLSVHE+G+LRDGT+MQEVA +IK  G+K+NPN +LLGINCV
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCV 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           S+N S DI++S+H+ LP++ L+AYPNSGE+YDT KKIWLPN + + +WD +VK YI +G 
Sbjct: 241 SYNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKNPIFTWDDIVKGYIEAGV 300

Query: 301 RIIGGCCRTSPKDIQEIFTAVKK 323
           RIIGGCCRT+P DI+ +  AVK+
Sbjct: 301 RIIGGCCRTTPNDIKAVTIAVKE 323

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  473 bits (1217), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 224/326 (68%), Positives = 260/326 (79%), Gaps = 2/326 (0%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXX--XXXXXXXXX 58
           M R  +K+ L  NP++VLVLDGGQGTELENRGIKVANPVWSTIPFI              
Sbjct: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60

Query: 59  RKIVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGE 118
           R+IVKEM++DFL AGA +LMT TYQ S+KSVSENT IKTL EY++LL RIV FSR CIG+
Sbjct: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120

Query: 119 DKYLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNI 178
           DK+L+GCIG WGAH C EFTGDYGA PE IDF QYFKPQ            IGFETIPNI
Sbjct: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180

Query: 179 HELKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGIN 238
           HEL+AILSWDES+++KPFYIGLSVHE+G+LRDGTTM +VA++IK  GD++NPNF+LLGIN
Sbjct: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240

Query: 239 CVSFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISS 298
           CVS+NQS DIL SLH+ LP+M L+AYPNSGEVYDT KKIW P + +  SW+ +VK YI S
Sbjct: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300

Query: 299 GARIIGGCCRTSPKDIQEIFTAVKKY 324
           GARIIGGCCRTSPKDI+ I  AV+KY
Sbjct: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  473 bits (1216), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 228/326 (69%), Positives = 255/326 (78%), Gaps = 2/326 (0%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXX--XXXXXXXXX 58
           M R  +K+ LA NP++VLVLDGGQGTELENRGIKVANPVWSTIPFI              
Sbjct: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60

Query: 59  RKIVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGE 118
           R+IVKEM+ DFL AGA +LMT TYQ S+KSVSENT I TL EY+ LL+RIV FSR CIG+
Sbjct: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120

Query: 119 DKYLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNI 178
           DK+L+GCIGPWGAH C EFTGDYG+ PE ID+ QYFKPQ            IGFETIPNI
Sbjct: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180

Query: 179 HELKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGIN 238
           HEL+AILSWD ++L KPFYIGLSVHEHGVLRDGTTM EVA++IK LGDKINPNF LLGIN
Sbjct: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240

Query: 239 CVSFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISS 298
           CVS+N SP+IL SLHQ +P++ L+AYPNSGEVYDT KKIW P  D   +WD VVK YI S
Sbjct: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300

Query: 299 GARIIGGCCRTSPKDIQEIFTAVKKY 324
           GARIIGGCCRTSPKDI  I  AV KY
Sbjct: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  469 bits (1208), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 223/326 (68%), Positives = 259/326 (79%), Gaps = 1/326 (0%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R P+K  L++NPKK+L+LDGGQGTELENRGI VANPVWSTIPF+            R+
Sbjct: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IVK+MFNDFL+AGAEILMTTTYQTS+KSVSENT IKTL EY+ LLTRIV+FSR CIGE+K
Sbjct: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIGCIGPWGAHIC EFTG+YG +PE ID+Y+YFKPQ            IGFETIPN++E
Sbjct: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LK ILSW   +L KPFYIGLSVHE+GVLRDGTTM +VA +I  L DK+NPN  LLGINCV
Sbjct: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWL-PNSDKLNSWDAVVKRYISSG 299
           S   SPDIL+S+H  LPD+ L+ YPNSGEVYDT KKIWL PN +   SWD VV+RY+ +G
Sbjct: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300

Query: 300 ARIIGGCCRTSPKDIQEIFTAVKKYT 325
           ARIIGGCCRT+P DI++I  AV KY+
Sbjct: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  465 bits (1196), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 226/273 (82%), Positives = 240/273 (87%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           MAR+PLKQLLAD+PKKVLVLDGGQGTELENRGIKVANPVWSTIPFI            RK
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IVKEMFNDFL AGAEILMT TYQTS+KSVSENTPIKTL+ Y+NLLTRIVDFSR CIGE+K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           +LIGCIGPWGAH+C EFTG+YG NPESIDFYQYFKPQ            +GFETIPNIHE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSWDES+LSKPFYIGLSVHEHGVLRDGTTM+ VAKVIKDLGDKINPNF LLGINCV
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDT 273
           SFNQSPDILESLH+ALP+M LLAYPNSGEVYDT
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDT 273

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  462 bits (1189), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 219/314 (69%), Positives = 251/314 (79%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R P+++ L  NP+KVLVLDGGQGTELENRGI VANPVWST+PFI            R 
Sbjct: 1   MPRQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWSNKSSKDRV 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IVK MF+ FLDAGAEILMTTTYQTS+KSVSENTPI+ L EY++LL RIV FSR CIG DK
Sbjct: 61  IVKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIGCIGPWGAH+C EF GDYG NP  ID+  YFKPQ            IGFETIPNIHE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           L+AILSWDE++LSKPFYIGLSVH +G+LRDG+TM++VA +IK  G K+N N +LLGINCV
Sbjct: 181 LRAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCV 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SF+ SPDILES+H+ LPDM L+AYPNSGEVYDT KKIWLPN D + +W+ VV RYI +GA
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVMTWEEVVDRYIKAGA 300

Query: 301 RIIGGCCRTSPKDI 314
           RI+GGCCRTSPKDI
Sbjct: 301 RIVGGCCRTSPKDI 314

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  460 bits (1184), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 213/323 (65%), Positives = 254/323 (78%)

Query: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRKIV 62
           R+P+K+   +NP  VLV+DGGQGTELENRGI VANPVWST+PFI            R IV
Sbjct: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61

Query: 63  KEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKYL 122
           K+MF DF++AGA+ILMT TYQTS+KSVSENTPI+TL EYN LL RIV FSR CIGED+YL
Sbjct: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121

Query: 123 IGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHELK 182
           IGCIG WGAH+C EFTGDYG +P+ ID+++YF+PQ            IGFETIPNIHEL+
Sbjct: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181

Query: 183 AILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVSF 242
           AILSWDE+VLSKPFYIGLSVHE+GVLRDGT+MQ++A +I  LGDK+N N   +GINC +F
Sbjct: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241

Query: 243 NQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGARI 302
           NQS  ILESLH + P+M L+ YPNSGE+YDT KKIWL N ++L +WD VVK YI +GARI
Sbjct: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301

Query: 303 IGGCCRTSPKDIQEIFTAVKKYT 325
           IGGCCRT+  DI+E+  AV KY 
Sbjct: 302 IGGCCRTTVDDIKEVRLAVNKYA 324

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  459 bits (1181), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 213/324 (65%), Positives = 262/324 (80%), Gaps = 1/324 (0%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R+P+K+L+ ++ K++LVLDGGQGTELENRGI+VANPVWSTIPF+            RK
Sbjct: 1   MVRIPIKKLVIES-KEILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWTDSSSKERK 59

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IV+ +F+DF  +G+ ILMT TYQTS+ S+ ENT  KTL+EYN LL RIV FSR CIG+++
Sbjct: 60  IVESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDER 119

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIG +GPWGAH+C EFTG+YG +PESID+Y+YFKPQ            IGFET+PN HE
Sbjct: 120 YLIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHE 179

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSWDE+ ++KPFYIGLSVH +GVLRDGTTM+E+ + IK LG+KI+ NF LLG+NCV
Sbjct: 180 LKAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCV 239

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SFN S D+++S+H+ALPDM LLAYPNSGEVYDTEKKIW  N DKL+SWD+VV+ YI +GA
Sbjct: 240 SFNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWFDNKDKLDSWDSVVRSYIDNGA 299

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKY 324
           RIIGGCCRTSP+DI E+  AVKKY
Sbjct: 300 RIIGGCCRTSPRDIAEVSAAVKKY 323

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  442 bits (1136), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 210/249 (84%), Positives = 225/249 (90%)

Query: 77  LMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKYLIGCIGPWGAHICRE 136
           LMT TYQTS+KSVSENTPIKTL+ Y+NLLTRIVDFSR CIGE+K+LIGCIGPWGAH+C E
Sbjct: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70

Query: 137 FTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHELKAILSWDESVLSKPF 196
           FTG+YG NPESIDFYQYFKPQ            +GFETIPNIHELKAILSWDES+LSKPF
Sbjct: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130

Query: 197 YIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVSFNQSPDILESLHQAL 256
           YIGLSVHEHGVLRDGTTM+ VAKVIKDLGDKINPNF LLGINCVSFNQSPDILESLH+AL
Sbjct: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190

Query: 257 PDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGARIIGGCCRTSPKDIQE 316
           P+M LLAYPNSGEVYDTEKKIWLPNSDKLNSWD VVK+YI SGARIIGGCCRT+PKDIQE
Sbjct: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250

Query: 317 IFTAVKKYT 325
           +  AVKKYT
Sbjct: 251 VSAAVKKYT 259

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  442 bits (1137), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 208/324 (64%), Positives = 245/324 (75%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R  +KQLL  NP ++L++DGGQGTELENRGI VANPVWSTIPFI            R+
Sbjct: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWSDRSSRDRQ 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IV  MF +++ AGA +LMT TYQ+S+KSVSENT IKTL EYN LL RIV FSR CIG D 
Sbjct: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YL+GCIG WGAHIC EF+GDYG +PE I +  YF+PQ            IGFETIPNIHE
Sbjct: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           L AILSWDES++ KPFYIG+SVHEHG LRDGTTM +VA++ + LG K+NPNF  LGINC 
Sbjct: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SF  S  ILESLH+ LP + L+AYPNSGE+YDT KKIWL N + + +WD +VK Y+ SGA
Sbjct: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKY 324
           RIIGGCCRT+P DI++I TAVKKY
Sbjct: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  431 bits (1107), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 198/325 (60%), Positives = 249/325 (76%), Gaps = 1/325 (0%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R+ +++L+ ++P+KVLVLDGGQGTELENRGI + +PVWS  PFI            R 
Sbjct: 1   MGRIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFWESTSSD-RT 59

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           +V+EM+ DF+DAGA +LMT TYQ ++ S+SENT IKTLS+YN  L R+V F+R  IGED+
Sbjct: 60  LVEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDR 119

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIG IGPW AH+  E+TGDYG++PE ID+ Q+FK Q            IGFET+PN HE
Sbjct: 120 YLIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHE 179

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSWDE+++SKPFY+GLSVH++G+LRDGTTM+E+A  +K LG KIN +F LLG+NC+
Sbjct: 180 LKAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCI 239

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SFNQS  IL+SLHQALPDM LLAYPNSGEVYDT+ K W     K NSW+ VV+ +I +GA
Sbjct: 240 SFNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQNSWEVVVEEFIDNGA 299

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325
           RIIGGCCRTS KDI EI +AV K++
Sbjct: 300 RIIGGCCRTSAKDISEIASAVDKHS 324

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  429 bits (1103), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 196/325 (60%), Positives = 255/325 (78%), Gaps = 1/325 (0%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R+PL+++L D+ +K+LVLDGGQGTE+ENRGI+VANPVWS+IPF+            RK
Sbjct: 1   MGRVPLRKVLTDS-RKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWTDEWSKERK 59

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IV+E++ DF+ +G+++LMT TYQ S+K+++ENT ++TLSEYN+LL RIV FSR CIG+++
Sbjct: 60  IVEEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDER 119

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YL+G +GPW A+   E+TGDYG + +SID+Y Y+KPQ            IG ET+PN HE
Sbjct: 120 YLVGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHE 179

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSWDE  ++KPFY+ L+ H+ GVLRDGT M+++A+ IK LG+ +NPNF LLGINCV
Sbjct: 180 LKAILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCV 239

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SFN S DILE LH ALP+M LLAYPNSGEVY+ +KKIWL N  K  SWD+VVK +I+SGA
Sbjct: 240 SFNDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLANKCKTTSWDSVVKSFINSGA 299

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325
           RIIGGCCRTSP+DI ++  AVKKY+
Sbjct: 300 RIIGGCCRTSPQDIADVSIAVKKYS 324

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  414 bits (1063), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 190/325 (58%), Positives = 247/325 (76%), Gaps = 1/325 (0%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R+P+++LL ++P+KVLVLDGGQGTELENRGI + +PVWS  PF+            RK
Sbjct: 1   MKRIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFWEKSSRE-RK 59

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           +V+EM+ DF++AGA +LMT TYQ ++KS+S+NT IKTL  Y   L +IV FSR  IGE++
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEER 119

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIG IGPW AH+  E+TG+YG +PE ID+Y++F+PQ            IGFETIPN HE
Sbjct: 120 YLIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHE 179

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSW E ++S+PFY+GLSVH++G+LRDGTT++E++  IK LG KIN NF LLG+NC+
Sbjct: 180 LKAILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCI 239

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SFNQS  IL++LH+ LPD  LL YPNSGE+YD ++K W   +DKL+SWD  V+++I SGA
Sbjct: 240 SFNQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDSWDVTVRKFIDSGA 299

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325
           RIIGGCCRTSPKDI EI  +V  Y+
Sbjct: 300 RIIGGCCRTSPKDIAEIAASVDTYS 324

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  406 bits (1044), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 241/324 (74%), Gaps = 1/324 (0%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R+ +++L+ + P +VLVLDGGQGTELENRGI +  PVWS  PF             R+
Sbjct: 1   MKRISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPF-TSDSFWEQSSHDRE 59

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           +V+EM+ DF++AGA +LMT TYQ ++KS+SENT I+TLS YN  L RIV F+R  IGE++
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEER 119

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YL+G IGPW AH+  E+TG+YG +PE ID+Y +FKPQ            IGFET+PN HE
Sbjct: 120 YLVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHE 179

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSW E ++SKPFY+GLSVH++G+LRDGTTM+EV+  IK LG +IN +  L+G+NC+
Sbjct: 180 LKAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCI 239

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SFN+S  IL +LH++LPD  LL YPNSGEVYD ++K W   +DK  SWD  VK +I SGA
Sbjct: 240 SFNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPESWDITVKTFIDSGA 299

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKY 324
           RIIGGCCRTSPKDI EI TAV++Y
Sbjct: 300 RIIGGCCRTSPKDIAEIATAVRRY 323

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  402 bits (1033), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 188/325 (57%), Positives = 244/325 (75%), Gaps = 1/325 (0%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R+P+K+L+ ++P KVL+LDGGQGTELENRGI + +PVWS  PF             RK
Sbjct: 1   MKRIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPF-TSESFWEPSSQERK 59

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           +V+EM+ DF+ AGA ILMT TYQ +++S+SENT IKTL+ Y   L +IV F+R  IGE++
Sbjct: 60  VVEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEER 119

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIG IGPW AH+  E+TGDYG +PE+ID+Y +FKPQ            IGFETIPN HE
Sbjct: 120 YLIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHE 179

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LKAILSWDE ++SKPFYIGLSV ++ +LRDGTT++E++  IK LG+KIN N  L+G+NCV
Sbjct: 180 LKAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCV 239

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           SFNQS  IL+ LH+ LP M LL YPNSGE+Y+ ++K W   ++KL+ W+  VK+++ +GA
Sbjct: 240 SFNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDNGA 299

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325
           RIIGGCCRTSPKDI EI +AV KY+
Sbjct: 300 RIIGGCCRTSPKDIAEIASAVDKYS 324

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  383 bits (984), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 179/325 (55%), Positives = 235/325 (72%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R+PLK+ L +NP+KVLV DGGQG ELE RG+ + + +WST PF+             +
Sbjct: 1   MVRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWSDPSSNDIR 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IVK MF DF++AGAEILMTTTYQTS+K+VSE+T +K+L EYN LL +IV F+R CIG+++
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YLIG IG +GA +  E++GDYG +PE++DFY YFKPQ            +GFETI N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           LK++LSWDE  +SKPFYI LSVH++G LRDGT M  +   IK L   INPN + LG+NCV
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           ++N++ +I++S+H  LP M L  +PNSGEV++ EK IW  N +   SW+AVVKR+ISSG 
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAASWEAVVKRFISSGV 300

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325
           RI+GGCCRT P DI++I  AVKK +
Sbjct: 301 RIVGGCCRTRPHDIEQISKAVKKLS 325

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  372 bits (954), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 178/200 (89%), Positives = 185/200 (92%)

Query: 78  MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKYLIGCIGPWGAHICREF 137
           MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSR CIGE+KYLIGCIGPWGAHICREF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 138 TGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHELKAILSWDESVLSKPFY 197
           TGDYG +PESIDFY+YFKPQ            IGFETIPN+HEL+AILSWDES+LSKPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 IGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 257
           IGLSVHEHGVLRDGTTM+EVAKVIK LGDKINPNFSLLGINCVSFNQSPDILESLHQALP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 258 DMALLAYPNSGEVYDTEKKI 277
           DMALLAYPNSGEVYDTEKKI
Sbjct: 181 DMALLAYPNSGEVYDTEKKI 200

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  365 bits (936), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 175/200 (87%), Positives = 183/200 (91%)

Query: 78  MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKYLIGCIGPWGAHICREF 137
           MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSR CIGEDKYLIGCIGPWGAHIC EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 138 TGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHELKAILSWDESVLSKPFY 197
           TGDYG +P+SIDFY+YFKPQ            IGFETIPN+HEL+AILSWDES+LSKPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 IGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 257
           IGLSVHEHGVLRDGTTM+EVAKVIK LGDKINPNFSLLGINCVSFNQSPDILESLHQ LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 258 DMALLAYPNSGEVYDTEKKI 277
           +MALLAYPNSGEVYDTEKKI
Sbjct: 181 NMALLAYPNSGEVYDTEKKI 200

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  367 bits (943), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 179/325 (55%), Positives = 222/325 (68%), Gaps = 2/325 (0%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R+P++Q L ++P +VLV+DGGQGTELENRGI VA+PVWS  PF+            R 
Sbjct: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           IV  +  DF+ AGAE++MT TYQ S+ SV+ NT I TL +YN LL RIV F R  +G+DK
Sbjct: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YL+G IG WGAH+C EFTGDYG  P+ ID+  YFKPQ            IGFETIPN HE
Sbjct: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           L+AILSWDESV++KPFY+ LSVH+ G LRDGT M +VA ++      +NPNF  LGINC 
Sbjct: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAA-APLNPNFLGLGINCS 239

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
           S +++P IL  LH  LP + +  YPNSGE+YD  KK+W   S  +  W AVV  YI SGA
Sbjct: 240 SLSRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGA 298

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325
           RIIGGCCRT P DI++I  AV+ + 
Sbjct: 299 RIIGGCCRTIPNDIRQIADAVRTHA 323

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  362 bits (930), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 225/325 (69%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R+P+K+ L  N  K+LVLDGGQGTELE RGI +++PVWST+PFI            RK
Sbjct: 1   MGRVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWSNSSSNDRK 60

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120
           I+K+M++DF+ AGA++L TTTYQTS+ S+SENT I+TL +Y+ LL RI  F+R CIG+ K
Sbjct: 61  IIKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHE 180
           YL+G IG + A++  E+TGD+G   ++ID++ YFKPQ            IGFETIPNIHE
Sbjct: 121 YLVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHE 180

Query: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240
           L+AILS ++  LSKPFYI LS +    LRDGT+++ V  VIK     +NPN  LLGINC+
Sbjct: 181 LRAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCI 240

Query: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300
             N S   +E L+  LP   L+ YPNSGE YD  +KIWL + D   +W+ +V RY+ +GA
Sbjct: 241 GLNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAFTWEYIVHRYLDAGA 300

Query: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325
           RI+GGCCRT+P DI+ I  A+K YT
Sbjct: 301 RIVGGCCRTTPSDIRSISEAIKCYT 325

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  323 bits (827), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 153/321 (47%), Positives = 215/321 (66%), Gaps = 3/321 (0%)

Query: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXR-KI 61
           R   K+    +P  V+V+DGGQGTELE RG+ V++ VWST+PFI               I
Sbjct: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61

Query: 62  VKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKY 121
           VK+MF  F+ AG++ LM+ TYQ S+ ++S NT I+ L EYN LL +IV F R CIG  KY
Sbjct: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121

Query: 122 LIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHEL 181
           LIG IGP+ +H+  E+TGDYG +PE++D+  YFKPQ            I  ET+PN +EL
Sbjct: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYEL 181

Query: 182 KAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVS 241
           KA+LSWD + + KPFYI LSV + G LRDGT+M  ++ + ++   K NPN  ++G+NCVS
Sbjct: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240

Query: 242 FNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSD-KLNSWDAVVKRYISSGA 300
           ++++  I++ L  A+PD+ L+ YPNSGEVYD   + W  N+D KL+SW+ +VK  +++G 
Sbjct: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300

Query: 301 RIIGGCCRTSPKDIQEIFTAV 321
           R++GGCCRT+P DI +I  AV
Sbjct: 301 RMVGGCCRTTPDDIHKIAQAV 321

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  320 bits (821), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 153/320 (47%), Positives = 209/320 (65%), Gaps = 2/320 (0%)

Query: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXX-XXXXXXXXRKI 61
           R+P ++ + ++P ++LVLDGGQGTELENRG+ + +P+WSTI F+             RK 
Sbjct: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61

Query: 62  VKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKY 121
           ++EMFNDF DAGA +  T TYQTS+ SVSENT IK+L EY+ LL +I  F R CI +D Y
Sbjct: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121

Query: 122 LIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHEL 181
           L+GCIG + A I  E+ G+YG     ID+ +YFKPQ            IGFETIPN HEL
Sbjct: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181

Query: 182 KAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVS 241
           +AILSWDE ++++PF+I LS+ +   LRDGT+ +E+ ++      + N N   +G NC+S
Sbjct: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240

Query: 242 FNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGAR 301
           +  S D +  LH  +P + L+AYPNSGE+YD + K W   S    SW+ VV  Y  +G +
Sbjct: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300

Query: 302 IIGGCCRTSPKDIQEIFTAV 321
           IIGGCCRT+P DI++I  AV
Sbjct: 301 IIGGCCRTTPDDIKQIKKAV 320

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  309 bits (791), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 156/328 (47%), Positives = 212/328 (64%), Gaps = 12/328 (3%)

Query: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXX-XXXXXXXXRKI 61
           R  L ++L D   +VLV+DGGQGTELENRG+ ++ P+WST+PF              R +
Sbjct: 2   RQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60

Query: 62  VKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKY 121
           V  MF  ++DAGA++L T TYQTSYK++  +T I T ++Y+ LL RIV F R CIG+D Y
Sbjct: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120

Query: 122 LIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHEL 181
           L+G IGP+ AH+  E+TGDYG  PE ID++QYF+PQ            IG ET+PN+HEL
Sbjct: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180

Query: 182 KAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVS 241
           K+ILSWDE+ +SKPFY+ L V + G LRDGT ++++  +     ++ N N  L+GINC S
Sbjct: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPL---FANRSNKNLLLVGINCCS 237

Query: 242 FNQSPDILESLHQALPD--MALLAYPNSGEVYDTEKKIWLP----NSDKLNSWDAVVKRY 295
            + S   L  L++ L    M LL YPNSGE+YD + + W      +S +L SW ++V+ Y
Sbjct: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRL-SWPSLVQEY 296

Query: 296 ISSGARIIGGCCRTSPKDIQEIFTAVKK 323
              GAR IGGCCRT+P DIQEI   V +
Sbjct: 297 RKFGARAIGGCCRTTPLDIQEICKVVDR 324

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  298 bits (764), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 211/322 (65%), Gaps = 3/322 (0%)

Query: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXX-XXXXXXXXRKI 61
           R+P+++L+ + P +VLV DGG GT LE+RGI V++P+WST+PF+             R I
Sbjct: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61

Query: 62  VKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKY 121
           ++ ++ D++ +G+ IL T TYQTS+  +S +T +KT+  Y  L+  I  F R  IGED Y
Sbjct: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121

Query: 122 LIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHEL 181
           LIG IGP+GA +  E+TG+YG +P +I++ +YFKPQ            IGFET+PN +EL
Sbjct: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181

Query: 182 KAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVS 241
           +AILSWD+SV+SKP+Y+ LS+ ++G LRDGT+ +E+A + K   +  N N  L G NC+S
Sbjct: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239

Query: 242 FNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGAR 301
           F  + + +  LHQA+P + L+ YPNSGE+YD   K W  +     +W+ ++K   +S  R
Sbjct: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299

Query: 302 IIGGCCRTSPKDIQEIFTAVKK 323
           I+GGCCRT+P DI +I   + K
Sbjct: 300 IVGGCCRTTPDDINKIKDMITK 321

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  256 bits (655), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 141/336 (41%), Positives = 198/336 (58%), Gaps = 24/336 (7%)

Query: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
           M R P+ + L  +   +LVLDGGQGTE+E RGI V +P+WST+PFI              
Sbjct: 1   MRRQPIAEYLESS---ILVLDGGQGTEMERRGIDVIHPLWSTLPFIKKNPTHLNH----- 52

Query: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSE--NTPIKTLSEYNNLLTRIVDFSRG-CIG 117
            +K M++DF  +GA  L T TYQ S+ ++ +  +  + T  +Y   L  I+ F+R  CI 
Sbjct: 53  -IKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCIS 111

Query: 118 EDKYLIGCIGPWGAHICR--EFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETI 175
           + +YLIGC+GP+ A++C   E++GDYG+  E IDF QYFKPQ            +GFETI
Sbjct: 112 DSQYLIGCVGPYAAYLCNGAEYSGDYGS--EKIDFKQYFKPQLDVFSRDDRIDMVGFETI 169

Query: 176 PNIHELKAILSWDESVL--SKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFS 233
           PNI ELK +LS D + +  +KPFYI +S   +G LRDGT + ++ + IKD      PN  
Sbjct: 170 PNIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLL 229

Query: 234 LLGINCVSFNQSPDILESLHQALPDMALL----AYPNSGEVYDTEKKIWLPNSDKLN--S 287
            LGINCV ++ S +IL  L+  L D   L     YPNSGE+YD     W  NS+     +
Sbjct: 230 FLGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELT 289

Query: 288 WDAVVKRYISSGARIIGGCCRTSPKDIQEIFTAVKK 323
           W+ +V ++     ++IGGCCRT+P DI++I  AV K
Sbjct: 290 WNYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNK 325

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  233 bits (594), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 190/335 (56%), Gaps = 27/335 (8%)

Query: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRKIV 62
           RL L++ L     ++L+LDGGQGTELE RGI +A+P+WST+P++             KI+
Sbjct: 2   RLQLEEYLK---HEILLLDGGQGTELEKRGINIAHPLWSTLPYVTKDKKHL------KII 52

Query: 63  KEMFNDFLDAGAEILMTTTYQTSYKSVSENTP--IKTLSEYNNLLTRIVDFSRG-CIGED 119
           KEM++ F  AG   LMT TYQ S+ S+  ++   I    EY   L  ++D++   CI  +
Sbjct: 53  KEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCISPN 112

Query: 120 KYLIGCIGPWGAHICR--EFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPN 177
            YL+G +GP+ A++    E++G Y    ++IDF ++F+PQ            IG ETIPN
Sbjct: 113 SYLVGSVGPYAAYLSNGAEYSGHYIE--DNIDFIEFFRPQVQHFAVSSRIDLIGIETIPN 170

Query: 178 IHELKAILSWDESVLS--KPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLL 235
             E KA+L  + S L   KP+YI ++    G LRDGT  Q++ + IK     + PN    
Sbjct: 171 FEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLVFF 230

Query: 236 GINCVSFNQSPDILESLHQALPDMAL-------LAYPNSGEVYDTEKKIWLPNSD--KLN 286
           GINCVSF    DIL+ L+ +L D+ +         YPNSGEVY  +   W PN +    +
Sbjct: 231 GINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGPAD 290

Query: 287 SWDAVVKRYISSGARIIGGCCRTSPKDIQEIFTAV 321
           +W+ +  + +  G  +IGGCCRTSP D+++I + V
Sbjct: 291 TWENLASKVVQQGCLMIGGCCRTSPADLRQIASVV 325

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  217 bits (552), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 124/337 (36%), Positives = 186/337 (55%), Gaps = 27/337 (8%)

Query: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRKIV 62
           R PLK+   +N   +L+LDGGQGTELE +G+ +++P+WST+PFI             + +
Sbjct: 2   RKPLKEFFKNN---ILLLDGGQGTELEKKGVSISHPLWSTLPFIIKNKTHL------EAI 52

Query: 63  KEMFNDFLDAGAEILMTTTYQTSYKSVSENTP--IKTLSEYNNLLTRIVDFS-RGCIGED 119
           KEM+ DF +AG+  LMT TYQ S+ S+ + +   + +  +Y   L  ++ F+ R CI  D
Sbjct: 53  KEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECITPD 112

Query: 120 KYLIGCIGPWGAHICR--EFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPN 177
           KYL+G +GP+   +    E++G YG     IDF  Y+ PQ            IG ETIPN
Sbjct: 113 KYLVGSVGPYAGLLSNGAEYSGYYGEG--KIDFIDYYSPQVKHFALSPRIDLIGIETIPN 170

Query: 178 IHELKAILSWDESVLS--KPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLL 235
           I E KA+LS + S LS  KP+YI ++   +G LRDGT++ E+ + IK     +  NF   
Sbjct: 171 IDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFVFF 230

Query: 236 GINCVSFNQSPDILESLHQALPDMAL-------LAYPNSGEVYDTEKKIWL--PNSDKLN 286
            INCV F    +IL+SL+  L    +        AYPNSGE+Y      W   P +   +
Sbjct: 231 AINCVEFLHCVEILQSLNDCLEMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAGPED 290

Query: 287 SWDAVVKRYISSGARIIGGCCRTSPKDIQEIFTAVKK 323
           +W+ +    +S    ++GGCCRT  ++I+++    KK
Sbjct: 291 TWENLTLGLLSQECLMLGGCCRTGSEEIRQMALTTKK 327

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  213 bits (543), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 116/318 (36%), Positives = 180/318 (56%), Gaps = 19/318 (5%)

Query: 15  KKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRKIVKEMFNDFLDAGA 74
           + VLV+DGG G ELE RG+ V +P+WST PF+               ++ ++ +F  AG+
Sbjct: 57  RNVLVMDGGMGVELERRGMDVKSPLWSTAPFLRGDRAAL------DTIRGLYREFRAAGS 110

Query: 75  EILMTTTYQTSYKS-VSENTPIKTLSEYNNLLTRIVDFS-RGCIGEDK-YLIGCIGPWGA 131
             + T TYQ S+ S V  +  + + ++Y   L ++VDF+ R C+   + Y+IG +GP+ A
Sbjct: 111 RGISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPARDYIIGSVGPYAA 170

Query: 132 HICR--EFTGDYGANPESIDFYQYFKPQXXXXXXXXXXXXIGFETIPNIHELKAILSWDE 189
            +C   E+TGDYG   E+I+F+ YF+PQ            I FET+PN+ EL A+L  + 
Sbjct: 171 FLCNGAEYTGDYGF--ETINFFNYFEPQVSKFATDPRIDAIAFETVPNVVELMAMLQPEF 228

Query: 190 SVL--SKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVSFNQSPD 247
             L  +KPFYI +S  +  VLRDGT +  V ++I++  D + PN    G+NCV   +S  
Sbjct: 229 HALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCFGLNCVDLTRSAA 288

Query: 248 ILESLHQALPDMAL---LAYPNSGEVYDTEKKIWLPNSDKLN-SWDAVVKRYISSGARII 303
           +L  L+  L D  +     YPN   V+D     W P+ D  + +W   VK Y++   R+I
Sbjct: 289 MLAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAEAVKLYLNQDCRMI 348

Query: 304 GGCCRTSPKDIQEIFTAV 321
           GGCC T+P+D+++I  A+
Sbjct: 349 GGCCGTTPQDMRQIAEAL 366

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  202 bits (515), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 99/105 (94%)

Query: 221 IKDLGDKINPNFSLLGINCVSFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLP 280
           + DLGDKINPN S LGINCVSFNQSPDILESLHQALP+MALLAYPNSGEVYDTEKKIWLP
Sbjct: 1   MMDLGDKINPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLP 60

Query: 281 NSDKLNSWDAVVKRYISSGARIIGGCCRTSPKDIQEIFTAVKKYT 325
           NSDKLNSWD VVK+YISSGARIIGGCCRTSPKDIQEI  AVKKYT
Sbjct: 61  NSDKLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKYT 105

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  160 bits (404), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 81/96 (84%)

Query: 1  MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIXXXXXXXXXXXXRK 60
          M RLPLKQLL DNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFI            RK
Sbjct: 1  MVRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWSDESSANRK 60

Query: 61 IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIK 96
          IVK MFNDFL+AGAEILMTTTYQTSYKSVSENTPIK
Sbjct: 61 IVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPIK 96

>TPHA0O00630 Chr15 complement(115953..117737) [1785 bp, 594 aa] {ON}
           Anc_1.386 YLR173W
          Length = 594

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 22/50 (44%)

Query: 259 MALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGARIIGGCCR 308
           + LL  PN+  + D  KKIW  + D LN W  +  +       + G   R
Sbjct: 186 ITLLLKPNTKNIVDVLKKIWKKDYDHLNIWSDMSLKLSKKSYLLFGANLR 235

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,871,260
Number of extensions: 1375765
Number of successful extensions: 3436
Number of sequences better than 10.0: 41
Number of HSP's gapped: 3509
Number of HSP's successfully gapped: 41
Length of query: 325
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 215
Effective length of database: 40,868,139
Effective search space: 8786649885
Effective search space used: 8786649885
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)