Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.4806.8ON51651626560.0
YPL272C6.8ON51751724340.0
Skud_16.56.8ON51551624290.0
Suva_16.336.8ON51851823770.0
KNAG0E027706.8ON50851912821e-172
NDAI0G00860singletonON52353112571e-169
TDEL0G046306.8ON50352512121e-162
CAGL0A01089g6.8ON53553911931e-159
Kpol_1045.796.8ON50852711311e-150
KAFR0B065106.8ON50852511011e-145
SAKL0E00792g6.8ON51152210791e-142
TPHA0J002606.8ON51552510421e-136
TPHA0M001806.8ON50351710301e-134
NCAS0D021806.8ON5155268631e-109
TBLA0A072206.8ON5095358401e-106
KLTH0C11572g6.8ON5185257117e-87
Kwal_56.223416.8ON5195236393e-76
Ecym_30116.8ON5095236341e-75
ACR018C6.8ON4784665866e-69
Kpol_1032.1singletonON2462463047e-31
Kpol_191.16.8ON1391451101e-05
KLTH0C02178g5.119ON4641351108e-05
Kwal_27.98985.119ON460150910.015
NDAI0D023605.119ON470302900.023
CAGL0K00737g5.119ON457294880.033
TBLA0A039608.326ON85074780.69
SAKL0G15004g5.119ON456132761.1
TBLA0E038302.245ON25684722.2
TBLA0B022305.475ON790104714.2
Kpol_1003.442.295ON47031688.5
Kpol_1010.495.119ON48197688.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.480
         (516 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...  1027   0.0  
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   942   0.0  
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   940   0.0  
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   920   0.0  
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   498   e-172
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              488   e-169
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   471   e-162
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   464   e-159
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   440   e-150
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   428   e-145
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   420   e-142
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   405   e-136
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   401   e-134
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      337   e-109
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   328   e-106
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   278   7e-87
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   250   3e-76
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   248   1e-75
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   230   6e-69
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   121   7e-31
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    47   1e-05
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    47   8e-05
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    40   0.015
NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.1...    39   0.023
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    39   0.033
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    35   0.69 
SAKL0G15004g Chr7 (1288241..1289611) [1371 bp, 456 aa] {ON} simi...    34   1.1  
TBLA0E03830 Chr5 (964482..965252) [771 bp, 256 aa] {ON} Anc_2.24...    32   2.2  
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...    32   4.2  
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    31   8.5  
Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON} (1130...    31   8.7  

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score = 1027 bits (2656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/516 (97%), Positives = 503/516 (97%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS 60

Query: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120
           RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNNISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240
           LNNISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF
Sbjct: 181 LNNISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240

Query: 241 YNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300
           YNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360
           NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360

Query: 361 LSLIDDELSVNEFLAXXXXXXXXXXXXXKLMEYQFNNVTKHVSSFIMAKLKSWEKNGFND 420
           LSLIDDELSVNEFLA             KLMEYQFNNVTKHVSSFIMAKLKSWEKNGFND
Sbjct: 361 LSLIDDELSVNEFLANSNDNEEDEEFDEKLMEYQFNNVTKHVSSFIMAKLKSWEKNGFND 420

Query: 421 DDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSINRPTLL 480
           DDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSINRPTLL
Sbjct: 421 DDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSINRPTLL 480

Query: 481 SLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
           SLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 481 SLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  942 bits (2434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/517 (88%), Positives = 488/517 (94%), Gaps = 1/517 (0%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKK+LTQSLNDQRNGTIFSSTYSKSL +ENDADWHSDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS 60

Query: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120
           RLTLPLIATTLKRLIKSQPALFAT+NEEWEFEPL+QLKTSDIVNVIEFET+KDKEVNCHW
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRF+PGSN+PLWTLYVIDE LLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNNISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240
           LN IS+VTH EDRILFD+N++++S+L FPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSI+
Sbjct: 181 LNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY 240

Query: 241 YNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300
           YNTLKRPFGYLTNQTS+SS  SATQLKKYNDILNAH+SLCGTTVFGIV+NQRFNYLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360
           NQEHICLRSFICGIAMICLKPLVKDFSGTIVF+IPI+LR HLGLG SLGLFFKELR+ CP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECP 360

Query: 361 LSLIDDELSVNEFLA-XXXXXXXXXXXXXKLMEYQFNNVTKHVSSFIMAKLKSWEKNGFN 419
           LSLIDDELS NEFL               +LMEYQFN VTKHVS FIMAKL+SWEKNGFN
Sbjct: 361 LSLIDDELSANEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRSWEKNGFN 420

Query: 420 DDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSINRPTL 479
           DDDIRRMKYDNDD+FHIQNS+TKL+QINDVSDISLSMN DDKSFKIVS+GFTSSINRPTL
Sbjct: 421 DDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPTL 480

Query: 480 LSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
           +SLSYTYC+EMGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 481 MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/516 (88%), Positives = 480/516 (93%), Gaps = 1/516 (0%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKS  + NDADW+SDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDS 60

Query: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120
           RLTLP IA TLKRLIKSQPALFAT+NEEWEFEPL+QLKTSDIVNVIEFET+KDKEVNCHW
Sbjct: 61  RLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRF+PGSN+PLWTLYVIDE LLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNNISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240
           LNNIS   H +DR+LFDI++V+IS+LNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF
Sbjct: 181 LNNISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240

Query: 241 YNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300
           YNTLKRPFGYLTNQTS+    S TQLKKYNDILNAHSSLCGTTVFGIV+NQRFNYLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360
           NQEHICLRSFICGIAMICLKPLVKDF+G IVFSIPIDLRK+L LGESLGLFFKELRI CP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECP 360

Query: 361 LSLIDDELSVNEFLAXXXXXXXXXXXXXKLMEYQFNNVTKHVSSFIMAKLKSWEKNGFND 420
           LSLIDDELS +EFLA             KLMEYQFN VTKHVS FIMAKLKSWEKNGFND
Sbjct: 361 LSLIDDELSADEFLANRNDKEDDDEFNEKLMEYQFNKVTKHVSDFIMAKLKSWEKNGFND 420

Query: 421 DDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSINRPTLL 480
           DDIRRMKYDNDD  HIQNSKTKL+QINDVSDISLSMNND+K+FKI+SSGFTSSINRPTL+
Sbjct: 421 DDIRRMKYDNDD-CHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSINRPTLM 479

Query: 481 SLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
           SLSYTYC+EMGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 480 SLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/518 (86%), Positives = 484/518 (93%), Gaps = 2/518 (0%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKS  KE DADWHSDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDS 60

Query: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120
           RLTLPLIATTLK+LIKSQPALFAT+NE+WE+ PL+QLKTSDIVNVIEFET KDKEVNCHW
Sbjct: 61  RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRF+PGSN+PLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNNISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240
           LN+I+SV+  +DR+LFDIN+V+ ++L+FPKSIYDSAKL LPAMTPQI HKQTQSFFKSIF
Sbjct: 181 LNSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIF 240

Query: 241 YNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300
           YNTLKRPFGYLTNQTS SSPA  +QLK+YNDILN +SSLCGTTVFGIV+NQRF+YLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360
           NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHL LGESLGLFFKELRI CP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECP 360

Query: 361 LSLIDDELSVNEFLA--XXXXXXXXXXXXXKLMEYQFNNVTKHVSSFIMAKLKSWEKNGF 418
           LSLIDDELS+NEFL                KLMEYQFN VTKHVS++IM KLKSWE+NGF
Sbjct: 361 LSLIDDELSINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKLKSWERNGF 420

Query: 419 NDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSINRPT 478
           NDDDIRRMKYDNDD+FH+QNSKTKL+QINDVSDISLSM+NDDKSFKIVSSGFT+SINRPT
Sbjct: 421 NDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSINRPT 480

Query: 479 LLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
           L+SLSYTYC++MGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 481 LMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  498 bits (1282), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 257/519 (49%), Positives = 354/519 (68%), Gaps = 17/519 (3%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS 60
           M++ R LSSFEKKLL QS++  +NGT F + YS    KE    W  +E TL T     DS
Sbjct: 1   MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTF--KEG---WSDEEATLLT---VKDS 52

Query: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120
           RL L L+   L+ LIK    LF TINE++EFE L+++KTSD+++ I+F++ KD+++NC  
Sbjct: 53  RLCLGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQL 112

Query: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           G PP YLLRH FN  RF+PGS +PLW LY++D++L  FHG D LFD+FS ANFH+L LKE
Sbjct: 113 GAPP-YLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKE 171

Query: 181 LNNISSVTHYEDRI--LFDINNVSISDL-NFPKSIYDSAKLHLPAMTPQIFHKQTQSFFK 237
           +N +SS      ++  +F     S+S++   PKSIYD+ KL++P + P +F+ QTQSFFK
Sbjct: 172 VNLLSSRPQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFK 231

Query: 238 SIFYNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLK 297
           SI+ NT+K+P  +LTN T +S  +  + +K YNDIL+ +S LCG TVFG VSN+RF YL 
Sbjct: 232 SIYVNTVKKPIEFLTN-TDVSFLSLNSNMK-YNDILDINSKLCGNTVFGCVSNERFKYLN 289

Query: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRI 357
           +I+NQE +CL+SFI GIAM+CLKP+VK+ SGT+ FSIP+DLR  +      GL++K++R+
Sbjct: 290 TIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRV 349

Query: 358 ACPLSLIDDELSVNEFLAXXXXXXXXXXXXXKLMEYQFNNVTKHVSSFIMAKLKSWEKNG 417
            CPLSLIDD+ S +                 KLMEYQF N+T  V + +  +L  + K G
Sbjct: 350 ECPLSLIDDDKSKD---CMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTG 406

Query: 418 FNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSINRP 477
           FNDDDIRRMK+D+ +     ++    +QI D S I+++   +  SF I +   T S+N  
Sbjct: 407 FNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNSE 466

Query: 478 TLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
            L+SLSYTYC+E GLNICIHYP++Y +ESFVECF+SF+E
Sbjct: 467 ELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  488 bits (1257), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 246/531 (46%), Positives = 357/531 (67%), Gaps = 27/531 (5%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRL 62
           + R LSSFEKK+L+Q+L+ +RNG  +++ Y   +G  +D+        L T     D RL
Sbjct: 2   SIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATK----DIRL 57

Query: 63  TLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGV 122
            + ++   L+RLIK    L++TINE +EF+ L ++K  D+++VI F+T KD+++NCH G 
Sbjct: 58  NIGIVTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGA 117

Query: 123 PPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH FNK +F    N+PLW LY+IDET+++FHG D+LFDIFSAANFHKLF  ELN
Sbjct: 118 PP-YLLRHIFNKEKF--ELNKPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELN 174

Query: 183 N---ISSVTHYEDRILFDINNVSISDLNF-------PKSIYDSAKLHLPAMTPQIFHKQT 232
           +    ++ +    + L  +  +++SD NF       P+SI+D+ KLHLPAMTP +F+ QT
Sbjct: 175 DYFLTNTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQT 234

Query: 233 QSFFKSIFYNTLKRPFGYLTNQTSISSPASATQLKKYN-----DILNAHSSLCGTTVFGI 287
           +SFFK+I+ NT+K+P        S +     +QLK+Y      D+L   SSLCGTTVFG 
Sbjct: 235 KSFFKTIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGT 294

Query: 288 VSNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGES 347
           VS  R+NYLK ++ Q+ ICLRSFICGI MICLKP +K++SG I+FSIPI+LR ++   ++
Sbjct: 295 VSPTRYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKN 354

Query: 348 LGLFFKELRIACPLSLIDDE-LSVNEFLAXXXXXXXXXXXXXKLMEYQFNNVTKHVSSFI 406
            GLF+K+++I CPLSLIDD     N +               KL+EYQF  VT+ + + I
Sbjct: 355 FGLFYKDVKIDCPLSLIDDRNFKYNGYKDSSIPDENDLEFNEKLLEYQFKQVTEFIENVI 414

Query: 407 MAKLKSWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMN-NDDKSFKI 465
           + +LK WEK  FNDDDI+RMK+D+D+   +    +K++QIND ++I L  N N++K+F +
Sbjct: 415 LERLKIWEKFNFNDDDIKRMKFDHDE---VLGQNSKIIQINDTTEIMLGENDNNNKAFTL 471

Query: 466 VSSGFTSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
            +  FT +++    +S+S+  C+E GLN+CIHYPD Y++E+FVECF++FIE
Sbjct: 472 TNPNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIE 522

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  471 bits (1212), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 251/525 (47%), Positives = 342/525 (65%), Gaps = 36/525 (6%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRL 62
           +FR L  FEKK+L+QSL   RNG +F + YS +       +W SD+ TL T     DSRL
Sbjct: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTT-----PEEW-SDDATLLTYK---DSRL 52

Query: 63  TLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGV 122
            L L++ TL ++I     LF TINE+ EF P++++K  +++N + F + KD+ VNC +G 
Sbjct: 53  NLSLLSRTLAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGA 112

Query: 123 PPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH FN+T F PGS   LW +YV+DETL+VFHGHDVLFDIFSAANFHK+FL+ LN
Sbjct: 113 PP-YLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLN 171

Query: 183 NISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFYN 242
           +IS  +  +   +F +    +    FPKSIYD+AKL LPA    +F+ QTQSFFKS+++N
Sbjct: 172 SISK-SGSKLSTIFKLEKAVLPP--FPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFN 228

Query: 243 TLKRPFGYLTNQTSISSPASATQLK----KYNDILNAHSSLCGTTVFGIVSNQRFNYLKS 298
            +K+P  Y+      S+P    QLK    +Y DIL   ++LCGTT+FG +  +R   L  
Sbjct: 229 AVKKPLDYIN-----SNPPQ--QLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDC 281

Query: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIA 358
           I  Q++ICL+SF+CGI M+CLKP+VK+++G+I F +P+DLR  L      G+F+K++R+ 
Sbjct: 282 IFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVE 341

Query: 359 CPLSLIDDE----LSVNEFLAXXXXXXXXXXXXXK--LMEYQFNNVTKHVSSFIMAKLKS 412
           CPLSLIDD+    L+V                  K  L+EYQF  VT HV + +  ++K+
Sbjct: 342 CPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKA 401

Query: 413 WEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNND-DKSFKIVSSGFT 471
           WEK GFNDDDI+RMK+ +DD      + TKL+QINDVSDI +  + D    F +     T
Sbjct: 402 WEKFGFNDDDIKRMKFGSDD----TATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMT 457

Query: 472 SSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
            S+    L+SLSYT+  E GL+ICIHYPD YN+ESFVECF+SFIE
Sbjct: 458 QSLKPGQLMSLSYTH-SEKGLDICIHYPDGYNMESFVECFQSFIE 501

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  464 bits (1193), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 243/539 (45%), Positives = 347/539 (64%), Gaps = 35/539 (6%)

Query: 5   RPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDAD-WHSDEVTLGT------NSSK 57
           R LSS+E+KLL++ L + +NGT+F ++Y        D   W  D  TL        ++ K
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 58  DDSRLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVN 117
               LTLPL+   LK LI+  P ++ T+N+  EF PL++++T D+++V+ F+  KD++VN
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 118 CHWGVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLF 177
           CH G PPPYL+RH      F PGSN+PLW LY+IDE+ LVFH  D+LFDIFSAANFHKLF
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 178 LKELNNISSVTH-YEDRI--LFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQS 234
           LKEL  +      YE  +  LF +     ++ + PKSIYD+ KLHLPA  P++ + QTQS
Sbjct: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242

Query: 235 FFKSIFYNTLKRPFGYL---------------TNQTSISSPASATQL--KKYNDILNAHS 277
           FFKSIF N +K+P  ++                + T IS   +  +L   +Y +IL + +
Sbjct: 243 FFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILTSAT 302

Query: 278 SLCGTTVFGIVSNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPID 337
           S CG T+FG VSN+RFNYL S+V  E ICLRSFI  I M+CLKP+VK F+GT++FS+P++
Sbjct: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362

Query: 338 LRKHLGLGESLGLFFKELRIACPLSLIDDELSVNEFLAXXXXXXXXXXXXXKLMEYQFNN 397
           LR  +      GL +K++R+ CPLS+IDD+       +             KL+E QF  
Sbjct: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQC-----SVPGLNESDPEYNEKLLEIQFQQ 417

Query: 398 VTKHVSSFIMAKLKSWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMN 457
           +  +V+  I  ++ +W+K G+ND+D++RMK+   DE    N  T+L++INDVS++S   +
Sbjct: 418 IATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPN--TRLIKINDVSEVSFD-D 474

Query: 458 NDDKSFKIVSSGFTSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
           ND +   I S GFT+S+++ TL+SLSYT+C+E GLNICIHYPD YN+E+FV+CFESF+E
Sbjct: 475 NDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFME 533

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  440 bits (1131), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 236/527 (44%), Positives = 342/527 (64%), Gaps = 35/527 (6%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKD-- 58
           MT+FR L ++EKKL+ Q+L  Q NG IFS+ Y       N  D  +D+ TL TNS     
Sbjct: 1   MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYIS-----NAQDGLTDDATLLTNSEPLLL 55

Query: 59  DSRLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNC 118
           DSRL        L++++   P L  T+NE+ EFE ++++KTSDI+  ++F++LKD+ VNC
Sbjct: 56  DSRL-----VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNC 110

Query: 119 HWGVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFL 178
           H G PP YLLRH FN+ +F PGS +PLW L VID++L++FHG DVLFDIF+AANFHKLFL
Sbjct: 111 HLGAPP-YLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFL 169

Query: 179 KELNNISS--VTHYEDRILFDI--NNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQS 234
           + LN++    +T  E    +D   +N SIS   FP++IY++ KL +P  T  + + QTQS
Sbjct: 170 ETLNSMDDEHITDLEYIYRYDATKSNRSIS---FPRTIYENPKLRIPGKTIDLVNLQTQS 226

Query: 235 FFKSIFYNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFN 294
           FFKS + N +K+P   +T  +         ++    D +N  S+LCGTTVFG ++  RF 
Sbjct: 227 FFKSFYVNAIKKPLDIITFNSEPMKYIKPNEI----DFMNEASALCGTTVFGHITTDRFE 282

Query: 295 YLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKE 354
           YL SI   E++C+RSFICGIA++CLK ++KDF+G+I FSIP++LR+ +      GLF+K 
Sbjct: 283 YLNSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKT 342

Query: 355 LRIACPLSLIDDEL--SVNEFLAXXXXXXXXXXX----XXKLMEYQFNNVTKHVSSFIMA 408
           + + CPLSLIDD++  ++N +                   K +EYQF  ++  VS+ +  
Sbjct: 343 ILVECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKE 402

Query: 409 KLKSWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSS 468
           ++++W +NGFNDDDI++MK+ +DD    + S TK++QINDVS+  ++ +   K   I   
Sbjct: 403 RMRAWRRNGFNDDDIKKMKFTSDD----KASNTKIIQINDVSEFKINSSKSSKV-SIKEL 457

Query: 469 GFTSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFI 515
            FT SI+    +SLSYTYC+E G NICIHYPD+Y++E FVE F+SF+
Sbjct: 458 NFTHSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  428 bits (1101), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 222/525 (42%), Positives = 334/525 (63%), Gaps = 29/525 (5%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRL 62
           T R LSS+E+K+L +++  +RNG IF+++YS S       +W  D   L    +  DSR 
Sbjct: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSAS-----SEEWGDDTTLL----TLKDSRP 52

Query: 63  TLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGV 122
           T+ ++   ++RLI     LF TINE +EFE L+ +K  DI+N++EF++ KD+++NCH G 
Sbjct: 53  TIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGC 112

Query: 123 PPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH F+  RF+PGS +PLW+L++IDE+L++FHG D+LFDIFSAANFHKL LKE N
Sbjct: 113 PP-YLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETN 171

Query: 183 NISS--VTHYEDRILFDINNV--SISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKS 238
            +++  +   E  I+F + N    I++L   KSIYD+ ++HLPA +P +F+ QTQSFFKS
Sbjct: 172 IVANEPLDSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKS 231

Query: 239 IFYNTLKRPFGYLTNQ------TSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQR 292
           +F++T+K+P  YL         TS ++ +  T ++KY DI + +++L  TTVFG ++ QR
Sbjct: 232 VFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQR 291

Query: 293 FNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGE-SLGLF 351
           + YL S++  + IC +SF+ GI M+CLKP +++F G++ FSI I+LR  L       GLF
Sbjct: 292 YEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLF 351

Query: 352 FKELRIACPLSLIDDELSVNEFLAXXXXXXXXXXXXXKLMEYQFNNVTKHVSSFIMAKLK 411
           +K++ I  PLSLIDD   +                  K++E+QF  VT  V   I  ++ 
Sbjct: 352 YKDVLIDVPLSLIDDNAVM--LSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRIS 409

Query: 412 SWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFT 471
            +   GFNDDDIR+MKY    E       TK++++ D S++SL     D  + + ++ FT
Sbjct: 410 KFSTMGFNDDDIRQMKYGKPAE------DTKIIRLFDTSEVSLGSGKRDGKYILHNTNFT 463

Query: 472 SSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
            S+ +    S+SYT C   GLN+C+ +PD  ++E+FVECF+SFIE
Sbjct: 464 KSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  420 bits (1079), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 219/522 (41%), Positives = 329/522 (63%), Gaps = 29/522 (5%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRL 62
           +FR LSS EKKL +Q+LN++RNG +F++ YS    KE    W SD  TL T     D RL
Sbjct: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKE--ETW-SDNATLLT---VKDQRL 59

Query: 63  TLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGV 122
           +  L++  LK++I +   L+ TIN+  EF+P++ +   D+V  +EF++ KD+ VNCH GV
Sbjct: 60  SNSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGV 119

Query: 123 PPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH F+K +F    ++PLW + ++DET+++FHGHDVLFDIF+AANFHKLF + LN
Sbjct: 120 PP-YLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALN 178

Query: 183 NISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFYN 242
            +       + +  + +  S     FPKSIY++ KL LPA+   +F  QTQSFFKS++  
Sbjct: 179 QLPKDGPTLECLFKNDSKASF----FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNW 234

Query: 243 TLKRPFGYLTNQTSISSPASATQLKK--YNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300
           T+K+P  ++      ++P S  +  +  Y DIL   ++LCGTTVFG +S +R   LK I+
Sbjct: 235 TIKKPLDFIN-----TNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIM 289

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360
            QE+ICL SF+C IA++CLKPLV +F  ++ FSIP+DLR  +      GL +K + + CP
Sbjct: 290 KQENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECP 349

Query: 361 LSLIDDEL--SVNEF----LAXXXXXXXXXXXXXKLMEYQFNNVTKHVSSFIMAKLKSWE 414
           L+LIDD++   +N +    +               L+EYQF     HV + +  + ++WE
Sbjct: 350 LTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWE 409

Query: 415 KNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSI 474
           ++GFNDDDI+RMK+   +    Q    +++++N+V++    + +D+ +F I    FT S 
Sbjct: 410 RSGFNDDDIKRMKFGKTE----QGKSKRIIEVNNVTEFQFHV-DDNATFNIKDVCFTKSQ 464

Query: 475 NRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
           N  T +SLS  + +  GLN+CIHYPD YN++ FVECF+SF+E
Sbjct: 465 NLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  405 bits (1042), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 217/525 (41%), Positives = 327/525 (62%), Gaps = 28/525 (5%)

Query: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRLT 63
           FRPL+S+E+ +L +S  +Q NGTIFS+ Y+     + ++  + D  TL T + +++    
Sbjct: 3   FRPLASYERNVLIESYENQTNGTIFSAKYT---DMQTNSTINDDAATLLTQNEENN---M 56

Query: 64  LPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGVP 123
                  L  +I   P L+ TIN + EFEP+ ++KT D+++ I+F + KD+ VNC  G P
Sbjct: 57  FSRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAP 116

Query: 124 PPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNN 183
           P YLLRH FNK +F+PGS +PLW LY++D+++++FHG DVLFDI+SAA+FH+ F   L  
Sbjct: 117 P-YLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEG 175

Query: 184 ISSVTHYEDRILFDINNVSISDLN--FPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFY 241
            ++ T  +   +F ++++S S L   FPKSIYDS  L LPA T  +   QT+ F KS+  
Sbjct: 176 -ATPTSEKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVS 234

Query: 242 NTLKRPFGYLT-NQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300
            T+ +P   +  N   + S  ++  +    DIL   SSLCGTTVFG +SN+RF+YL+SI 
Sbjct: 235 KTIVKPLNIIMFNDEPMKSFTNSDPM----DILEKTSSLCGTTVFGNISNERFDYLQSIA 290

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360
            +E++C +S +CGI M+CLKPL+KDFS  I FSI ++LR  +      GLF+K +RI  P
Sbjct: 291 EEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVP 350

Query: 361 LSLIDDEL-----SVNEFLAXXXXXXXXX-XXXXKLMEYQFNNVTKHVSSFIMAKLKSWE 414
           LS IDD +     S N + A              +L+ YQFN +   +S  +  ++++W 
Sbjct: 351 LSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWR 410

Query: 415 KNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDIS---LSMNNDDKSFKIVSSGFT 471
           +NGFNDDDI+ MK+ + D    +N+  K++QIND+SD+S   ++ N +  S  +    FT
Sbjct: 411 RNGFNDDDIKMMKFGSKD----KNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFT 466

Query: 472 SSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
            S+     +SLSYT+C+  G NICIH+P+ Y+LE FVE F++FI+
Sbjct: 467 HSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  401 bits (1030), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 217/517 (41%), Positives = 322/517 (62%), Gaps = 21/517 (4%)

Query: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRLT 63
           FR L  +EKK+L Q++  +RNG +FSS  +    K++D ++  D  TL T  S ++  L 
Sbjct: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQIT--FNKKSD-EFADDNATLYTGRSVNEVSLK 59

Query: 64  LPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGVP 123
             L A  L+ +I +   L+ TIN+   F P+ Q++T+D++  I ++  KDK +       
Sbjct: 60  SVLCAA-LQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL--MKDQI 116

Query: 124 PPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNN 183
              LLRH FNK  F P + +PLW   + +++ ++FHGHDVLFDIFS ANF K  LKE+N+
Sbjct: 117 SDKLLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMND 176

Query: 184 I--SSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFY 241
           +  S+      + LF  +    S  N+P+SIY++ KLHLPA+T  + + QTQSFFK+I+ 
Sbjct: 177 VLNSNQKLKTVKTLFKFD-AERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQ 235

Query: 242 NTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIVN 301
           NTLK+P   +T+  S ++   +    +  DIL+  +SLCG TV G +S +R+ +LK +V 
Sbjct: 236 NTLKKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVE 295

Query: 302 QEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACPL 361
           QE+I LRSFI  I M+CLKP+VK+F G+I+FSIP++LR  +      GLF+K +++ CPL
Sbjct: 296 QENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPL 355

Query: 362 SLIDDELSVNEFLAXXXXXXXXXXXXXKLMEYQFNNVTKHVSSFIMAKLKSWEKNGFNDD 421
            LI+DE                      L+E QF  +++HVS  I  ++K+WEK GFNDD
Sbjct: 356 ELINDE------KYYTNPEVLHSMQNNSLLEIQFERISRHVSDVISQRMKAWEKFGFNDD 409

Query: 422 DIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDD--KSFKIVSSGFTSSINRPTL 479
           DI+RMK+ ND++  I      ++QINDV++IS    ND+   SF + +  FT S++    
Sbjct: 410 DIKRMKFSNDEKTGI----APIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEF 465

Query: 480 LSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
           +SL Y++  + GLNICIHYPD YN+E+FVECF+SFIE
Sbjct: 466 MSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  337 bits (863), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/526 (36%), Positives = 307/526 (58%), Gaps = 29/526 (5%)

Query: 5   RPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRLTL 64
           R LS +E KLL Q+L  +RNG  F++ Y +     N  D         T  S  D RLTL
Sbjct: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGR-----NYDDSSLSSSDESTLVSLKDRRLTL 58

Query: 65  PLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGVPP 124
            +I   L+ LI     L+  I+E+  +  + +++  D++++I F++ KD+ +NCH G PP
Sbjct: 59  SVITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLG-PP 117

Query: 125 PYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNN- 183
           PYLLRH FNK+ F  G  +PLW LY+IDET ++FHG D+LFD FSAA FHK FL E+N+ 
Sbjct: 118 PYLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSY 177

Query: 184 ISSVTHYEDR----ILFDINN----VSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSF 235
           +SS+   + +     LF +++    + I D   P+SIYD        +T  +F+ QT+SF
Sbjct: 178 MSSIVSSKQKKPLDYLFQLSSSADLIKIYD-EIPRSIYDYDSSPFAPLTAVMFNDQTKSF 236

Query: 236 FKSIFYNTLKRPFGYLTN---QTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQR 292
           FKS++ N +K+P  ++TN   Q          + + Y + +  H SLCG T+FG +S+ R
Sbjct: 237 FKSLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCR 296

Query: 293 FNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFF 352
           FN L     +E I L+S ICG+ M+ LKP + DFS  +VFSI ++LR  +   ++ GL++
Sbjct: 297 FNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYY 356

Query: 353 KELRIACPLSLIDDE-LSVNEFLAXXXXXXXXXXXXXKLMEYQFNNVTKHVSSFIMAKLK 411
           +++ I CPLSLIDD  +  + +               K+ E QF +VT ++ + +  K+ 
Sbjct: 357 RDIIIECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIG 416

Query: 412 SWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMN-NDDKSFKIVSSGF 470
            W+     D+DI+ MK  +     +  SK +++QIND+++I ++ N + +  + + SS  
Sbjct: 417 YWK----TDNDIKMMKMMD----DMHQSKDEIIQINDLTEIDINENLSQNDPYCVKSSSM 468

Query: 471 TSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
            +S+++  + S+SYT+C+  GL I IH P   ++ESFVE F++F++
Sbjct: 469 VTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  328 bits (840), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/535 (37%), Positives = 307/535 (57%), Gaps = 58/535 (10%)

Query: 3   TFRPLSSFEKKLLTQSLNDQ-RNGTIFSSTY-SKSLGKENDADWHSDEVTLGTNSSKDDS 60
             RPLSS EK+ L  SL  + R+G++ S  + S SL   +DA          T  S  D 
Sbjct: 11  VLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDA----------TLLSSKDK 60

Query: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120
            LT+ L++  LK LI +   +F TIN+  EF+ L+++ TSD+++ I FE  KD+ VNCH 
Sbjct: 61  PLTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHS 120

Query: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           G PP YL+ + F+   F P S +PLW L++++ +L+VF+G D LFDIF+ ANF KL  + 
Sbjct: 121 GAPP-YLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEI 179

Query: 181 LNNIS-SVTHYEDRILFDINNV-SISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKS 238
           +N++       +D I+F + N+ +IS +NFPKSIYD+  LHLPA  P++F+ QTQSFFKS
Sbjct: 180 INSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKS 239

Query: 239 IFYNTLKRPFGYL--TNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYL 296
           I+ NT K+ F YL  T QT I    +    K YN+IL+ +S +    V G VS +R+  L
Sbjct: 240 IYLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQL 299

Query: 297 KSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGL------------ 344
             +++ E I L+SF C I ++CLK ++  F G+I+F IP +LR    L            
Sbjct: 300 LKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGP 359

Query: 345 ---GESLGLFFKELRIACPLSLIDDELSVNEFLAXXXXXXXXXXXXXKLMEYQFNNVTKH 401
                 LG+ +K++ +  PL LI  E   NE                 ++E QF  V  +
Sbjct: 360 EDSANELGIIYKDIYVEVPLKLI--EKIGNE----------------DVVEEQFKIVCNY 401

Query: 402 VSSFIMAKLKSWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDK 461
           ++  I  ++K+WEKNGFNDDDI+RMK+  +   +I       +++ND++ + LS +  D 
Sbjct: 402 INESIQKRIKAWEKNGFNDDDIKRMKFGYEQVGNI-------IEVNDLTSLDLSCSK-DS 453

Query: 462 SFKIVSSGFTSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
            F I     T ++ +  +LSLS+      GLN+CI+Y   Y ++ F++CF+SF+E
Sbjct: 454 LFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  278 bits (711), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 172/525 (32%), Positives = 278/525 (52%), Gaps = 27/525 (5%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS 60
           +  +R L+  EK +L ++    +NG +FS+TY K+   ++     SD  TL ++ ++   
Sbjct: 5   LRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKD----LSDNETLRSDMNQ--- 57

Query: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120
           RL+  +I   L ++IK    L   ++   EFEP++++   D+V  IEF+   D++VNC+ 
Sbjct: 58  RLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYN 117

Query: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPP YLLRH F+K  F  G  +PLW L+VID T++VFHGHDVLFD F+AANFHKLFL+ 
Sbjct: 118 GVPP-YLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQA 176

Query: 181 LNNISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240
           LN++S  +    R +F    +  +    P++++   +    +     F+ Q+Q+  +S++
Sbjct: 177 LNSLSE-SCTSPRPVFKGGKILPT---LPRALFQKQEPQAASSITDAFYSQSQAILRSLY 232

Query: 241 YNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300
              +K+P  ++    S     S  Q     + LN  + LCGT VFG +S  RF  LK I+
Sbjct: 233 NLAIKKPLRFI---ESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGIL 289

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360
           N   I +++FI    + CL+P++      I FS+PI+LR  +     LG++ + + I CP
Sbjct: 290 NDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECP 349

Query: 361 LSLIDDE--------LSVNEFLAXXXXXXXXXXXXXKL-MEYQFNNVTKHVSSFIMAKLK 411
           L              +S  E L              +   E  F     HVS+ +   L+
Sbjct: 350 LGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQ 409

Query: 412 SWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFT 471
             E   F D D+  MK + + +F+   S +K+++IND+S+I LS N +   + +     T
Sbjct: 410 DLETGKFKDMDM--MKMEQEAKFYAAASGSKIIEINDLSEIDLS-NVNPSQYVVEDICAT 466

Query: 472 SSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
            S    T +S+SY++    GLN+ IHY +   +  FVE FE+F+E
Sbjct: 467 KSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  250 bits (639), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 162/523 (30%), Positives = 276/523 (52%), Gaps = 26/523 (4%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRL 62
            +R L++ EK ++ ++    +NG +FSSTY +  G +N      D  +   +  K    L
Sbjct: 7   VYRNLTATEKTIICETAAGIKNGVLFSSTYFE--GPDN-----VDNTSPSVSCMKMGKGL 59

Query: 63  TLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGV 122
              ++   L ++IK    L ++IN+  +FE ++ +   D+V  IEF+ L D++V+C+ GV
Sbjct: 60  PDAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGV 119

Query: 123 PPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH F+K  F  G  +PLW ++VID++++VFHGHDVLFD F+AA FHKLFL+ LN
Sbjct: 120 PP-YLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALN 178

Query: 183 NISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFYN 242
           +  +V   +  ++F      I      +S+     + L +         +Q+  K+++  
Sbjct: 179 SFRNVKGQKSDLIFKTREDLIP---LCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSL 235

Query: 243 TLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIVNQ 302
            +K+P  ++ +     S   A+    Y D+ +    LCGT VFG V+ +R   L++++N+
Sbjct: 236 AIKKPLRFIESGRLEHSGIPASN--PY-DLASYAGDLCGTVVFGNVNPERVRGLRALMNE 292

Query: 303 EHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACPLS 362
             I  RSFI  + M CL P+++     I+FS+PI+LR+ +     LG+F   +   CPL 
Sbjct: 293 SKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLD 352

Query: 363 LIDDELSV--------NEFL-AXXXXXXXXXXXXXKLMEYQFNNVTKHVSSFIMAKLKSW 413
           LI  ++           EFL                  +  F  +  HV++ +       
Sbjct: 353 LIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRL 412

Query: 414 EKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSS 473
           EK+  + +D+  +K + +  +   +S++K+V+IND+ ++ LS     + +KI     TSS
Sbjct: 413 EKSHSSGEDL--IKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSR-YKIGDVCSTSS 469

Query: 474 INRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
               T +S+SY   +  GLN+ IHY + +N+E FVE FE F++
Sbjct: 470 RKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  248 bits (634), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 167/523 (31%), Positives = 277/523 (52%), Gaps = 32/523 (6%)

Query: 2   TTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSR 61
           ++ R LSS EK    +    +RNG +F+  YS +  K     W SD++TL   S+  DSR
Sbjct: 6   SSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSN--KCESERW-SDDITL---SNLRDSR 59

Query: 62  LTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWG 121
           L    I+  L+ +IK    L  TI ++ +F P E ++  D+V  IEF+T KD+ + C  G
Sbjct: 60  LFDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNG 119

Query: 122 VPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKEL 181
           +PP Y+LR+     +F  G  RPLW L ++D T+++ H H+V+FD+F+AANFH  F K L
Sbjct: 120 IPP-YILRNILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKAL 176

Query: 182 NNISSVTHYEDRI-LFDINNVSISDLNFP--KSIYDSAKLHLPAMTPQIFHKQTQSFFKS 238
           +     TH  D + +++ N + +S  NF     I  S    LP     +     ++  K 
Sbjct: 177 SQFPKDTHALDILFVYEGNELQLSKTNFDGMSQISVSPVQSLPLQCISVLKGAYRTTVKK 236

Query: 239 IFYNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKS 298
              N ++R F      T+  S  S      +N      ++LCGTTV G ++ +R   L  
Sbjct: 237 SL-NVIRRNFVANNQITTYESSKSDVFKSMFNP-----NTLCGTTVSGSLNAERLASLLE 290

Query: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIA 358
           + + E++C+ S +C I ++ LKPL++ F+G+I F +PID+R+ L + + LG+ +  L + 
Sbjct: 291 LTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFD-LGVSYTNLMVE 349

Query: 359 CPLSLIDDE-----LSVNEFLAXXXXXXXXXXXXXKLMEYQFNNVTKHVSSFIMAKLKSW 413
           CPLS I+D+     +S     +              L+EYQF  +T HV + +  K ++W
Sbjct: 350 CPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAW 409

Query: 414 EKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSS 473
           +K  F+   ++  K    ++      + K ++IN V D+  +    D  F   +  FTSS
Sbjct: 410 QKRRFDMSSLKGKKLRRSNKI----IRGKFIEINLV-DMGEA---QDGQFHTKNVNFTSS 461

Query: 474 INRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
           +    L+S+S    + +G+NI +HYP+S ++++FVECF+  +E
Sbjct: 462 LGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLE 504

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  230 bits (586), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 145/466 (31%), Positives = 247/466 (53%), Gaps = 53/466 (11%)

Query: 67  IATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGVPPPY 126
           I++ L+ +I+    +  T+ +  +F P+ +++  D+V VIEF+T KD+ + CH G+PP Y
Sbjct: 47  ISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPP-Y 105

Query: 127 LLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNNIS- 185
           + RH  NK++F  G  +PLW +Y+ D ++++FH H+VLFD+F+A NFH  F + L     
Sbjct: 106 VARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEK 163

Query: 186 ------SVTHYED---RILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFF 236
                 ++  YE    ++  D +  S+  ++ P           PA +P +      SF 
Sbjct: 164 NEPHNETLFVYEGGPLQLPIDPDACSLPGVDVP----------YPASSPFV------SFV 207

Query: 237 KSIFYNTLKRPFGYLTNQTSISSPASATQLKKYNDILNA-HSSLCGTTVFGIVSNQRFNY 295
           K++    LK PFG L +  + S   + + L +   +L     SL GTTV G +++++ + 
Sbjct: 208 KNVCRYALK-PFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGYLNSKKLDS 266

Query: 296 LKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKEL 355
           L  ++++E +C+RSF+C I ++ LKPL+++F G+I FSIP+DLR         G   K +
Sbjct: 267 LLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRI 326

Query: 356 RIACPLSLIDDELSVNEF-----LAXXXXXXXXXXXXXKLMEYQFNNVTKHVSSFIMAKL 410
            + CPL+LIDD +  + F                     L+EYQF  VT HV   + A+ 
Sbjct: 327 LVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHVMKSLTAQT 386

Query: 411 KSWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGF 470
                   + D   + KY        Q  K K+++IN V D+  S       F+I +  F
Sbjct: 387 --------SGDWTGKRKYSK-----CQLRKKKIIEIN-VVDMGTS---PSARFQIKNMNF 429

Query: 471 TSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516
           T S+   T +SLS    + +G+N+C+HY +  +++ FV+CF++F++
Sbjct: 430 TDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  121 bits (304), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 124/246 (50%), Gaps = 16/246 (6%)

Query: 273 LNAHSSLCGTTVFGIVSNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVF 332
           L   S +    +FG ++ +RFN LK+++ +  ICLRS ICGI M+C KP +++F G I F
Sbjct: 14  LRKDSYIYNRVLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRF 73

Query: 333 SIPIDLRKHLGLGESLGLFFKELRIACPLSLIDDELSVNEFLAXXXXXXXXXXXXXKLME 392
           SI +D++  +      G+  K + + CPL LIDD+                      ++E
Sbjct: 74  SIGVDMKPIVDDSSQFGILKKNIIVDCPLKLIDDK--------HYKDTDSESIKNGDILE 125

Query: 393 YQFNNVTKHVSSFIMAKLKSWEKNGFNDDDIRRMKYD-NDDEFHIQNSKTKLVQINDVSD 451
            QF  VT  V+  +  KL+S  K+       +R     N    + Q S +K++QIND++D
Sbjct: 126 IQFRKVTDFVTEELSNKLQSMAKH------FKRNNCPFNFSSINSQISDSKVIQINDLTD 179

Query: 452 ISLSMNNDD-KSFKIVSSGFTSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVEC 510
           I  +    +   +       T  ++    +SLSY       ++I IHY ++  ++SFVEC
Sbjct: 180 IPFTTTEQNPNGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFVEC 239

Query: 511 FESFIE 516
           F +FIE
Sbjct: 240 FRTFIE 245

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 66/145 (45%), Gaps = 9/145 (6%)

Query: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRLT 63
            R L+  EK  L Q+     NG IFS   SK        D  SD+ TL T     +S   
Sbjct: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKC-----EDNLSDDATLHTTG---ESGNL 53

Query: 64  LPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGVP 123
             L+  +LK LI     L  T++E   F  L+++KT+D+V +I +   K  ++N     P
Sbjct: 54  QLLLLKSLKLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRK-FDINEGLSGP 112

Query: 124 PPYLLRHAFNKTRFIPGSNRPLWTL 148
              L+   +  + F PGS +P   L
Sbjct: 113 SSSLINSIYYHSNFQPGSGKPYGKL 137

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 61/135 (45%), Gaps = 17/135 (12%)

Query: 67  IATTLKRLIKSQPALFA---TINEEWEFEPLEQ-LKTSDIVNVIEFETLKDKEVNCHWGV 122
           I   ++ ++   P L++   T N     EPL+  L  SD+V   E E+L ++  N     
Sbjct: 38  IVQAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDEEHSN----- 92

Query: 123 PPPYLLRHAFNKTRFIPGSNRPLWTLYVI-DETLLVFHGHDVLFDIFSAANFHKLFLKEL 181
                    F +  F+ G+ +PLW + ++ D+   V     ++ D  SA  F   F++ L
Sbjct: 93  -------KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSFMRSL 145

Query: 182 NNISSVTHYEDRILF 196
           N   + + + D ++F
Sbjct: 146 NASHADSTFPDEVVF 160

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 64/150 (42%), Gaps = 15/150 (10%)

Query: 67  IATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIV-NVIEFETLKDKEVNCHWGVPPP 125
           I   +K  ++  P L++ +  + E   LE +    ++  V+E+           +G+   
Sbjct: 38  ICGAIKATVEECPHLYSDVVTKGELPSLEPINEQILLEQVLEYT---------DYGLLDE 88

Query: 126 YLLRHAFNKTRFIPGSNRPLWTLYVI-DETLLVFHGHDVLFDIFSAANFHKLFLKELNNI 184
            +    F +  F  GS +PLW + V+ D   LV     V+ D  S   F K FL  LN  
Sbjct: 89  DICNKIFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWKKFLGSLNAT 148

Query: 185 SSVTHYEDRILFDINNVSISDLNFPKSIYD 214
           +S T     ++F+    S+ +   P+  YD
Sbjct: 149 AS-TSLVSEVVFE---PSVHNSVVPQHPYD 174

>NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.119
           YGR212W
          Length = 470

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 67/302 (22%), Positives = 120/302 (39%), Gaps = 69/302 (22%)

Query: 70  TLKRLIKSQPALFATI--NEEWEFEPLEQLKTS-----DIVNVIEFETLKDKEVNCHWGV 122
            L+  I + P L   I  N+E E+  +E +K +     D+V  + +E  ++KE+N     
Sbjct: 44  ALQDTIATYPQLHQNITKNKEDEYLYVEDIKKTPIEFEDVVEFVAWEKFEEKEINS---- 99

Query: 123 PPPYLLRHAFNKTRFIPGSNRPLWTLYVIDE--TLLVFHGHDVLFDIFSAANFHKLFLKE 180
                    F    F   ++RPLW + V+    T ++   H  LFD  SA    + F+++
Sbjct: 100 --------IFQTYNFHYRNDRPLWKILVVPSLNTFILLLDH-ALFDGISAVKIWETFMEK 150

Query: 181 LNNISSVTHYEDRILFDINNVSIS-DLNFPKSIYDS---AKLHLPAMTPQIFHKQTQSFF 236
           LN  S           +I N+ ++  L  P+  ++    A  H   + P     + +SF 
Sbjct: 151 LNKSS-----------EIENIDVTVPLYIPEENHEGTLVASQHPYDIWPVPIAWKVKSFI 199

Query: 237 KSIFYN-----------------TLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSL 279
            +  +N                   K P G+L+           T  K  ND       +
Sbjct: 200 ATKLFNWYPQAIISPNSNLFEFKGYKFPEGFLSQYPK----DGVTSFKVRNDNTQKLIKM 255

Query: 280 CGTTVFGIVSNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKD-FSGTIV-FSIPID 337
               +  I+ N + N          + L S+I  I +I L+ + ++ ++G ++  SIPI+
Sbjct: 256 APGKLETILKNCKTN---------AVSLTSYIVAIIIIALRNVTQESYTGNLLKVSIPIN 306

Query: 338 LR 339
            R
Sbjct: 307 TR 308

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 64/294 (21%), Positives = 121/294 (41%), Gaps = 53/294 (18%)

Query: 70  TLKRLIKSQPALFATI---NEEWEFEPL-EQLKTSDIVNVIEFETLKDKEVNCHWGVPPP 125
            L+R++ S   L+      N E    P+ E +K  D+V+ ++++T  ++E+N        
Sbjct: 42  ALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEEEINS------- 94

Query: 126 YLLRHAFNKTRFIPGSNRPLWTLYVIDET-LLVFHGHDVLFDIFSAANFHKLFLKELNNI 184
                 F K  F  G ++PLW + V+ +   ++F    + FD  +   F    LK L  +
Sbjct: 95  -----VFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFWTELLKSLEEL 149

Query: 185 SSVTHYEDRILFDINNVSISDLNF-PKSIYDSA-KLHLPAMTPQIFH-KQTQSFFKSIFY 241
                 +D      N++ + ++ + P    DS  + H     P  F  K  +   K++F 
Sbjct: 150 K-----QD------NDLDVDEIIYRPGGSTDSIDQCHPYEKLPIPFSWKVKRPIVKALF- 197

Query: 242 NTLKRPFGYLTNQTSISSPASATQLKKYN---DILNAHSSLCGTTVFGIVSNQ-----RF 293
                    +     +S  AS  Q  +Y    D L  +S+  G       + Q       
Sbjct: 198 --------TIAPGAVVSQDASIIQFDEYKIPEDYLKKNSNDDGCYQIKNTNRQISLKMSS 249

Query: 294 NYLKSIV---NQEHICLRSFICGIAMICLKPLVKD-FSG-TIVFSIPIDLRKHL 342
           N LK I+    Q H+   +++  +  + L  + K+ +SG TI + +P++ R  +
Sbjct: 250 NKLKVIMKDCKQHHVSFTAYLTAVLYLALGKIPKEKYSGSTIKYEVPMNTRNRI 303

>TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {ON}
           Anc_8.326 YLR131C
          Length = 850

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 6/74 (8%)

Query: 10  FEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWH----SDEVTLGTNSSKDDSRLTLP 65
            E++LL   L  Q+  T+F ++Y KS+  EN  + H    S++ TL  NS ++DS    P
Sbjct: 251 LEQQLLENRLEQQKLETVFKTSYDKSV--ENTLNNHTTGISEQDTLKLNSRENDSTPLRP 308

Query: 66  LIATTLKRLIKSQP 79
              +  +R++ S P
Sbjct: 309 TSISPSRRIVTSNP 322

>SAKL0G15004g Chr7 (1288241..1289611) [1371 bp, 456 aa] {ON} similar
           to uniprot|P53304 Saccharomyces cerevisiae YGR212W SLI1
           N-acetyltransferase confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           inactivating it co-operates with Ypk1p in mediating
           resistance to myriocin converts myriocin into N-acetyl-
           myriocin
          Length = 456

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 61/132 (46%), Gaps = 17/132 (12%)

Query: 66  LIATTLKRLIKSQPALFATI---NEEWEFEPLEQ-LKTSDIVNVIEFETLKDKEVNCHWG 121
           L++  + ++I   P L++ +   +E+   +P+E  +  +D+V  ++ E L ++       
Sbjct: 37  LLSHVITKVIPRYPQLYSNVFLQDEKPIVKPIESFIYFNDVVEYMQEEQLTEE------- 89

Query: 122 VPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETL-LVFHGHDVLFDIFSAANFHKLFLKE 180
                L+   F   +F    + P+W +  ++    LV     + FD  S   F +  ++E
Sbjct: 90  -----LINQIFRTVKFKYHDDVPIWKILALNGGRSLVLCLEHLFFDGLSGVKFLENIMEE 144

Query: 181 LNNISSVTHYED 192
           LN I   ++Y+D
Sbjct: 145 LNTIECFSNYQD 156

>TBLA0E03830 Chr5 (964482..965252) [771 bp, 256 aa] {ON} Anc_2.245
           YNL063W
          Length = 256

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 14/84 (16%)

Query: 167 IFSAANFH--KLFLKELNNISSVTHYEDRI-LFDINNVSISDLNFPKSIYDSAKLHLPAM 223
           IF+  N +  KL  K++NN  +  H+E+ I +   N   I  LN+  S+  S KL+ P++
Sbjct: 158 IFNQLNLYDVKLIRKDINNCQTPIHFENHIDILTCNPPYIPTLNYNSSVSTSVKLYEPSL 217

Query: 224 TPQ---IFHKQ--------TQSFF 236
             +   IF+K         T SFF
Sbjct: 218 ALKGDLIFYKTLLTRYLPFTDSFF 241

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 44/104 (42%), Gaps = 8/104 (7%)

Query: 226 QIFHKQTQSFFKSIFYNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSS---LCGT 282
           QIF  Q    F  + YN  K+ +    N  + ++ +   QL++   I+N+  S      T
Sbjct: 214 QIFETQQ---FNDLMYN--KKWYSISNNNENTTTDSLFLQLQRVTSIINSRMSERAFIST 268

Query: 283 TVFGIVSNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDF 326
            +F    N+  NYL S  +  +     FI  +    L P+ KD 
Sbjct: 269 KMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTVLPPIFKDI 312

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 419 NDDDIRRMKYDNDDEFHIQNSKTKLVQINDV 449
           NDDDIR M  DN D+  + N  T++ ++++V
Sbjct: 333 NDDDIRSMPDDNVDDVLLSNEVTEIEELDNV 363

>Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON}
           (113037..114482) [1446 nt, 482 aa]
          Length = 481

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 15/97 (15%)

Query: 95  EQLKTSDIVNVIEFETLKDKEVNCHWGVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDET 154
           E++  +DIV    ++++ +  +N              F +  F   +++P+W + V++  
Sbjct: 76  EKIYFADIVEYKNWDSVSESNINS------------IFQEYSFEYFTDKPVWKILVLENQ 123

Query: 155 --LLVFHGHDVLFDIFSAANFHKLFLKELNNISSVTH 189
             LL+   H VLFD  S  NF   F+  L +I S++ 
Sbjct: 124 NQLLMLLDH-VLFDGMSGINFWNSFISSLPSIDSISE 159

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,433,998
Number of extensions: 2729462
Number of successful extensions: 9714
Number of sequences better than 10.0: 62
Number of HSP's gapped: 9977
Number of HSP's successfully gapped: 62
Length of query: 516
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 402
Effective length of database: 40,409,475
Effective search space: 16244608950
Effective search space used: 16244608950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)