Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.4796.6ON62623106e-39
Skud_16.66.6ON62622984e-37
YPL271W (ATP15)6.6ON62622976e-37
Suva_16.346.6ON62622691e-32
NDAI0I027406.6ON66592049e-23
Kpol_1045.826.6ON62621952e-21
TPHA0J002306.6ON62611935e-21
ZYRO0F00418g6.6ON62611919e-21
TDEL0G046506.6ON62601891e-20
Sklu_YGOB_Anc_6.66.6ON61621856e-20
KAFR0B064906.6ON66611857e-20
CAGL0A01111g6.6ON69591857e-20
KNAG0E027906.6ON65611858e-20
Kwal_56.223336.6ON62601804e-19
NCAS0D022006.6ON85571791e-18
Klac_YGOB_Anc_6.66.6ON61621762e-18
TBLA0A072006.6ON65571727e-18
Kthe_YGOB_Anc_6.66.6ON62601727e-18
Ecym_30086.6ON61621405e-13
ACR021W6.6ON62621283e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.479
         (62 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...   124   6e-39
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)      119   4e-37
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...   119   6e-37
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)   108   1e-32
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    83   9e-23
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    80   2e-21
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    79   5e-21
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    78   9e-21
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    77   1e-20
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    76   6e-20
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    76   7e-20
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    76   7e-20
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    76   8e-20
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    74   4e-19
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    74   1e-18
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    72   2e-18
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    71   7e-18
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    71   7e-18
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    59   5e-13
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    54   3e-11

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score =  124 bits (310), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

Query: 61 TK 62
          TK
Sbjct: 61 TK 62

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score =  119 bits (298), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 59/62 (95%), Positives = 61/62 (98%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MSAWRKAGISYAAYLNVAA+ IRSSLKTELQTASVLSRSKTDAFYT+YKNGAAASEPTPI
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

Query: 61 TK 62
          TK
Sbjct: 61 TK 62

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score =  119 bits (297), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 58/62 (93%), Positives = 61/62 (98%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MSAWRKAGISYAAYLNVAA+AIRSSLKTELQTASVL+RS+TDAFYTQYKNG AASEPTPI
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

Query: 61 TK 62
          TK
Sbjct: 61 TK 62

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score =  108 bits (269), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 52/62 (83%), Positives = 58/62 (93%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MSAWRKAG+SYAAYLNVAA+ IRSSLKTELQTA+VLSRS+TDA+YT+YKNG AASEP  I
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60

Query: 61 TK 62
          TK
Sbjct: 61 TK 62

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 83.2 bits (204), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 52/59 (88%)

Query: 4  WRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPITK 62
          WRKAGI+Y+AYL++AA+ +R++LK ELQTA+V++RS TDA++T+YK+GA ASEP  + K
Sbjct: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 79.7 bits (195), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 48/62 (77%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MSAWRKAGI+Y  Y+N+AA+ +R +LK EL+T +VL+RSKT+A +  ++NGA   EP PI
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

Query: 61 TK 62
           +
Sbjct: 61 QQ 62

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 79.0 bits (193), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MS WRKAG++Y+ YL VAAK +R SLK +L+T SVLSRSKTD  YT ++ G A SEPT I
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

Query: 61 T 61
          +
Sbjct: 61 S 61

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 78.2 bits (191), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 47/61 (77%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MSAWRKAG++Y AYL+VAAK +RS+LK E QTA+VLSR + D+ YT+++ G    EP P+
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

Query: 61 T 61
           
Sbjct: 61 V 61

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 77.4 bits (189), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 49/60 (81%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          M+AWRKAG++Y  YL+VAA+ +R++LK ELQ A VL+RSKTDA Y +Y+ G+AAS+  P+
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 75.9 bits (185), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 50/62 (80%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MSAWRKAG++Y  YL++AAK +R++LKTE QTA VLSRSK++A + +++NG   S+P P+
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENG-TPSDPIPL 59

Query: 61 TK 62
           K
Sbjct: 60 KK 61

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 75.9 bits (185), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 47/61 (77%)

Query: 2  SAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPIT 61
          S WRKAG++YA+YL++A+K +R  LKTE QTA+V SRS T+A  T YKNG+  S+P P+ 
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62

Query: 62 K 62
          K
Sbjct: 63 K 63

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 75.9 bits (185), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 47/59 (79%)

Query: 2  SAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          +AWRKAG+SY+++L +AA+ +R SLK ELQT +V+ R KTDA YT+Y+ G+  S+P P+
Sbjct: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 75.9 bits (185), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 46/61 (75%), Gaps = 1/61 (1%)

Query: 1  MSA-WRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTP 59
          MSA W+KAGI+YA YLNV AK +RS+LK ELQT +VLSR  TDA YT Y+ G   ++P P
Sbjct: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60

Query: 60 I 60
          +
Sbjct: 61 L 61

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 73.9 bits (180), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (76%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MSAWRKAG++Y  Y+ +AA+ +RS+LK E QTA VL RSKT+A + +Y+NG A +E  P+
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 73.6 bits (179), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 46/57 (80%)

Query: 4  WRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
           RKAG++YA YL VA++ +R+SLKTELQT  V++RS TDA+YT+Y+ G+  ++P P+
Sbjct: 24 LRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPL 80

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 72.4 bits (176), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 49/62 (79%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MS WRKAG+++  Y++VAA  +R++LK ELQT SVL+RSK++A + +++NG  ASEP P+
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENG-VASEPVPL 59

Query: 61 TK 62
           K
Sbjct: 60 KK 61

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 70.9 bits (172), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (80%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEP 57
          MSAWRKAGI+Y AY+ +AAK +R++LK ELQTA+V+ RS T+A +T+Y  G+  ++P
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADP 57

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 70.9 bits (172), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 45/60 (75%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MSAWRKAG++Y  Y+ +AA+ +RS+LK +LQTA VL RSKT+A + +Y+ G   +E  P+
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 58.5 bits (140), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 48/62 (77%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MSAWRKAG+SY  Y+ VAA+A+RS+LK EL+ A+VLSRS T+A    YK+G AAS+  P+
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDG-AASDAVPL 59

Query: 61 TK 62
           K
Sbjct: 60 KK 61

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 53.9 bits (128), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 46/62 (74%)

Query: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60
          MSAWRKAG++Y +YL VAA+ +R++LK ELQ+ +VL+RS T+A    Y +  +A+E  P+
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60

Query: 61 TK 62
           K
Sbjct: 61 RK 62

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.117    0.316 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,221,791
Number of extensions: 117831
Number of successful extensions: 270
Number of sequences better than 10.0: 20
Number of HSP's gapped: 270
Number of HSP's successfully gapped: 20
Length of query: 62
Length of database: 53,481,399
Length adjustment: 35
Effective length of query: 27
Effective length of database: 49,468,089
Effective search space: 1335638403
Effective search space used: 1335638403
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)