Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.4786.5ON77375435860.0
YPL270W (MDL2)6.5ON77375433330.0
Skud_16.76.5ON77375432350.0
Suva_16.356.5ON76775532140.0
CAGL0A01133g6.5ON80160923490.0
NDAI0I027306.5ON83267523110.0
NCAS0D022106.5ON77360122930.0
ZYRO0F00396g6.5ON73269322850.0
Kpol_1045.836.5ON74860922860.0
TDEL0G046606.5ON73968522800.0
TPHA0J002206.5ON74062922220.0
TBLA0A071906.5ON79459221960.0
KNAG0E028006.5ON74167621380.0
SAKL0E00748g6.5ON77463021320.0
Kwal_56.223296.5ON77661921100.0
KLTH0C11616g6.5ON74062120860.0
KLLA0D00748g6.5ON78960020810.0
ACR022W6.5ON75462220590.0
Ecym_30076.5ON76961219910.0
KAFR0B064806.5ON75169219630.0
TPHA0B046201.67ON72061213571e-177
NCAS0B087001.67ON71562513501e-176
NDAI0A005601.67ON71462113491e-176
YLR188W (MDL1)1.67ON69559713301e-173
KLLA0C01991g1.67ON70659613291e-173
Kpol_2000.791.67ON70760813291e-173
Skud_12.2531.67ON69260413221e-172
TDEL0C063501.67ON69359513211e-172
Smik_12.2481.67ON69659813121e-171
Suva_10.2841.67ON69362613091e-170
SAKL0C02244g1.67ON71261213051e-169
Ecym_10721.67ON68359613001e-169
ZYRO0F17050g1.67ON71468112881e-167
KLTH0F02024g1.67ON73462212841e-166
AFR683C1.67ON67759812641e-164
Kwal_33.133081.67ON70660812551e-162
TBLA0A053001.67ON70761812251e-157
CAGL0E00385g1.67ON60859812081e-156
YKL209C (STE6)1.527ON12905255425e-57
TDEL0F003401.527ON12575205312e-55
SAKL0H00968g5.20ON7004655078e-54
KLTH0B09482g5.20ON6945995079e-54
Kwal_26.94805.20ON7194585024e-53
KAFR0I025805.20ON7094544945e-52
KLLA0A10131g5.20ON7204614911e-51
Suva_11.111.527ON12905264992e-51
Kpol_1018.1851.527ON12765084841e-49
KNAG0E013205.20ON6953534742e-49
TBLA0B100701.527ON12965234822e-49
Skud_11.111.527ON12955224771e-48
Skud_13.4755.20ON6914384672e-48
Smik_13.5185.20ON6875254635e-48
Suva_13.4915.20ON6934364645e-48
TBLA0C070005.20ON7253284611e-47
YMR301C (ATM1)5.20ON6904384592e-47
TPHA0L022705.20ON7115264592e-47
KAFR0E002301.527ON12705014635e-47
ZYRO0G02244g1.527ON12734914628e-47
NCAS0D024305.20ON7024454531e-46
Ecym_56495.20ON6963304512e-46
KNAG0G001901.527ON12755544564e-46
AGL335W5.20ON6914334468e-46
TDEL0G004305.20ON6965624451e-45
NDAI0I024405.20ON7305484442e-45
Smik_11.141.527ON13165404484e-45
Kpol_513.235.20ON7083284407e-45
ZYRO0D07106g5.20ON7095334353e-44
NDAI0D015401.527ON12935184404e-44
NCAS0G035101.527ON12885224388e-44
CAGL0K00363g1.527ON12275424379e-44
SAKL0A10208g1.527ON13105024333e-43
AFR432W1.527ON12845124324e-43
CAGL0M13739g5.20ON7274444231e-42
TPHA0O001601.527ON12535104236e-42
Ecym_36121.527ON13155104192e-41
KLLA0B14256g1.527ON12712414111e-40
NCAS0E041605.10ON15065724022e-39
KLTH0B01100g1.527ON12985204022e-39
NDAI0B006405.10ON14915543988e-39
NCAS0J00160singletonON16545183908e-38
CAGL0E03982g4.6ON16594933881e-37
KAFR0C065105.10ON14575293853e-37
YGR281W (YOR1)5.10ON14775583819e-37
Kwal_33.155611.527ON12975103801e-36
TPHA0C009608.303ON15235713782e-36
NCAS0C059304.6ON16575213782e-36
ZYRO0G07612g4.6ON16955013755e-36
CAGL0E03355g4.52ON15355483738e-36
NDAI0J011508.303ON15175303721e-35
SAKL0H26026g4.6ON16535323721e-35
Ecym_84184.6ON16785463712e-35
Skud_7.6145.10ON14775633702e-35
CAGL0G00242g5.10ON14775653702e-35
TBLA0G007104.6ON16914913692e-35
Smik_16.275.10ON14775563693e-35
KNAG0E011204.6ON17175573684e-35
Smik_12.484.52ON15575333684e-35
Ecym_42658.303ON15054973674e-35
Kwal_34.157704.6ON14365033665e-35
Suva_7.5775.10ON14785603658e-35
Suva_10.234.6ON16615753641e-34
KNAG0K001705.10ON14425313641e-34
TDEL0G018504.6ON16424823641e-34
KLLA0E00529g4.6ON16504953631e-34
Smik_8.64.6ON15855213622e-34
YHL035C (VMR1)4.6ON15925433622e-34
Kpol_311.34.6ON16575063622e-34
TPHA0F001804.6ON16465533595e-34
KNAG0J027304.52ON15375453595e-34
KLTH0H16038g4.6ON16495033551e-33
TPHA0A056205.10ON14775633542e-33
YLL048C (YBT1)4.6ON16615513532e-33
TDEL0E056104.52ON15355403523e-33
SAKL0H00704g5.10ON14395723496e-33
Smik_12.114.6ON16615273498e-33
NDAI0H001904.6ON16825103489e-33
Zrou_YGOB_Anc_5.105.10ON9925883479e-33
Skud_4.3958.303ON15164863481e-32
KLTH0C09240gna 1ON15465503443e-32
TBLA0A06840singletonON10585503433e-32
TPHA0K023104.6ON16494833425e-32
Skud_12.524.52ON15615383417e-32
Kpol_1060.75.10ON14605623417e-32
Skud_12.224.6ON16615283417e-32
Kpol_1033.288.303ON15315463409e-32
NCAS0B034708.303ON15124853391e-31
YDR135C (YCF1)8.303ON15154873362e-31
KLTH0B09724g5.10ON14865563363e-31
Kwal_56.22747na 1ON15383213354e-31
Smik_4.3808.303ON15164793344e-31
ACL072C4.6ON16274823345e-31
KAFR0L001904.6ON16535523327e-31
TBLA0C071005.10ON14855693311e-30
Suva_2.2978.303ON15164863311e-30
Kwal_26.95325.10ON14715603311e-30
KAFR0B056308.303ON15154883301e-30
TBLA0C06400singletonON13775583282e-30
Suva_8.164.6ON15994943273e-30
CAGL0C03289g4.6ON16484933273e-30
Suva_10.60singletonON9905493254e-30
Suva_10.594.52ON15615483265e-30
KAFR0I013004.52ON15365413256e-30
KNAG0I009908.303ON15354893256e-30
ZYRO0G22176g4.52ON15705223247e-30
YLL015W (BPT1)4.52ON15595453221e-29
KLLA0C14234g5.10ON14545403212e-29
Skud_8.94.6ON15875223183e-29
KLTH0B00396gsingletonON15072453184e-29
Kwal_56.238448.303ON14944863184e-29
TPHA0F004104.52ON15705593175e-29
SAKL0H16016g8.303ON14995243166e-29
TDEL0G003305.10ON14655843166e-29
YKR104WsingletonON3062802979e-29
KLLA0F20075g8.303ON15164753132e-28
KLTH0G12716g8.303ON15002493095e-28
ZYRO0D06160g8.303ON15252913077e-28
AGR047W8.303ON14925283069e-28
TDEL0F043008.303ON15145043023e-27
Kpol_YGOB_1041.454.52ON15685502971e-26
Skud_18.2singletonON15802492971e-26
Kpol_1041.45singletonOFF15965502962e-26
TBLA0A038008.303ON15465552962e-26
SAKL0H23958g4.52ON15582892952e-26
CAGL0L06402g8.303ON15352512943e-26
KLLA0D04059g4.52ON15685402943e-26
Smik_11.367na 2ON15955332934e-26
AGL346W5.10ON14005052586e-22
Ecym_56605.10ON15362652103e-16
YKR103W (NFT1)na 2ON12182201987e-15
ACR128C8.661ON8271871843e-13
YPL147W (PXA1)8.661ON8702531834e-13
SAKL0D10208g1.366ON7522371782e-12
Smik_6.3448.661ON8702321754e-12
Suva_16.1638.661ON8702061754e-12
Kpol_175.1singletonON13774371737e-12
Kwal_26.87308.661ON8312101711e-11
KLTH0D10890g8.661ON8302501701e-11
Skud_16.1358.661ON8702321701e-11
KNAG0I005301.427ON10472421692e-11
TDEL0B057601.427ON10362711682e-11
SAKL0H21010gsingletonON14472391683e-11
NDAI0H035701.366ON7552071673e-11
CAGL0K10472g1.366ON7522121673e-11
Ecym_24108.661ON8281911664e-11
AEL032W1.366ON7532411664e-11
KNAG0C019601.366ON7522391655e-11
KLTH0H12760g1.427ON10202651656e-11
TPHA0D011708.661ON9152561656e-11
TBLA0D043501.427ON11192491648e-11
KNAG0A029808.661ON8712471631e-10
SAKL0D09394g1.427ON10272741621e-10
YER036C (ARB1)3.534ON6102881611e-10
Ecym_11943.534ON6093281611e-10
KLLA0F11484g8.661ON8452081611e-10
KAFR0C045401.366ON7522391612e-10
ZYRO0E08800g3.534ON6103261602e-10
Smik_5.1593.534ON6102341602e-10
ZYRO0E04092g1.427ON10622441602e-10
KLTH0H13442g1.366ON7522411583e-10
NDAI0E012408.661ON8972081584e-10
SAKL0F01606g3.534ON6082751574e-10
Kwal_23.51613.220ON14892351584e-10
YOL075C3.133ON12942491584e-10
TDEL0A060708.661ON8721931575e-10
Suva_5.1343.534ON6101881565e-10
AER190W1.427ON10112711575e-10
ZYRO0D11880g5.500ON14982371575e-10
Skud_5.1453.534ON6101881565e-10
TBLA0I033303.534ON6103171566e-10
ZYRO0B05588g3.133ON12702341567e-10
Skud_4.2623.220ON15012361567e-10
KLLA0A10857g1.366ON7522261558e-10
ZYRO0G01144g1.366ON7522351559e-10
KLLA0D04554g1.427ON10222441559e-10
Kpol_1043.431.366ON7522331541e-09
SAKL0C11616g3.220ON14842361551e-09
KAFR0A037908.661ON8762091541e-09
ZYRO0F07018g8.661ON8612001541e-09
KLTH0A01914g3.220ON14992321541e-09
Suva_15.913.133ON13022471541e-09
NCAS0F00410singletonON15312701541e-09
YNR070W (PDR18)na 3ON13332481541e-09
AGL142CsingletonON14972371531e-09
NCAS0A085701.427ON10602471532e-09
TBLA0C012201.366ON7512371522e-09
TBLA0D01820singletonON15512341532e-09
KNAG0B038705.500ON15132391522e-09
CAGL0C02343g3.534ON7202721512e-09
KNAG0K013503.220ON15012731522e-09
TBLA0D017805.500ON15952341522e-09
ZYRO0B14762gsingletonON15152441522e-09
KAFR0C052205.500ON14992321522e-09
Smik_7.3131.366ON7522121512e-09
KAFR0C00820na 4ON15173511513e-09
Kwal_34.162401.366ON7522411503e-09
TDEL0D040403.220ON15002331513e-09
TPHA0A008403.133ON13122341513e-09
CAGL0I04862g3.220ON15072501513e-09
Ecym_36043.220ON14742381513e-09
TPHA0A023101.366ON7522351503e-09
Smik_15.843.133ON12952361503e-09
NCAS0A120605.500ON15432351503e-09
Skud_4.6805.500ON14452411504e-09
Skud_4.681na 5ON14452411504e-09
Kwal_0.3271.427ON10192441504e-09
KNAG0K009503.133ON12842851504e-09
SAKL0H06908g8.661ON8361861494e-09
YDR011W (SNQ2)3.220ON15012361504e-09
YFR009W (GCN20)1.366ON7522121494e-09
ZYRO0D11836gna 6ON14622601495e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.478
         (773 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...  1385   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...  1288   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)  1250   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...  1242   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   909   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   894   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      887   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   884   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   885   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   882   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   860   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   850   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   828   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   825   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   817   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   808   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   806   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   797   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   771   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   760   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   527   e-177
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   524   e-176
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   524   e-176
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   516   e-173
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   516   e-173
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   516   e-173
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   513   e-172
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   513   e-172
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   509   e-171
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   508   e-170
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   507   e-169
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   505   e-169
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   500   e-167
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   499   e-166
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   491   e-164
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   488   e-162
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   476   e-157
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   469   e-156
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   213   5e-57
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   209   2e-55
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   199   8e-54
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   199   9e-54
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   197   4e-53
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   194   5e-52
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   193   1e-51
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   196   2e-51
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   191   1e-49
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   187   2e-49
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   190   2e-49
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   188   1e-48
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   184   2e-48
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   182   5e-48
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   183   5e-48
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   182   1e-47
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   181   2e-47
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   181   2e-47
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   182   5e-47
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   182   8e-47
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     179   1e-46
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   178   2e-46
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   180   4e-46
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   176   8e-46
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   176   1e-45
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   175   2e-45
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   177   4e-45
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   174   7e-45
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   172   3e-44
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   174   4e-44
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   173   8e-44
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   172   9e-44
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   171   3e-43
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   171   4e-43
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   167   1e-42
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   167   6e-42
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   166   2e-41
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   162   1e-40
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    159   2e-39
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   159   2e-39
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    157   8e-39
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   154   8e-38
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   154   1e-37
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   152   3e-37
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   151   9e-37
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   150   1e-36
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   150   2e-36
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   150   2e-36
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   149   5e-36
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   148   8e-36
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   147   1e-35
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   147   1e-35
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   147   2e-35
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   147   2e-35
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   147   2e-35
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   146   2e-35
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   146   3e-35
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   146   4e-35
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   146   4e-35
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   145   4e-35
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   145   5e-35
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   145   8e-35
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   144   1e-34
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   144   1e-34
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   144   1e-34
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   144   1e-34
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   144   2e-34
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   144   2e-34
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   144   2e-34
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   142   5e-34
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   142   5e-34
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   141   1e-33
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   140   2e-33
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   140   2e-33
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   140   3e-33
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   139   6e-33
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   139   8e-33
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   138   9e-33
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   138   9e-33
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   138   1e-32
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   137   3e-32
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   136   3e-32
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   136   5e-32
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   135   7e-32
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   135   7e-32
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   135   7e-32
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   135   9e-32
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   135   1e-31
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   134   2e-31
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   134   3e-31
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   133   4e-31
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   133   4e-31
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   133   5e-31
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   132   7e-31
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           132   1e-30
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   132   1e-30
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   132   1e-30
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   131   1e-30
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   130   2e-30
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   130   3e-30
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   130   3e-30
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   129   4e-30
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   130   5e-30
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   129   6e-30
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   129   6e-30
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   129   7e-30
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   128   1e-29
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   128   2e-29
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   127   3e-29
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   127   4e-29
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   127   4e-29
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   126   5e-29
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   126   6e-29
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   126   6e-29
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   119   9e-29
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   125   2e-28
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   123   5e-28
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   122   7e-28
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   122   9e-28
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   120   3e-27
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   119   1e-26
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   119   1e-26
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   118   2e-26
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   118   2e-26
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   118   2e-26
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   117   3e-26
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   117   3e-26
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   117   4e-26
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   103   6e-22
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    86   3e-16
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    81   7e-15
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    75   3e-13
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    75   4e-13
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    73   2e-12
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    72   4e-12
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    72   4e-12
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    71   7e-12
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    70   1e-11
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    70   1e-11
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    70   1e-11
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    70   2e-11
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    69   2e-11
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    69   3e-11
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    69   3e-11
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    69   3e-11
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    69   4e-11
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    69   4e-11
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    68   5e-11
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    68   6e-11
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    68   6e-11
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    68   8e-11
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    67   1e-10
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    67   1e-10
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    67   1e-10
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    67   1e-10
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    67   1e-10
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    67   2e-10
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    66   2e-10
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    66   2e-10
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    66   2e-10
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    65   3e-10
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     65   4e-10
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    65   4e-10
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    65   4e-10
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    65   4e-10
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    65   5e-10
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    65   5e-10
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    65   5e-10
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    65   5e-10
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    65   5e-10
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    65   6e-10
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    65   7e-10
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    65   7e-10
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    64   8e-10
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    64   9e-10
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    64   9e-10
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    64   1e-09
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    64   1e-09
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    64   1e-09
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    64   1e-09
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    64   1e-09
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    64   1e-09
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                64   1e-09
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    64   1e-09
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    64   1e-09
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    64   2e-09
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    63   2e-09
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              64   2e-09
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    63   2e-09
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    63   2e-09
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    63   2e-09
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    63   2e-09
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    63   2e-09
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    63   2e-09
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    63   2e-09
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              63   3e-09
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    62   3e-09
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    63   3e-09
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    63   3e-09
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    63   3e-09
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    63   3e-09
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    62   3e-09
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    62   3e-09
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    62   3e-09
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    62   4e-09
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    62   4e-09
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    62   4e-09
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    62   4e-09
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    62   4e-09
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    62   4e-09
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    62   4e-09
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    62   5e-09
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            62   5e-09
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    62   6e-09
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    62   6e-09
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    62   6e-09
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       61   7e-09
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             62   7e-09
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    62   7e-09
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    61   7e-09
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    61   8e-09
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    61   9e-09
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    61   9e-09
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    61   9e-09
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    61   1e-08
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    61   1e-08
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    60   1e-08
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    60   1e-08
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    61   1e-08
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    60   1e-08
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    61   1e-08
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    60   1e-08
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    61   1e-08
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    60   1e-08
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    60   1e-08
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    60   1e-08
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    60   2e-08
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    60   2e-08
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    60   2e-08
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    60   2e-08
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    60   2e-08
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    60   2e-08
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    60   2e-08
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    60   2e-08
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    60   2e-08
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    60   2e-08
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    59   2e-08
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    60   2e-08
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    60   3e-08
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    60   3e-08
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    59   3e-08
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    59   3e-08
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    59   4e-08
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    59   4e-08
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 59   4e-08
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    59   4e-08
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    59   4e-08
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    59   5e-08
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    59   5e-08
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    59   5e-08
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    59   5e-08
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    59   5e-08
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    59   5e-08
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    59   5e-08
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    59   6e-08
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    58   6e-08
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    59   6e-08
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     59   6e-08
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    59   6e-08
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    59   7e-08
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    58   7e-08
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    58   8e-08
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    58   8e-08
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            58   8e-08
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    56   9e-08
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    57   1e-07
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    57   1e-07
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    57   1e-07
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    57   1e-07
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    57   1e-07
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    57   1e-07
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    52   2e-07
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    57   2e-07
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    57   2e-07
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    57   2e-07
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    57   2e-07
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    56   2e-07
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    57   2e-07
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    56   3e-07
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    56   3e-07
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    56   3e-07
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    55   3e-07
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    56   3e-07
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    56   3e-07
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    56   4e-07
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    56   4e-07
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    56   4e-07
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    56   4e-07
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    56   4e-07
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    55   4e-07
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    55   4e-07
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    56   4e-07
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    55   5e-07
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    55   5e-07
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    55   5e-07
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    55   6e-07
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    55   6e-07
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    55   7e-07
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    55   7e-07
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    55   8e-07
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    55   8e-07
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    54   8e-07
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    55   9e-07
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     55   9e-07
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    54   1e-06
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    54   1e-06
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    54   1e-06
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    54   1e-06
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    54   1e-06
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    54   1e-06
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    54   1e-06
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    54   1e-06
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    54   2e-06
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    54   2e-06
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    54   2e-06
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    54   2e-06
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    54   2e-06
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    53   2e-06
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    53   2e-06
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    53   3e-06
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    53   3e-06
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    53   3e-06
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    53   3e-06
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    53   3e-06
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    53   4e-06
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    52   4e-06
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    52   5e-06
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    52   5e-06
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    52   5e-06
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    52   5e-06
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    52   7e-06
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    52   8e-06
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    51   9e-06
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    51   1e-05
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    50   1e-05
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    50   1e-05
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    50   2e-05
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    50   2e-05
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    50   2e-05
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    50   3e-05
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    49   3e-05
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              49   4e-05
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    49   4e-05
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    49   4e-05
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    49   4e-05
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    49   5e-05
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    49   6e-05
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    48   8e-05
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    48   1e-04
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    47   1e-04
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    48   1e-04
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    47   1e-04
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    46   1e-04
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    47   1e-04
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    47   2e-04
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    47   2e-04
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    47   2e-04
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    47   2e-04
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    47   2e-04
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    46   2e-04
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    45   3e-04
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    46   4e-04
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    46   5e-04
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    45   5e-04
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    45   6e-04
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    45   7e-04
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    45   7e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    45   8e-04
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    45   8e-04
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    45   9e-04
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    45   0.001
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    45   0.001
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    45   0.001
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    45   0.001
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    44   0.001
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    45   0.001
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    45   0.001
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    45   0.001
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    45   0.001
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    44   0.001
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    44   0.001
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    44   0.002
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    44   0.002
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    43   0.002
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    44   0.002
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    44   0.002
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    44   0.002
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    44   0.002
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    44   0.002
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    44   0.002
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    44   0.002
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    44   0.002
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    43   0.003
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    43   0.003
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    43   0.003
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    43   0.003
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    43   0.004
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    43   0.004
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    43   0.004
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    43   0.004
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    43   0.004
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    43   0.004
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    42   0.004
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    42   0.004
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    42   0.004
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    42   0.004
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    42   0.005
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    42   0.005
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    42   0.005
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    42   0.005
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    42   0.006
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    41   0.006
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    42   0.007
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     42   0.007
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    42   0.008
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    41   0.008
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    42   0.009
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    41   0.009
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    42   0.009
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    42   0.010
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    41   0.010
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    40   0.011
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    41   0.011
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    41   0.012
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    41   0.013
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    41   0.013
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    41   0.013
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    41   0.014
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    41   0.014
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    41   0.014
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    41   0.015
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    41   0.015
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    40   0.018
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    40   0.021
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    39   0.031
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    39   0.035
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    40   0.036
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    39   0.036
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    39   0.056
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    38   0.056
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    38   0.062
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    38   0.062
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    38   0.076
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    38   0.080
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    38   0.11 
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    38   0.11 
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    38   0.12 
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    37   0.15 
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    37   0.20 
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    36   0.32 
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    35   0.44 
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    35   0.57 
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    35   0.62 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    35   0.64 
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    35   0.70 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    35   0.73 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    35   0.79 
Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {O...    35   0.95 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    34   1.4  
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    34   1.7  
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    34   1.8  
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    34   1.8  
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    33   2.1  
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    33   3.9  
Suva_43.1 Chr43 (2..1099) [1098 bp, 366 aa] {ON} YDR011W (REAL)        32   4.0  
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    32   5.3  
NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.2...    32   7.9  

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score = 1385 bits (3586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/754 (91%), Positives = 689/754 (91%)

Query: 20  RPRMTKLPFMRFRSLVTHSSSQLILINPLHTRSPIIGKTLILSSFRYISSKTKLQAPLPX 79
           RPRMTKLPFMRFRSLVTHSSSQLILINPLHTRSPIIGKTLILSSFRYISSKTKLQAPLP 
Sbjct: 20  RPRMTKLPFMRFRSLVTHSSSQLILINPLHTRSPIIGKTLILSSFRYISSKTKLQAPLPS 79

Query: 80  XXXXXXXXXXXXXXTEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKV 139
                         TEQSKTDDYKDIIRLFMLAKRDWK           SCSIGMSIPKV
Sbjct: 80  VSSTSKGSSKSAHSTEQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKV 139

Query: 140 IGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERV 199
           IGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERV
Sbjct: 140 IGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERV 199

Query: 200 VARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVG 259
           VARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVG
Sbjct: 200 VARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVG 259

Query: 260 VGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT 319
           VGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT
Sbjct: 260 VGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT 319

Query: 320 VQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ 379
           VQSFVAEGNELSRYNVAIRDIFQVG              SLLGDLSFLTVLAYGSYLVLQ
Sbjct: 320 VQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQ 379

Query: 380 SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 439
           SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY
Sbjct: 380 SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 439

Query: 440 QPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
           QPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN
Sbjct: 440 QPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499

Query: 500 PTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
           PTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA
Sbjct: 500 PTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559

Query: 560 KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
           KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE
Sbjct: 560 KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619

Query: 620 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
           SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS
Sbjct: 620 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679

Query: 680 ALSQLLNERAAPGPSDQQLQIEKVEEKEDTNEGEXXXXXXXXXXXXXXXXXXXXXXXXXL 739
           ALSQLLNERAAPGPSDQQLQIEKVEEKEDTNEGE                         L
Sbjct: 680 ALSQLLNERAAPGPSDQQLQIEKVEEKEDTNEGEKHDQQNKQDDDNSHNNHDNDSNNQSL 739

Query: 740 EVKDKNSENIEESVEHLLKDAAKEANPIKLTPQP 773
           EVKDKNSENIEESVEHLLKDAAKEANPIKLTPQP
Sbjct: 740 EVKDKNSENIEESVEHLLKDAAKEANPIKLTPQP 773

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score = 1288 bits (3333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/754 (85%), Positives = 664/754 (88%)

Query: 20  RPRMTKLPFMRFRSLVTHSSSQLILINPLHTRSPIIGKTLILSSFRYISSKTKLQAPLPX 79
           RPR+ KLP +RFRSLVT SSSQLI ++ L  RSP +GK+LIL SFR  SSKT  +  LP 
Sbjct: 20  RPRLAKLPSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLILQSFRCNSSKTVPETSLPS 79

Query: 80  XXXXXXXXXXXXXXTEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKV 139
                          EQSKTDDYKDIIRLFMLAKRDWK           SCSIGMSIPKV
Sbjct: 80  ASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKV 139

Query: 140 IGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERV 199
           IGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERV
Sbjct: 140 IGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERV 199

Query: 200 VARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVG 259
           VARLRA+VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG+VG
Sbjct: 200 VARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVG 259

Query: 260 VGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT 319
           VGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT
Sbjct: 260 VGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT 319

Query: 320 VQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ 379
           VQSFVAEGNELSRYNVAIRDIFQVG              SLLGDLSFLTVLAYGSYLVLQ
Sbjct: 320 VQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQ 379

Query: 380 SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 439
           SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY
Sbjct: 380 SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 439

Query: 440 QPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
           +P+RGVIEFKDVSFSYPTRPSVQIFK+LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN
Sbjct: 440 KPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499

Query: 500 PTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
           PTTGTI IDNQDI+KLNCKSLRR IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA
Sbjct: 500 PTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559

Query: 560 KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
           KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE
Sbjct: 560 KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619

Query: 620 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
           SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN TS
Sbjct: 620 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTS 679

Query: 680 ALSQLLNERAAPGPSDQQLQIEKVEEKEDTNEGEXXXXXXXXXXXXXXXXXXXXXXXXXL 739
           ALSQLLNE+AAPGPSDQQLQIEKV EKED NE +                          
Sbjct: 680 ALSQLLNEKAAPGPSDQQLQIEKVIEKEDLNESKEHDDQKKDDNDDNDNNHDNDSNNQSP 739

Query: 740 EVKDKNSENIEESVEHLLKDAAKEANPIKLTPQP 773
           E KD NS++IE+SVEHLLKDAAKEANPIK+TPQP
Sbjct: 740 ETKDNNSDDIEKSVEHLLKDAAKEANPIKITPQP 773

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score = 1250 bits (3235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/754 (83%), Positives = 654/754 (86%)

Query: 20  RPRMTKLPFMRFRSLVTHSSSQLILINPLHTRSPIIGKTLILSSFRYISSKTKLQAPLPX 79
           RPR+ KLP ++FRSLVT SSS LI IN L  RSP +GK+L+L   RY SSKT+  A L  
Sbjct: 20  RPRLAKLPSIKFRSLVTPSSSHLIPINRLCIRSPTVGKSLLLQFSRYNSSKTEPVALLSS 79

Query: 80  XXXXXXXXXXXXXXTEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKV 139
                          ++SKTDDYKDIIRLFMLAKRDWK           SCSIGMSIPKV
Sbjct: 80  SSSASKDSVKPARPPQRSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKV 139

Query: 140 IGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERV 199
           IGIVLDTLKTSSGSDFF+LKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERV
Sbjct: 140 IGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERV 199

Query: 200 VARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVG 259
           VARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG+VG
Sbjct: 200 VARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVG 259

Query: 260 VGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT 319
           VGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT
Sbjct: 260 VGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT 319

Query: 320 VQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ 379
           VQSFVAEGNELSRYNVAIRDIFQVG              SLLGDLSFLTVLAYGSYLVLQ
Sbjct: 320 VQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQ 379

Query: 380 SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 439
           SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPT GHKY
Sbjct: 380 SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKY 439

Query: 440 QPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
           +P RGV+EFKDVSFSYPTRPSVQIFK+LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN
Sbjct: 440 KPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499

Query: 500 PTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
           P+TGTIMID+QDITK+NCKSLRR IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA
Sbjct: 500 PSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559

Query: 560 KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
           KQCFCHNFITKFPNTYDTVIG  GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE
Sbjct: 560 KQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619

Query: 620 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
           SEGAINYTFG LMKSKSMTI+SIAHRLSTIRRSENVIVLGHDGSVVEMGKFK+LYAN TS
Sbjct: 620 SEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTS 679

Query: 680 ALSQLLNERAAPGPSDQQLQIEKVEEKEDTNEGEXXXXXXXXXXXXXXXXXXXXXXXXXL 739
           ALSQLLNERAAPGPSDQQ QIEK  E E++ E +                          
Sbjct: 680 ALSQLLNERAAPGPSDQQQQIEKDNENEESTEEKAPDHSNKNDNDDNDNNHDNDSNKQSQ 739

Query: 740 EVKDKNSENIEESVEHLLKDAAKEANPIKLTPQP 773
           EV  KNS++IEESVEHLL+DAAKEA PIKLTPQP
Sbjct: 740 EVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQP 773

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score = 1242 bits (3214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/755 (83%), Positives = 653/755 (86%), Gaps = 8/755 (1%)

Query: 20  RPRMTKLPFMRFRSLVTHSSSQLILINPLHTRSPIIGKTLILSSFRYISSKTKLQ-APLP 78
           R R+ KLP +RFRSL T SSS LI I+ L TR   I K+L+    R+ S+KT+    PLP
Sbjct: 20  RSRLVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLLSQFVRFNSTKTQQDIPPLP 79

Query: 79  XXXXXXXXXXXXXXXTEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPK 138
                            QSK+DDYKDIIRLFMLAKRDWK           SCSIGMSIPK
Sbjct: 80  STSASKQPAKPAY----QSKSDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPK 135

Query: 139 VIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSER 198
           VIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGC ANFGRFILLRILSER
Sbjct: 136 VIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSER 195

Query: 199 VVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIV 258
           VVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG+V
Sbjct: 196 VVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVV 255

Query: 259 GVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIK 318
           GVGMMCSLSPQLS+LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIK
Sbjct: 256 GVGMMCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIK 315

Query: 319 TVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVL 378
           TVQSFVAEGNELSRYNVAIRDIFQVG              SLLGDLSFLTVLAYGSYLVL
Sbjct: 316 TVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVL 375

Query: 379 QSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK 438
           QSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK
Sbjct: 376 QSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK 435

Query: 439 YQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
           Y+P+RGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY
Sbjct: 436 YKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 495

Query: 499 NPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSV 558
           NPTTGTIMIDNQDITK+NCKSLRR IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSV
Sbjct: 496 NPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSV 555

Query: 559 AKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
           AKQCFCHNFITKFPNTYDTVIGP+GTLLSGGQKQRIAIARALIKKPT+LILDEATSALDV
Sbjct: 556 AKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDV 615

Query: 619 ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANST 678
           ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY+N T
Sbjct: 616 ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPT 675

Query: 679 SALSQLLNERAAPGPSDQQLQIEKVEEKEDTNEGEXXXXXXXXXXXXXXXXXXXXXXXXX 738
           SALSQLLNER AP PS+QQ Q+EK  EKE+ NE E                         
Sbjct: 676 SALSQLLNERTAPVPSEQQQQVEKDNEKEEPNEDE---NHDQRNEGDDGSNHDNDSNNKP 732

Query: 739 LEVKDKNSENIEESVEHLLKDAAKEANPIKLTPQP 773
           LE KDK S++IEESVEH+LKDAAKEANPIKL+P P
Sbjct: 733 LESKDKKSDDIEESVEHVLKDAAKEANPIKLSPPP 767

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/609 (73%), Positives = 505/609 (82%), Gaps = 12/609 (1%)

Query: 95  EQSKT----DDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTS 150
           EQS+T     +++DI+RL +L +RDWK           SCSIGM+IPKVIG++LD LK +
Sbjct: 106 EQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNA 165

Query: 151 SGSDFFDL------KIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVAR 202
             ++  D       K+P  +F L  YEFL  F +ALL+G AAN+GR ILLR+LSER+VAR
Sbjct: 166 LAANSVDGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLRVLSERLVAR 225

Query: 203 LRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGM 262
           LRA VIKKT+HQDAEFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+GM
Sbjct: 226 LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285

Query: 263 MCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS 322
           M +LSPQLS LLL FTPPV+ SASVFGKQI  TS++LQEATG LT+VAEEQLSGIKTVQS
Sbjct: 286 MLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQS 345

Query: 323 FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL 382
           FVAE  E++RYN AIRDIF +G              S +GDLSFLTVL +GSYLVLQ+ L
Sbjct: 346 FVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSL 405

Query: 383 SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPE 442
           +IGDLTAFM+YTEYTGN++FGLSTFYSEIMQGAGAASRLFELTDR PSIS T G KY+P 
Sbjct: 406 TIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPG 465

Query: 443 RGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 502
            G IEFK+VSF+YPTRPS  IFK+LNFKI  GS+VCIVGPSGRGKST+ALLL +YY P++
Sbjct: 466 NGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSS 525

Query: 503 GTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
           G I+ID Q+I  LN KSLRR IG+VQQEP+LMSGTIRDNI YGLT  PTK+EIR VAKQC
Sbjct: 526 GEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC 585

Query: 563 FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
           FCHNFIT+F ++YDTVIGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEG
Sbjct: 586 FCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEG 645

Query: 623 AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALS 682
           AINYTFGQLMK K MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL+ + TS LS
Sbjct: 646 AINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELS 705

Query: 683 QLLNERAAP 691
           QLLNE++ P
Sbjct: 706 QLLNEKSTP 714

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/675 (66%), Positives = 525/675 (77%), Gaps = 7/675 (1%)

Query: 101 DYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKI 160
           ++KD+ RLF+L K+D+K           SC+IGM IPK+IG++LD LK+ + +       
Sbjct: 159 NFKDVFRLFLLVKKDYKLLIVSLTLLTISCTIGMMIPKIIGLILDALKSVATTPDGGSSP 218

Query: 161 P---IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAE 217
           P   +F L LYEFL  F+VAL IGCAAN+GR ILLRILSER+VARLR+ V+K TLHQD+E
Sbjct: 219 PPTIMFGLTLYEFLGGFSVALFIGCAANYGRLILLRILSERLVARLRSVVMKHTLHQDSE 278

Query: 218 FFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFF 277
           FFD HKVGDLISRLG+D+Y+VSRS+TQK+SDGVK+LICG VG+GMM  LS  LS +L+ F
Sbjct: 279 FFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCF 338

Query: 278 TPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAI 337
             PV+ SAS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G++TVQSFVAE  E+ R+N +I
Sbjct: 339 VIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSI 398

Query: 338 RDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT 397
           R+IF VG              SL+GDLSFLTVL YGSYLVL   L+IGDLTAFMLYTEYT
Sbjct: 399 REIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYT 458

Query: 398 GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPT 457
           GNA+FGLSTFYSEIMQGAGAASRLFELTDR P+I PT+G  Y P +G IEFK+VSF+YPT
Sbjct: 459 GNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPT 518

Query: 458 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNC 517
           RPS QIFKSLNFKI PGS+VCIVGPSG+GKSTIALLLL YYNPT+G I+ID QDITKLN 
Sbjct: 519 RPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNS 578

Query: 518 KSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
           KSLRRQI +VQQEPVLMSGTIRDNITYGLT  PTKEEIR+VAKQCFCHNFI KFP TYDT
Sbjct: 579 KSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDT 638

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637
            IGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFGQLMKSKSM
Sbjct: 639 YIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSM 698

Query: 638 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQ 697
           TIVSIAHRLSTIRRSEN+IVLG+DGSVVEMGKFKEL+A+ TS LS+LLNE+++      +
Sbjct: 699 TIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTSELSKLLNEKSSRKKVVTK 758

Query: 698 LQIEKVEEKEDTNEGEXXXXXXXXXXXXXXXXXXXXXXXXXLEVKDKNSENIEESVEHLL 757
                      +  G                          +      ++ +E+S+E +L
Sbjct: 759 TVPPVSSTSVSSANGSSIHHEGTILEEDHAQEDHESEAPPTI----ITTQQLEDSIESVL 814

Query: 758 KDAAKEANPIKLTPQ 772
            D + E+ PIKL+P+
Sbjct: 815 NDVSAESKPIKLSPK 829

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/601 (72%), Positives = 502/601 (83%), Gaps = 4/601 (0%)

Query: 94  TEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK--TSS 151
           T +    ++ D+IRLF+L K DWK           SC IGM IPKVIGI+LD+LK  T++
Sbjct: 116 TSEEPKSNFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIPKVIGIILDSLKVQTAT 175

Query: 152 GSDFFDLKIPI--FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIK 209
            S+  +   PI  F L +YEFL  F++ALL GC ANFGR ILLRILSER+VARLR+ VIK
Sbjct: 176 QSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGRLILLRILSERLVARLRSTVIK 235

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ 269
           +T+HQDA+F+D HK GDLISRLG+DAY+VSRS+TQK+SDG K+LICG VGVGMMCSLS  
Sbjct: 236 RTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLD 295

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
           LS +L     PV+ SAS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G+KTVQSFVAE  E
Sbjct: 296 LSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQRE 355

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389
           + R+N AIR+IF VG              SL+GDLSFLTVL YGSYLVL   L+IGDLTA
Sbjct: 356 IKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTA 415

Query: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFK 449
           FMLYTEYTGN++FGLSTFYSEIMQGAGAASRLFELTD  P I PT+G  Y P +G IEFK
Sbjct: 416 FMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFK 475

Query: 450 DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 509
           +VSFSYPTRP  QIFK+LNFKI PGS+VCIVGPSG+GKSTIALLLL YYNPT+G I+ID 
Sbjct: 476 NVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 535

Query: 510 QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 569
           QDITK+N KSLRR++GIVQQEPVLMSG+IRDNITYGLTYTPTKEEIR VAKQCFCHNFIT
Sbjct: 536 QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFIT 595

Query: 570 KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629
           KFP+TYDT IGP GTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG
Sbjct: 596 KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 655

Query: 630 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERA 689
           QLMK+KSMTIVSIAHRLSTIRRSENVIVLG+DGSV+EMGKFKEL+++ +S LS+LLNE++
Sbjct: 656 QLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPSSELSKLLNEKS 715

Query: 690 A 690
           +
Sbjct: 716 S 716

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/693 (64%), Positives = 521/693 (75%), Gaps = 48/693 (6%)

Query: 96  QSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTS-SGSD 154
           Q K   YKD +RLF LAKRDW+           SC IGMSIPKVIG+VLD L+    G D
Sbjct: 71  QKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKD 130

Query: 155 FFDLKI----PI-FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIK 209
             ++ +    PI F L +Y+FL  F   LL+G AANF R ++LRILSERVVARLR+ V+ 
Sbjct: 131 LQNVNMDDLGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVARLRSGVMN 190

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ 269
           KTLHQD+EF+D HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+GMM S+SP+
Sbjct: 191 KTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPE 250

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
           LS +LLFF PP+L+SASVFGK+IR+TSKDLQEATGQLTRVAEEQLSG+KTVQSFVAE  E
Sbjct: 251 LSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRE 310

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389
           L RYN AIR I+ VG              ++LGD+SF+ VL YGSYLVLQ  L+IGDLTA
Sbjct: 311 LHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTA 370

Query: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFK 449
           FMLYTEYTG++VFGL+TFYSE+MQG GAASRLF+LTD   SISPT G KY P +G IEFK
Sbjct: 371 FMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFK 430

Query: 450 DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 509
           +VSFSYPTRP  QIFK +N K+ PGS+VCIVGPSGRGKSTIALLLLRYYNPT G I++D 
Sbjct: 431 NVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDG 490

Query: 510 QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 569
           QDI+K+NCK+LRR IG+VQQEP+LMSGTIRDNITYGL    TKEEIRSVAKQCFCHNFIT
Sbjct: 491 QDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFIT 550

Query: 570 KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629
           KFP+ YDT+IG  G LLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESEGAINYTFG
Sbjct: 551 KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFG 610

Query: 630 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERA 689
           QLMKS SMTIVSIAHRLSTI+RSENVIVLG DGSV+E GKFKEL+AN  S L +LL E++
Sbjct: 611 QLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKS 670

Query: 690 A-----------PGPSDQQLQIEKVEEKEDTNEGEXXXXXXXXXXXXXXXXXXXXXXXXX 738
           +           P  + Q   +E++ EK                                
Sbjct: 671 SRSDGNDSLPPPPPNATQDKVVEQIAEK-------------------------------I 699

Query: 739 LEVKDKNSENIEESVEHLLKDAAKEANPIKLTP 771
           LE   +  ++ + +V+ + KD + E  PIK+TP
Sbjct: 700 LERFPEAGQSPDATVKEIFKDVSSEGKPIKITP 732

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/609 (71%), Positives = 500/609 (82%), Gaps = 3/609 (0%)

Query: 104 DIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKT-SSGSDFFDLKIP- 161
           D+ RL  LAKRDWK           SC IGMS+PK+IGIVLD LK   S  DF    +P 
Sbjct: 101 DLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDDVPE 160

Query: 162 -IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFD 220
             F L LYEF+S   V+LL+G AAN+GR ILLR+LSERVVARLRA+VIKKT+HQDAEFFD
Sbjct: 161 IAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAEFFD 220

Query: 221 NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPP 280
           N+KVGDLISRL SDAYVVSRS+TQKVSDG KA++CG VG+GMM S+SPQLS  LLF TPP
Sbjct: 221 NNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFLTPP 280

Query: 281 VLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDI 340
           V+ SAS FG+ IRN S+DLQEATG LT+VAEEQ SGIKTVQSFVAE  E+ RYN AIR I
Sbjct: 281 VMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAIRHI 340

Query: 341 FQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNA 400
           F VG              ++LGD+SFL VLAYGSYLVL   LSIGDLTA+M+YTEYTG++
Sbjct: 341 FNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYTGSS 400

Query: 401 VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPS 460
           +FGLSTFYSEIMQGAGAASRLFELTDR PSISPT+G K+ P +G IEFK+VSFSYPTR S
Sbjct: 401 IFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPTRAS 460

Query: 461 VQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSL 520
            QIFK+L+FKI  GS+VCIVGPSGRGKSTIA LLLRYYNPTTG I +D QDI+K++ KSL
Sbjct: 461 NQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSSKSL 520

Query: 521 RRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 580
           RR + IVQQEPVLMSGTIRDNITYGL   PT++E+RS+ K+CFCHNFITKFPN+YDT++G
Sbjct: 521 RRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDTILG 580

Query: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIV 640
           PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG+LMKSKS+TI+
Sbjct: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSITII 640

Query: 641 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQLQI 700
           SIAHRLSTIRRSENVIVLG+DGSV E+GKFKELYA+  S LS+LL+E+A      Q    
Sbjct: 641 SIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQNTAE 700

Query: 701 EKVEEKEDT 709
           ++  + E+T
Sbjct: 701 DQEIDPEET 709

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/685 (65%), Positives = 520/685 (75%), Gaps = 38/685 (5%)

Query: 95  EQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKT----S 150
           E  +    KD++RL MLAK DWK           SC IGM+IPKVIG++LD LKT    +
Sbjct: 84  EAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETN 143

Query: 151 SGSD----FFDLKIPIF-SLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRA 205
            G D      D+  PIF    +YEFL  F   ++ G  AN+GR +LLRILSERVVARLRA
Sbjct: 144 EGKDGPISMADVP-PIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRA 202

Query: 206 HVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCS 265
           +VIKKT+HQD+EFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VGVGMM S
Sbjct: 203 NVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVGMMVS 262

Query: 266 LSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 325
           +SPQLS LLL FTPPVLFSAS+FG++IR+TS DLQEATGQLTRV+EEQLSG++TVQSFVA
Sbjct: 263 ISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVA 322

Query: 326 EGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIG 385
           E  E+ RY+ AIRDIF VG              S LGD+SFL VLAYGSYLVLQ  L+IG
Sbjct: 323 EQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIG 382

Query: 386 DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGV 445
           DLTAFMLYTEYTG++VFGL++FYSE+MQG GAA+RLFELTDR PSI PT G K+ P +G 
Sbjct: 383 DLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGE 442

Query: 446 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           I FKDV+FSYPTRP   IF+ ++ KI  GS+VC+VGPSGRGKSTIALLLLR+YNP++G I
Sbjct: 443 IVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQI 502

Query: 506 MIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCH 565
            ID QDI+KLN KSLRR IG+VQQEPVLMSGT+RDNITYGLT TP+KEEIR VAKQCFCH
Sbjct: 503 FIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCH 562

Query: 566 NFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN 625
           NFI KFP+ YDTVIGP G LLSGGQKQRIAIARALIKKPTIL+LDEATSALDVESEGAIN
Sbjct: 563 NFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAIN 622

Query: 626 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLL 685
           YTFGQLMKSKS+TIVSIAHRLSTIRRSEN+IVLG+DGSVVE GKFKEL+A+ +S LS+LL
Sbjct: 623 YTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSELSKLL 682

Query: 686 NERAAPGPSDQQLQIEKVEEKEDTNEGEXXXXXXXXXXXXXXXXXXXXXXXXXLEVKDKN 745
           NE+++   +          E+ +    +                            K+  
Sbjct: 683 NEKSSRSENSSSSYSPNASEQPEDEANQ----------------------------KNAP 714

Query: 746 SENIEESVEHLLKDAAKEANPIKLT 770
            E  ++SVE +LKD   E  PIK++
Sbjct: 715 EEAHDDSVEEILKDVTAEGKPIKIS 739

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/629 (69%), Positives = 494/629 (78%), Gaps = 17/629 (2%)

Query: 100 DDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKT--SSGSDF-- 155
           +D  DI RL  LAK+DWK           SC+IGMS+PKVIG+VLD LK   S   D   
Sbjct: 72  NDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAEL 131

Query: 156 --FDLKI------PI-FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAH 206
              DL I      PI F L LYEFL     ALLIG AANFGR +LLR+LSERVVARLR+ 
Sbjct: 132 GSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVLSERVVARLRSQ 191

Query: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266
           VIKKT+HQDAEFFDN+KVGDLISRLGSDAYVVSRSMTQKVSDG KAL+CG VGVGMM S+
Sbjct: 192 VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCGGVGVGMMVSI 251

Query: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
           SP+LS  LLFFTPPV+ S+  FG+ IR+ S+ LQEATGQLTRV+EEQ SG+KTVQ+FVAE
Sbjct: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311

Query: 327 GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386
             E+ RYN  I+D++ VG              S LGD+SFL VLAYGSYLVL   LSIGD
Sbjct: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGD 371

Query: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVI 446
           LTA+M+YTE TG+AVFGLS+FYSEIMQG GAASRLFELTDR P ISPT G KY P +G I
Sbjct: 372 LTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEI 431

Query: 447 EFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 506
           EFK+VSF+YPTRP  QIFKSLNFKI PGS+VCIVGPSGRGKSTIA LLL+YY PT GTI 
Sbjct: 432 EFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTIT 491

Query: 507 IDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
           +D QDI+KLN KSLRR IGIVQQEP+LMSG+IRDNITYGLTY  T EEIR V KQCFCHN
Sbjct: 492 VDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHN 551

Query: 567 FITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
           FITKFP+ Y T++GP+GTLLSGGQKQRIAIARAL+KKP +LILDEATSALDVESE AINY
Sbjct: 552 FITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINY 611

Query: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
           TFG+LMK K +TI+SIAHRLSTIRRSE VIVLG+DGSVVE+GKFK L+ N  S LSQLLN
Sbjct: 612 TFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671

Query: 687 ERAA---PGPSDQQLQI-EKVEEKEDTNE 711
           E++      P+++  +  E+  +K   NE
Sbjct: 672 EKSTINERNPNEKPAETPEQESQKNAANE 700

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/592 (70%), Positives = 483/592 (81%), Gaps = 5/592 (0%)

Query: 104 DIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK-----TSSGSDFFDL 158
           ++ RL ++  RDWK           SCSIGM+IPKVIG+VLD LK     + S  +  DL
Sbjct: 147 ELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDALKNVMTDSPSSLETSDL 206

Query: 159 KIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEF 218
               F L LY FL  F  AL+IG   N+GR+ILLR+LSERVVARLR+HVIKKTLHQDAEF
Sbjct: 207 PPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEF 266

Query: 219 FDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFT 278
           FD +KVGDLISRLGSDAYVVSRS+TQKVSDG KA++CG  G+GMM S+SPQLS  L+ F 
Sbjct: 267 FDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGGAGIGMMISISPQLSSFLVIFA 326

Query: 279 PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
           P V+ SAS+FGK+IR+ S  LQEATGQLTRV+EEQL+G+KTVQSFVAE  E+ RYN AIR
Sbjct: 327 PAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIR 386

Query: 339 DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
           DI+ +G              S++GD+SFL VLAYGSYLVL   L+IGDLTAFMLYT+YT 
Sbjct: 387 DIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTA 446

Query: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTR 458
           N++FGLS FYSEIMQG GAA RLF+LTDR P+I PT+G K+ P  G IEF+++ F+YPTR
Sbjct: 447 NSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTR 506

Query: 459 PSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCK 518
           P  Q+FK+LNFKI PG+SVCIVGPSGRGKSTIALLLLRYYNP++G I+IDNQDI KLN K
Sbjct: 507 PENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPK 566

Query: 519 SLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTV 578
           SLR+ +GIVQQEPVLMSG+IRDNITYGL    T +EIR V+KQCFCHNFITKFP+ Y+T+
Sbjct: 567 SLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETI 626

Query: 579 IGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMT 638
           IGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG+LMKSKS+T
Sbjct: 627 IGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVT 686

Query: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAA 690
           IVSIAHRLSTIRRSE +IVLG+DGSVVE GKFKELYA+ TS LS+LLNE+ +
Sbjct: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQS 738

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/676 (63%), Positives = 508/676 (75%), Gaps = 29/676 (4%)

Query: 102 YKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIP 161
           YKDI RLF+L K DWK           SC IGM IPKVIG VLD+LK   G +F +L I 
Sbjct: 88  YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFSELMI- 146

Query: 162 IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDN 221
            + + L  F    +  LL+GC AN+ R ILLRILSE +VA+LRA+VIK  +HQDA+FFD 
Sbjct: 147 -WDMSLKHFFYGLSGLLLLGCGANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDT 205

Query: 222 HKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSI-LLLFFTPP 280
           +KVGDLISR+G+DA++VSRS+TQK+SDGVKA+  G  GVGMM S+S  LS  +L+    P
Sbjct: 206 YKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMLSISIPLSCSILILMGSP 265

Query: 281 VLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDI 340
           +L SA VFGKQIR+ SK LQE T  LTRV+EEQ +GIKT+QSFVAE +E+ ++N +IR I
Sbjct: 266 LLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKI 325

Query: 341 FQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNA 400
           F VG              S++GDLSFL VL+YGS+LV Q QLS+GDLTAFMLYTEYTGNA
Sbjct: 326 FAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNA 385

Query: 401 VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERG-VIEFKDVSFSYPTRP 459
           +F LS F+SEIMQGAGAASR+FELTD KP I+PT G K+ P +G  IEFK+VSF+YPTRP
Sbjct: 386 IFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRP 445

Query: 460 SVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKS 519
           +V IF++LNFKI  GS+VCIVGPSG+GKSTIA LLL YYNP+ G I+ID QDI+ L+ KS
Sbjct: 446 TVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKS 505

Query: 520 LRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVI 579
           LRR IGIVQQEP+LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT+FP+TYDT I
Sbjct: 506 LRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAI 565

Query: 580 GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTI 639
           GPHGTLLSGGQKQRIAIARALIKKPT+LILDEATSALDVESEGAINYTFGQLMKSKSMTI
Sbjct: 566 GPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTI 625

Query: 640 VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAA---PGPSDQ 696
           VSIAHRLSTIRRSENVIVLG+DGSVVE GKFKEL+AN  S LS+LL E+++     P  Q
Sbjct: 626 VSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPASELSKLLREKSSGNNAAPEIQ 685

Query: 697 QLQIEKVEEKEDTNEGEXXXXXXXXXXXXXXXXXXXXXXXXXLEVKDKNSENIEESVEHL 756
             +I +  E++ +  GE                           V    +E   E++  +
Sbjct: 686 PQEISQTIEEDPSFSGEATPAS---------------------SVTGFKAETEAETINEV 724

Query: 757 LKDAAKEANPIKLTPQ 772
           LKD + E  P+K+ PQ
Sbjct: 725 LKDISTEGKPLKI-PQ 739

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/630 (64%), Positives = 487/630 (77%), Gaps = 20/630 (3%)

Query: 102 YKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSD-----FF 156
           YK+I RLF LA+ DWK           SCSIGM++PKVIG+VLD  K +  SD       
Sbjct: 124 YKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDLR 183

Query: 157 DLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDA 216
           DL   ++ L LY+FL+ F  AL++   ANFGR +LLRIL E++VARLR++VIKKT+HQDA
Sbjct: 184 DLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQDA 243

Query: 217 EFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLF 276
           EFFD +KVGDLISRL SDAYVVSRSMTQ +SDG KA+ICG VG+GMM  +S  L+  L  
Sbjct: 244 EFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSTLATALFL 303

Query: 277 FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336
           F PP+L  A+++G++IR+ S+DLQ++TG LT+VAEEQLSG+KTVQSFVAE  E+ RYN A
Sbjct: 304 FAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNHA 363

Query: 337 IRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEY 396
           IR +F VG              S+LGD SFL VLAYGS+LVLQ  LSIGDLTAFMLYTEY
Sbjct: 364 IRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTEY 423

Query: 397 TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYP 456
           +G+AVFGLS FYSE+M+GAGAASRLFELTD +PSI  T G  Y P +G I+F++VSFSYP
Sbjct: 424 SGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSYP 483

Query: 457 TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLN 516
           TR + QIF +LNF I  GS+VC+VGPSGRGKSTIA LLL+YYNPT+G I ID QDI+K++
Sbjct: 484 TRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKIS 543

Query: 517 CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576
            KSLRR +G+VQQEP+LMSG+IRDNITYG+ YTPT +EIRSV+K+CFCHNFITKF + Y+
Sbjct: 544 AKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGYE 603

Query: 577 TVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKS 636
           TVIGP G LLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYT GQLMKS+ 
Sbjct: 604 TVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRD 663

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAA------ 690
           +TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFKELYA+  S L +LLNE+A       
Sbjct: 664 ITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSKM 723

Query: 691 ---------PGPSDQQLQIEKVEEKEDTNE 711
                    P P  ++L  E+ EE+    E
Sbjct: 724 NAETVEKNDPSPKTEKLNDEEKEEQRRIEE 753

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/619 (65%), Positives = 479/619 (77%), Gaps = 6/619 (0%)

Query: 95  EQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGS- 153
           E+S    YK++IRLF LA  DWK           S  IGMSIPKVIG+VLD +K +  S 
Sbjct: 132 EESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSA 191

Query: 154 ----DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIK 209
                  DL   +  L +YEFL  F  AL+IG  ANFGR +LLR+L E++VARLR++VI+
Sbjct: 192 TGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIR 251

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ 269
           K +HQDAEFFD +KVGDLISRL SDAYVVSRSMTQ VSDG KA+ICG VG+GMM ++S  
Sbjct: 252 KIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMVNISIS 311

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
           L+  LL F PP+L  A ++GK+IR  S+DLQE+TG LTRV+EEQLSG+KT+QSFVAEG E
Sbjct: 312 LTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKE 371

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389
           L RYN AIR +F  G              ++LGDLSFL VLAYGS+LVLQ  L++GDLTA
Sbjct: 372 LQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTA 431

Query: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFK 449
           FMLYTEYTG+AVFGLS FYSE+M+GAGAASRLFE+TD  PSI PT G  Y P  G I FK
Sbjct: 432 FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFK 491

Query: 450 DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 509
           DVSFSYPTRP  QIF  LNF I PGS+VCIVGPSGRGKSTI  LLLRYYNP++G I ID+
Sbjct: 492 DVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDD 551

Query: 510 QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 569
           QDI++L+CKSLRR +G+VQQEP+LMSG+I+ N+TYGL    + +EIRSVAK+CFCH F+T
Sbjct: 552 QDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVT 611

Query: 570 KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629
           KFPN YDT+IGP G  LSGGQKQRIAIARAL+KKP ILILDEATSALDVESEGAINYT G
Sbjct: 612 KFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLG 671

Query: 630 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERA 689
           +LMKSK +TI+SIAHRLSTIRRSENVIVLG+DGSVVE+GKFK+LYA+  S L +LLN++ 
Sbjct: 672 KLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKK 731

Query: 690 APGPSDQ-QLQIEKVEEKE 707
              P+ + Q   EK  E+E
Sbjct: 732 RDKPTPRVQSDPEKDREQE 750

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/621 (64%), Positives = 478/621 (76%), Gaps = 9/621 (1%)

Query: 94  TEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGS 153
           TE+    +Y++I+RL  LA+ DWK           S ++GM+IPKVIGIVLD +K +SG 
Sbjct: 98  TEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGG 157

Query: 154 -----DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVI 208
                   DL   I+ L +++FL+ F   L+ G  ANFGR +LLR+L E++VARLR++VI
Sbjct: 158 FSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVI 217

Query: 209 KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSP 268
           KK +HQDAEFFD +KVGDLISRL SDAYVVSRSMTQ VSDG KA+ICG VG+GMM ++S 
Sbjct: 218 KKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMINISA 277

Query: 269 QLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGN 328
            L+  L  F PP+L  A ++GK+IR  S++LQE+TG LT+V+EEQLSG+KT+Q+FVAEG 
Sbjct: 278 SLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGK 337

Query: 329 ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT 388
           EL RYN AIR +F  G               +LGDLSFL VLAYGS+LVLQ  LS+GDLT
Sbjct: 338 ELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLT 397

Query: 389 AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEF 448
           AFMLYTEYTG+AVFGLS FYSE+M+GAGAASRLFE+TD    I P+ G  Y P  G I+F
Sbjct: 398 AFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKF 457

Query: 449 KDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           +DVSFSYPTRP  QIF  LNF I PGS+VC+VGPSGRGKSTIA LLLRYY+P +G IMID
Sbjct: 458 EDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMID 517

Query: 509 NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
            Q+I+KL+CKSLRR +G+VQQEP+LMSG+IR N+TYG+    T +EIRSVAK+CFCH FI
Sbjct: 518 GQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFI 577

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
           TKFP  Y+TVIGP G  LSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYT 
Sbjct: 578 TKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 637

Query: 629 GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNER 688
           G+LM+S+ +TI+SIAHRLSTIRRSENVIVLG+DGSVVEMGKFKELYAN  S L +LLN++
Sbjct: 638 GRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697

Query: 689 AAPGPSDQQLQIEK-VEEKED 708
               P+  Q Q    VE KE+
Sbjct: 698 K---PTQLQSQSRNSVETKEN 715

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/600 (65%), Positives = 468/600 (78%), Gaps = 16/600 (2%)

Query: 104 DIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDT----------------L 147
           D+ RLF LA+ DWK           SC+IGM++PKVIG+VLD                 L
Sbjct: 114 DVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALSGSNTNNGNGGL 173

Query: 148 KTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHV 207
           + S      DL   +  + LY+F   F  ALLIG  ANFGR +LL+IL ER+VARLR++V
Sbjct: 174 EDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVLLKILGERLVARLRSNV 233

Query: 208 IKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLS 267
           IKKT+H D EF+D +KVGDL+SRLG+DAY+VSRSMTQ +SDG KALICG VG+GMM  +S
Sbjct: 234 IKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHIS 293

Query: 268 PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEG 327
             L+ +L  F PP+L  A+++G +IR  S++LQ+A+G LT+VAEEQLSGIKTVQSFVAEG
Sbjct: 294 STLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEG 353

Query: 328 NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
            E+ RYN A+R +F VG              ++LGD SFL VLAYGS+LVLQ  L+IGDL
Sbjct: 354 KEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDL 413

Query: 388 TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIE 447
           TAFMLYTEYTG+AVFGLSTFYSE+M+GAGAA+RLFEL D KP+I  T G  ++P  G +E
Sbjct: 414 TAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVE 473

Query: 448 FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI 507
           F+ VSFSYPTR + QIFK LNF I PGS+VCIVGPSGRGKSTIA LLLRYYNPT+G I++
Sbjct: 474 FQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILV 533

Query: 508 DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
           D QDITKL+ KSLRRQ+G+VQQEP+LMSGTIR+NITYG++  P+ EEIRSVAK+CFCH F
Sbjct: 534 DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAF 593

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           I+KFPN Y+T+IGP G LLSGGQKQRIAIARAL+ KP ILILDEATSALDVESEGAINYT
Sbjct: 594 ISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYT 653

Query: 628 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
            G+LMKSK +TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFK+LYAN  SAL +LL E
Sbjct: 654 LGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTE 713

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/622 (62%), Positives = 476/622 (76%), Gaps = 18/622 (2%)

Query: 94  TEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK----- 148
            + +K   + ++ RL  L K DWK           SCSIGM++PKVIG+VLD  K     
Sbjct: 95  AQPAKPAGWHEVFRLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDATKDAVAQ 154

Query: 149 -----TSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARL 203
                T +     D+   I +  L + L+ F  ALL+G AANFGR  LL++L ER+VARL
Sbjct: 155 AEKNETGAPMSLLDMPSIIGNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLVARL 214

Query: 204 RAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMM 263
           RA VIKKTLH DAEFFD +KVGDLISRLGSDAY+VSRSMT  +SDGVKA +CG VGVGMM
Sbjct: 215 RAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMM 274

Query: 264 CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSF 323
             +S  L+  ++ F PP+L +A+++GK+IR  S++LQ++TG LTRV+EEQ +GIKT++SF
Sbjct: 275 FHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSF 334

Query: 324 VAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS 383
           VAEG E+ RYN A+R +F V               ++LGD+SFL VLAYGS+LVLQ +LS
Sbjct: 335 VAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELS 394

Query: 384 IGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPER 443
           +G LTAFMLYTEYTG++VFGLS FYSE+M+GAGAASRLFELTD K S+  TVG  + P  
Sbjct: 395 LGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRD 454

Query: 444 GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
           G IEFKDVSFSYPTRP+ QIFK L   I PGS+VCIVGPSGRGKSTIA LLLR+Y+  +G
Sbjct: 455 GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSG 514

Query: 504 TIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
           TI+ID QDI+K++ KSLR+ +G+VQQEPVLMSGTIRDNITYGL+YTP+ +EIR+VAK+CF
Sbjct: 515 TILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCF 574

Query: 564 CHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGA 623
           CHNFITKFP+ YDTVIGP G LLSGGQ+QRIAIARALIKKP ILILDEATSALDVESEGA
Sbjct: 575 CHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGA 634

Query: 624 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQ 683
           INYT G+LM+SK +TIVSIAHRLSTIRRSEN++VLG+DGSV+E GKF +LY +  S L +
Sbjct: 635 INYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFK 694

Query: 684 LLNER--------AAPGPSDQQ 697
           LLNE         A+P P+ ++
Sbjct: 695 LLNEHASEPAKPEASPAPAQEE 716

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/612 (61%), Positives = 461/612 (75%), Gaps = 25/612 (4%)

Query: 102 YKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDF------ 155
           +++++RL  LAK DWK           SC+IGM++PKVIG+VLD  K +  S +      
Sbjct: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156

Query: 156 ------------------FDLKIPIF-SLPLYEFLSFFTVALLIGCAANFGRFILLRILS 196
                              D   PI  +L + +F+  F  AL++G  ANFGR +LL+I+ 
Sbjct: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216

Query: 197 ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256
           ER+V+RLR+ VIK+T+H D EFFD +KVGDLISR GSDAYVVSRSMTQ VSDG KA+ICG
Sbjct: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276

Query: 257 IVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 316
            VG+GMM  +S  L+ ++L F PP+L  A ++GK+I   S+ LQ+++G LTRVAEEQL+G
Sbjct: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336

Query: 317 IKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYL 376
           I+T++SFVAE  E+ RYN AIR +F VG              ++LGD+SF+ VL YG+ L
Sbjct: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIVLLYGANL 396

Query: 377 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 436
           VLQ  LSIGDLTAFMLYTEYTG++VFGLSTFYSE+M+GAGAASRLFEL D K S+   + 
Sbjct: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456

Query: 437 HKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
           H   P +G IEF+DVSFSYPTRPS QIFK ++F I PGS+VCIVGPSG+GKSTI  LLLR
Sbjct: 457 HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLR 516

Query: 497 YYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556
           +Y+P  G+I+IDN DI+K   KSLRR +G+VQQEP LMSGTIRDNITYGL+YTPT +EIR
Sbjct: 517 FYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576

Query: 557 SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
            V+KQCFCH FITKFP+ YDTVIGP G  LSGGQ+QRIAIARALIKKP ILILDEATSAL
Sbjct: 577 VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636

Query: 617 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
           DVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSEN+IV+G+DGSVVE+GKF +LY N
Sbjct: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696

Query: 677 STSALSQLLNER 688
             S L +LLNE+
Sbjct: 697 EESELFKLLNEK 708

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/692 (58%), Positives = 492/692 (71%), Gaps = 44/692 (6%)

Query: 102 YKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIP 161
           ++D+ RL +L K+D K           SCSIGM+IPK+IG +LDTL+ +  +     +I 
Sbjct: 83  WRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDTLRNNYENLTSLSQIK 142

Query: 162 IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDN 221
           I ++PL  FL    + L+ GC ANFGR ++LRI+SER+V+RLR+ V+K  +H+D EFFD 
Sbjct: 143 ILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDT 202

Query: 222 HKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPV 281
            KVGDL+SR+G+DA+VVSRS+T KV+DGV++   GI G+G+M +LS +L+  L    PP+
Sbjct: 203 FKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFGIGLMLTLSRELTGALFAILPPI 262

Query: 282 LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
           ++  SVFGKQIR  SK LQ+ TG LTRV EEQ +GI+TVQ FVAE NE+ R+N  +R+IF
Sbjct: 263 IWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIF 322

Query: 342 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAV 401
           QVG              SL+GDL FL VL YGSYLV+   +SIGDLTAFMLYTEYTGNA+
Sbjct: 323 QVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAI 382

Query: 402 FGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGH-KYQPERGV----IEFKDVSFSYP 456
           FGLS+FYSE+MQG GAASR+FE+ D++P I  T G  K++P   V    IEFK+VSF YP
Sbjct: 383 FGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYP 442

Query: 457 TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLN 516
           TRP+ QIFK+LNFK+  GS+VCIVGPSGRGKSTIA LLL +YN  +G I+ID QDI  LN
Sbjct: 443 TRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLN 502

Query: 517 CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576
            KSLRR+IGIVQQEP+LMSGTIRDNITYGLT  P+KEEIR VAKQCFCHNFITKFP+TYD
Sbjct: 503 TKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYD 562

Query: 577 --TVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS 634
                G  GT LSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFGQ+MKS
Sbjct: 563 TTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQIMKS 622

Query: 635 KSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNER-----A 689
           KSMTIVSIAHRLSTIRR E+VIVLG+DGSVVEMGKFKELY N TS LS+LLNE+     A
Sbjct: 623 KSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPTSELSKLLNEKSSTKEA 682

Query: 690 APGPSDQ----QLQIEKVEEKEDTNEGEXXXXXXXXXXXXXXXXXXXXXXXXXLEVKDKN 745
            P P +      LQ    E+KE  N  E                             D +
Sbjct: 683 TPQPVNPPPFIDLQTNPEEKKEADNASEENGAKL-----------------------DDS 719

Query: 746 SENIE-----ESVEHLLKDAAKEANPIKLTPQ 772
            E++       S +  LK+A  E  PIK+TP+
Sbjct: 720 KEDVSVPDNMTSSDDSLKEAVNEGGPIKITPR 751

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  527 bits (1357), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 271/612 (44%), Positives = 389/612 (63%), Gaps = 17/612 (2%)

Query: 94  TEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGS 153
           +E+S    +KD+ RLF LAK +             S ++ M +P VIG +LD    +S  
Sbjct: 85  SEESTNTGFKDVKRLFTLAKPETAYIVLALVLILISSTVSMVVPSVIGKLLDLSSNTSND 144

Query: 154 DFFDLKIP-------------IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVV 200
           D  D K               I+     +F +   +  +IG  AN GR ++L++  E++V
Sbjct: 145 DTGDAKSKEKVDNKEDRDNNTIYGFTHTQFFAGLGIVFVIGAIANTGRIVILKVTGEKLV 204

Query: 201 ARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGV 260
           ARLR   +K  L QDA F D+++VGDLISRL SDA +V++S+T  VSDG +A++ G VG 
Sbjct: 205 ARLRTRTMKAALDQDATFLDSNRVGDLISRLSSDASIVAKSVTMNVSDGTRAILQGFVGF 264

Query: 261 GMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 320
            MM  +S +L+ +++   PP+   A V+GK+IRN S+ LQ A G LT+VAEEQL+  KT+
Sbjct: 265 SMMSYISFKLTSVMVLLIPPLGIMALVYGKKIRNLSRQLQTAVGGLTKVAEEQLNATKTI 324

Query: 321 QSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQS 380
           Q++  E  E+ RY   +RD+F VG               L+G+ + L++L  G+ ++   
Sbjct: 325 QAYGGEKKEIRRYASEVRDVFDVGLKEAITSGIFFGSTGLVGNAALLSLLLVGTNMISSG 384

Query: 381 QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQ 440
            L++GDL++FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G    
Sbjct: 385 SLTVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELDDRKPLIKPTIGKDPV 444

Query: 441 PERG-VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
             +G  I F+DVSF YPTRP+ ++F  ++FKI PG  +C VGPSG GKST++ LLLRYY+
Sbjct: 445 TLKGKAIIFQDVSFHYPTRPNHRVFNKISFKIEPGEHICFVGPSGSGKSTVSQLLLRYYD 504

Query: 500 PTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGL--TYTPTKEEIRS 557
            T G I+I   +I  L+ +  R+ +G+VQQEP+L +GTI DNI Y +       K ++  
Sbjct: 505 ATEGNILIGEDNIKSLSLRKYRKLLGVVQQEPMLFNGTIIDNILYNVPDEIASQKNKVDL 564

Query: 558 VAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
             K+  C  F+  FP+  +T++GP GT LSGGQKQRIAIAR+ +  P+IL+LDEATSALD
Sbjct: 565 AIKKSNCTKFLANFPDGLNTIVGPRGTQLSGGQKQRIAIARSFLLDPSILLLDEATSALD 624

Query: 618 VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANS 677
            +SE  I  T  +  +++ +T +SIAHRLSTI+ S  V+VL  +GSVVE GKF EL AN 
Sbjct: 625 TQSEDIIAMTLKK-REAEGLTTISIAHRLSTIKYSSRVVVLNKNGSVVETGKFTELIANP 683

Query: 678 TSALSQLLNERA 689
           TS L+ LL++  
Sbjct: 684 TSELNLLLSKEG 695

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  524 bits (1350), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 278/625 (44%), Positives = 399/625 (63%), Gaps = 11/625 (1%)

Query: 95  EQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSD 154
           E SK++  KDI RLF LAK + K           S S+ M+IP +IG +LD  K  +  +
Sbjct: 86  EVSKSNGMKDIKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKADNDDE 145

Query: 155 FFDL-----KIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIK 209
             D      K+ IF L   +F +      L G  AN  R ++L++  ER+VARLR   +K
Sbjct: 146 DGDNNAKKEKLMIFGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVARLRTRTMK 205

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ 269
             L+QDA F D ++VGDLISRL SDA +V++++TQ VSDG +A+I G VG GMM  +S +
Sbjct: 206 AALYQDASFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFISWK 265

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
           L+ +++   PP+   A V+G++IR  S+ LQ + G LT+VAEEQL+  +T+Q++  E  E
Sbjct: 266 LTCVMMIMVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEALE 325

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389
           + RY   +R +F VG               L+G+++ +++L  G+ ++    L++GDL++
Sbjct: 326 IHRYATEVRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDLSS 385

Query: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERG-VIEF 448
           FM+Y  YTG+++FGLS FYSE+M+GAGAA+R+FEL DRKP I PT+G+  +   G  IEF
Sbjct: 386 FMMYAVYTGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIGYDPKSLLGKSIEF 445

Query: 449 KDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           ++VSF+YPTRP+  I  +L+  I PG  VCIVGPSG GKST++ LLLRYY+ +TG+I ID
Sbjct: 446 QNVSFAYPTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKID 505

Query: 509 NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGL----TYTPTKEEIRSVAKQCFC 564
            Q+I + N +  RR +G+VQQEP+L +GTI DNI Y +    T T    +++   +Q  C
Sbjct: 506 GQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQANC 565

Query: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
             F+  FP   +T++GP GT LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +
Sbjct: 566 TKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIV 625

Query: 625 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
                + ++   +T +SIAHRLSTI+ S  VIVL   GSVVE G F+EL   S S L+ L
Sbjct: 626 AKNLSERVE-LGLTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVDYSRSELNML 684

Query: 685 LNERAAPGPSDQQLQIEKVEEKEDT 709
           L+++   G  + ++  E V E  D+
Sbjct: 685 LSQQHKKGEEEMEIISESVTESNDS 709

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  524 bits (1349), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 283/621 (45%), Positives = 394/621 (63%), Gaps = 15/621 (2%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTS------ 150
           SK+  +KDI RLF LA+ + +           S S+ M++P +IG +LD  K        
Sbjct: 89  SKSSGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENEE 148

Query: 151 SGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKK 210
             S      I  F L   +F +   V  L+G  AN GR I+L++  ER+VARLR   +K 
Sbjct: 149 EDSKTIVPDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMKA 208

Query: 211 TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQL 270
            L QDA F D ++VGDLISRL SDA +VS+++TQ VSDG +A+I G VG GMM  LS +L
Sbjct: 209 ALDQDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWKL 268

Query: 271 SILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNEL 330
           + +++   PP+   A V+G++IRN SK LQE+ G L++VAEEQL+  KT+Q++V E  E+
Sbjct: 269 TGVMMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLEI 328

Query: 331 SRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAF 390
            RY   +R++F++G               L+G+++ +++L  G+ ++    L++G+L++F
Sbjct: 329 HRYATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSSF 388

Query: 391 MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERG-VIEFK 449
           M+Y  YTG+++FGLS+FYSE+M+GAGAASR+FEL DRKP I  TVG   +   G  I+F+
Sbjct: 389 MMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGKSIKFE 448

Query: 450 DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 509
           +VSF+YP+RP+ +IF +LN +I PG  VCIVG SG GKSTIA LLLRYY+   G+I I +
Sbjct: 449 NVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGD 508

Query: 510 QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYG----LTYTPTKEEIRSVAKQCFCH 565
            DI   + +  RR IG VQQEP L +G+I DNI Y     LT     E ++   KQ  C+
Sbjct: 509 NDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANCN 568

Query: 566 NFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN 625
            F+ KFP+   T++GP G  LSGGQKQRIA+ARA +  PT+LILDE+TSALD  SE  + 
Sbjct: 569 IFLGKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEELVA 628

Query: 626 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLL 685
            T  Q   ++ +T +SIAHRLSTI+ S  VIV+G  GSVVE G F  L  N  S L+ LL
Sbjct: 629 KTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSELNMLL 687

Query: 686 ---NERAAPGPSDQQLQIEKV 703
              NE     PS ++ + E+V
Sbjct: 688 SQQNEHIDEDPSQEKQEPEEV 708

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  516 bits (1330), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 272/597 (45%), Positives = 376/597 (62%), Gaps = 5/597 (0%)

Query: 96  QSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDF 155
            SK+  +KDI RLF+L+K + K           S S+ M++P VIG +LD    S G D 
Sbjct: 80  NSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASESDGEDE 139

Query: 156 FDLKI-PIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQ 214
              K   ++     +F +      +IG  AN  R I+L++  ER+VARLR   +K  L Q
Sbjct: 140 EGSKSNKLYGFTKKQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQ 199

Query: 215 DAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILL 274
           DA F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  LS +L+ ++
Sbjct: 200 DATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVM 259

Query: 275 LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
           +   PP+   A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ RY 
Sbjct: 260 MILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYA 319

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
             +R++F +G               L+G+ + L++L  G+ ++    +++G+L++FM+Y 
Sbjct: 320 KEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYA 379

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-YQPERGVIEFKDVSF 453
            YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G       +  I FK+VSF
Sbjct: 380 VYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSF 439

Query: 454 SYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 513
           +YPTRP  QIFK LN  I PG  VC VGPSG GKSTIA LLLRYY+  +G+I   ++DI 
Sbjct: 440 TYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIR 499

Query: 514 KLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGL--TYTPTKEEIRSVAKQCFCHNFITKF 571
             N +  RR IG VQQEP+L +GTI DNI Y +        + IR    +  C  F+  F
Sbjct: 500 NFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLANF 559

Query: 572 PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQL 631
           P+   T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +     Q 
Sbjct: 560 PDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNL-QR 618

Query: 632 MKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNER 688
              +  T +SIAHRLSTI+ S  VIVLG  GSVVE G F++L A   S L+ LL E+
Sbjct: 619 RVERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIPNSELNALLAEQ 675

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  516 bits (1329), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 268/596 (44%), Positives = 377/596 (63%), Gaps = 4/596 (0%)

Query: 95  EQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSD 154
             SK   ++DI RLF+LAK + +           S ++ M++P VIG +LD  +      
Sbjct: 76  HDSKASGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIAREEHEQP 135

Query: 155 FFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQ 214
             + +  IF L   +F +      ++G  AN GR ++L++  ER+VARLR   +K  L Q
Sbjct: 136 ETEKETMIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRTMKAALEQ 195

Query: 215 DAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILL 274
           DA F D+++VGDLISRL SDA +VS+S+TQ +SDG +A+I G VG GMM  +S +L+ ++
Sbjct: 196 DATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKLTCVM 255

Query: 275 LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
           +   PP+   A V+GK+IRN S+ LQ + G+LT+V+EEQLS  KT+Q++  E  E+ RY 
Sbjct: 256 MLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIHRYA 315

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
             +R +F VG                +G+++ L +L  G+ ++    +++GDL++FM+Y 
Sbjct: 316 DEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFMMYA 375

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-YQPERGVIEFKDVSF 453
            YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G      E   I F  V F
Sbjct: 376 VYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSIHFNHVKF 435

Query: 454 SYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 513
           SYPTRP   IF+ LNF + PG  VCIVGPSG GKST+A LLLRYY+  +G I + N +I 
Sbjct: 436 SYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGNDNIR 495

Query: 514 KLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITKF 571
             N +  RR +G+VQQEP+L SGTI DNITY +      +E R      Q  C  F+  F
Sbjct: 496 DFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTKFLANF 555

Query: 572 PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQL 631
           P+   T +GP GT LSGGQKQRIA+ARA +  P+ILILDEATSALD +SE  +  +  Q 
Sbjct: 556 PDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQ- 614

Query: 632 MKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
             ++  T +SIAHR+STI+ S  VIVL   G+V E G F +L A   S+L++LL++
Sbjct: 615 RSARGKTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLNKLLSK 670

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  516 bits (1329), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 266/608 (43%), Positives = 381/608 (62%), Gaps = 16/608 (2%)

Query: 95  EQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSD 154
           ++S    +KD+ RLF LA+ +             S ++ M +P VIG +LD  K  S  +
Sbjct: 90  DESGRSGFKDVKRLFELARPETFYISIALLLIFISSAVSMVVPSVIGKLLDIAKPPSADE 149

Query: 155 FF------------DLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVAR 202
                         D    I+ L   +F +   V   +G  AN GR I+L++  ER+VAR
Sbjct: 150 ENGKGVSEKLKEKEDEDKKIYGLTALQFYTALGVVFTVGALANTGRIIILKVTGERLVAR 209

Query: 203 LRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGM 262
           LR   +K  L Q+A F D++KVGDLISRL +DA +V++S+TQ VSDG +A++ G VG GM
Sbjct: 210 LRTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQNVSDGTRAILQGFVGFGM 269

Query: 263 MCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS 322
           M  +S QL+ ++L   PP+   A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q+
Sbjct: 270 MSYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQA 329

Query: 323 FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL 382
           +  E  E+ RY   +R++F +G               L+G+ + L++L  G+ ++    L
Sbjct: 330 YGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNTALLSLLVVGTNMISSGAL 389

Query: 383 SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPE 442
           ++G+L++FM+Y  YTG+++FGLSTFYSE+M+GAGAA+R+FEL+DRKP+I PT+G      
Sbjct: 390 TVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVFELSDRKPAIKPTIGKDPITL 449

Query: 443 RG-VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 501
            G  +EFK+VSF YPTRP  QIF+  + KI PG  VC VGPSG GKST++ LLLRYY+  
Sbjct: 450 FGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPSGSGKSTVSSLLLRYYDVA 509

Query: 502 TGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKE--EIRSVA 559
            G+I++  +DI   + +  RR +G+VQQEP+L +GTI +NI Y +      E   I    
Sbjct: 510 KGSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILENILYSVPEEIANEPGRIERAI 569

Query: 560 KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
           +   C  F+  FP+  +T++GP GT LSGGQKQRIA+AR  +  P+ILILDEATSALD +
Sbjct: 570 ESANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALARTFLLDPSILILDEATSALDSQ 629

Query: 620 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
           SE  I     Q    K  T +SIAHRLSTI+ S  V+VLG +G VVE G F+EL +N +S
Sbjct: 630 SEDIIAQNL-QARNEKGQTTISIAHRLSTIKHSSRVVVLGKNGCVVETGTFQELISNPSS 688

Query: 680 ALSQLLNE 687
            L+ LL +
Sbjct: 689 GLNILLTQ 696

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  513 bits (1322), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 275/604 (45%), Positives = 383/604 (63%), Gaps = 18/604 (2%)

Query: 96  QSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDF 155
            SK+  +KDI RLF+L++ + K           S S+ M++P VIG +LD    S   + 
Sbjct: 80  NSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVIGKLLDVASESDDEED 139

Query: 156 F----DLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKT 211
                D K+  + L   +F +   +  +IG  AN  R I+L+I  ER+VARLR   +K  
Sbjct: 140 EEKARDSKL--YGLTKKQFFTALGLVFVIGAVANASRIIILKITGERLVARLRTRTMKAA 197

Query: 212 LHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLS 271
           L QDA F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  LS +L+
Sbjct: 198 LDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLT 257

Query: 272 ILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELS 331
            +++   PP+   A V+GK+IRN S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ 
Sbjct: 258 CVMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVH 317

Query: 332 RYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFM 391
           RY   +R++F +G               L+G+ + L++L  G+ ++    ++IG+L++FM
Sbjct: 318 RYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNMIQSGVMTIGELSSFM 377

Query: 392 LYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YQPERGVI 446
           +Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G       ++P    +
Sbjct: 378 MYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPISLAHKP----V 433

Query: 447 EFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 506
            FK+VSF+YPTRP  QIFK LN  I PG  VC VGPSG GKSTIA LLLRYY+  +G+I 
Sbjct: 434 VFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIE 493

Query: 507 IDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFC 564
            D++D+   N +  RR IG VQQEP+L +GTI DNI Y +     + E R     +Q  C
Sbjct: 494 FDDEDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSEIAEREDRVARAIEQANC 553

Query: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
             F+  FP+   T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +
Sbjct: 554 TKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPALLILDEATSALDSQSEEIV 613

Query: 625 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
                Q    + +T +SIAHRLSTI+ S  +IVLG  GSVVE G F++L A   S L+ L
Sbjct: 614 AKNL-QKRVERGLTTISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDLIAIPDSELNAL 672

Query: 685 LNER 688
           L E+
Sbjct: 673 LAEQ 676

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  513 bits (1321), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 269/595 (45%), Positives = 376/595 (63%), Gaps = 11/595 (1%)

Query: 102 YKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKI- 160
           +KDI RLF LAK +             S ++ M+IP ++G +LD  K    +D       
Sbjct: 90  FKDIKRLFRLAKPETLQIALALVLILISSAVSMTIPTIVGKLLDIAKDRKDADDTTEDDE 149

Query: 161 --PIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEF 218
              IF +   +F +      L+G AAN GR ++L+I  ER+VARLR   +K  L QDA F
Sbjct: 150 GPKIFGMTTKQFCTALLAVFLVGAAANAGRIVILKITGERLVARLRTRTMKAALDQDATF 209

Query: 219 FDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFT 278
            D ++VGDLIS L SDA +V++S+TQ VSDG +A+I G VG GMM  +S QL+ +++   
Sbjct: 210 LDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAVIQGFVGFGMMGYISWQLTSVMILMI 269

Query: 279 PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
           PP+   A V+G++IRN S+ LQ + G LT+V+EEQL  +KT+QS+V E  E+ RY   +R
Sbjct: 270 PPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAVKTIQSYVGEKKEIHRYATEVR 329

Query: 339 DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
           ++F +G               L+G++S L +L  G+ ++    +++GDL++FM+Y  YTG
Sbjct: 330 NVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVGTNMIQNGLITVGDLSSFMMYAVYTG 389

Query: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-YQPERGVIEFKDVSFSYPT 457
           +++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G          I F++VSF+YPT
Sbjct: 390 SSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPPTIGQDPVTLANKTIRFENVSFTYPT 449

Query: 458 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNC 517
           R + +IF  L+  + PG  VCIVGPSG GKST+A LLLRYY+   G IMI + +I   N 
Sbjct: 450 RLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGDHNINSFNV 509

Query: 518 KSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE----IRSVAKQCFCHNFITKFPN 573
           +  RR +GIVQQEP L +GTI DNI Y  T  P + +    I +   Q  C  F+  FP+
Sbjct: 510 RKYRRLLGIVQQEPQLFNGTILDNILY--TVPPERADNDDLISTAIGQANCSKFLANFPD 567

Query: 574 TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMK 633
              T++GP G  LSGGQKQRIA+ARA +  P++LILDEATSALD +SE  +  T  ++  
Sbjct: 568 GLQTLVGPRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEEIVAQTL-RVRV 626

Query: 634 SKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNER 688
            + +T +SIAHRLSTI+    V+VLG  G VVE G F+EL  N  S LS LL+++
Sbjct: 627 QRGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELLRNPLSELSILLSQQ 681

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  509 bits (1312), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 269/598 (44%), Positives = 377/598 (63%), Gaps = 6/598 (1%)

Query: 96  QSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLD--TLKTSSGS 153
            SK+  +KDI RLF+L+K + K           S S+ M++P VIG +LD  +       
Sbjct: 80  NSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASETEDEEK 139

Query: 154 DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLH 213
           +       ++ L   +F +   +  +IG  AN  R I+L++  ER+VARLR   +K  L 
Sbjct: 140 EEKAKSNKLYGLTKRQFFTALGLVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALD 199

Query: 214 QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL 273
           QDA F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  LS +L+ +
Sbjct: 200 QDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCV 259

Query: 274 LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRY 333
           ++   PP+   A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ RY
Sbjct: 260 MMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRY 319

Query: 334 NVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLY 393
              +R++F +G               L+G+ + L++L  G+ ++    +++G+L++FM+Y
Sbjct: 320 AKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMY 379

Query: 394 TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-YQPERGVIEFKDVS 452
             YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G       +  I FK+VS
Sbjct: 380 AVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVFKNVS 439

Query: 453 FSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDI 512
           F+YPTRP  QIFK LN  I PG  VC VGPSG GKSTIA LLLRYY+  +G+I   ++DI
Sbjct: 440 FTYPTRPKHQIFKDLNITINPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDI 499

Query: 513 TKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITK 570
              N +  RR IG VQQEP+L +GTI DNI Y +     ++E R      Q  C  F+  
Sbjct: 500 RSFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRIGRAIGQANCTKFLAN 559

Query: 571 FPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQ 630
           FP+   T +G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +     Q
Sbjct: 560 FPDGLQTTVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNL-Q 618

Query: 631 LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNER 688
               + +T +SIAHRLSTI+ S  V+VLG  GSVVE G F++L A   S L+ LL E+
Sbjct: 619 RRVERGLTTISIAHRLSTIKHSTRVVVLGKHGSVVETGSFQDLIAIPNSELNALLAEQ 676

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  508 bits (1309), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 280/626 (44%), Positives = 392/626 (62%), Gaps = 25/626 (3%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFF 156
           SK+  +KDI RLF+L++ +             S S+ M++P VIG +LD        +  
Sbjct: 80  SKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDDDEEDA 139

Query: 157 ----DLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTL 212
               D K+  + L   +F +      LIG  AN  R I+L++  ER+VARLR   +K  L
Sbjct: 140 KETKDNKL--YGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTRTMKAAL 197

Query: 213 HQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSI 272
            QDA F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  LS +L+ 
Sbjct: 198 DQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTC 257

Query: 273 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332
           +++   PP+   A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ R
Sbjct: 258 VMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRR 317

Query: 333 YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 392
           Y   +R++F VG               L+G+ + L++L  G+ ++    +++G+LT+FM+
Sbjct: 318 YAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGELTSFMM 377

Query: 393 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YQPERGVIE 447
           Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G       ++P    I 
Sbjct: 378 YAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKP----IV 433

Query: 448 FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI 507
           FKDVSF+YPTRP  QIFK LN  I PG  VC VGPSG GKSTIA LLLRYY+ + G+I  
Sbjct: 434 FKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSIDF 493

Query: 508 DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK---QCFC 564
            ++DI   N +  RR +G VQQEP+L +GTI DNI Y +     ++E R VA+   Q  C
Sbjct: 494 GDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDR-VARAIGQANC 552

Query: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
             F+  FP+   T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +
Sbjct: 553 TKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVV 612

Query: 625 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
                + +K + +T +SIAHRLSTI+ S  VIVLG  GSVVE G F++L +   S L+ L
Sbjct: 613 AKNLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIPGSELNAL 671

Query: 685 LNERAAPGPSDQQLQIEKVEEKEDTN 710
           L E+      D + + E V  K + N
Sbjct: 672 LAEQ-----QDDEGKDETVTSKNNNN 692

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  507 bits (1305), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 277/612 (45%), Positives = 383/612 (62%), Gaps = 27/612 (4%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK-------T 149
           SK   +KDI RLF+LAK +             S ++ M+IP VIG +LD  K       +
Sbjct: 97  SKASGFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHLAGVS 156

Query: 150 SSG-----SDFFDLKIP-----IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERV 199
           +SG     SD  D +       I+ L   +F +      ++G  AN GR +LL++  E++
Sbjct: 157 ASGEGVGSSDSSDNQEDSSDRLIYGLTFPQFYTALGTIFVVGAFANMGRIVLLKVTGEKL 216

Query: 200 VARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVG 259
           VARLR   +K  L QDA F DN++VGDLISRL SDA +VS+S+TQ +SDG +A+I G VG
Sbjct: 217 VARLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARAVIQGAVG 276

Query: 260 VGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT 319
            GMM  +S +L+ ++    PP+   A V+GK+IRN S+ LQ + G LT+VAEEQLS  +T
Sbjct: 277 FGMMSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLSAART 336

Query: 320 VQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ 379
           VQ++  E  E+ RY   +R++F +G                +G+++ L +L  G+ ++  
Sbjct: 337 VQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLTGTSMIRS 396

Query: 380 SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 439
             +++GDL++FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT G   
Sbjct: 397 GAITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTKGVDP 456

Query: 440 QPERG-VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
              +G  IEF++V+F+YPTR   +IF  L+  I PG  VCIVGPSG GKSTIA LLLRYY
Sbjct: 457 VTLQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIASLLLRYY 516

Query: 499 NPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR-- 556
           +   G I I  QDI + N +  RR +G+VQQEP+L +GTI DNITY +      ++ R  
Sbjct: 517 DVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELAGDDSRVS 576

Query: 557 SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
               Q  C  F+  FP+  +T++GP G  +SGGQKQRIA+ARA +  P +LILDEATSAL
Sbjct: 577 RAIGQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLILDEATSAL 636

Query: 617 DVESEGAINYTFGQLMKSKSM---TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
           D +SE  +     Q ++S+S    T VSIAHRLSTI+ S  VIVL   G V E G F+EL
Sbjct: 637 DSQSEEVV----AQSLRSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFREL 692

Query: 674 YANSTSALSQLL 685
            ++  S L+QLL
Sbjct: 693 ISDPDSHLTQLL 704

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  505 bits (1300), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 269/596 (45%), Positives = 376/596 (63%), Gaps = 6/596 (1%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKT--SSGSD 154
           SK   +K++ RLF LA+ + K           S ++ M+IP VIG +LD  K   + G  
Sbjct: 75  SKEYGFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEAGGDG 134

Query: 155 FFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQ 214
             + +  I+ L   +F +      +IG  AN GR ++L++  E++VARLR   +K  L Q
Sbjct: 135 DEEQETRIYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKTMKAALQQ 194

Query: 215 DAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILL 274
           DA F D ++VGDLISRL SDA +VS+S+TQ  SDG +A+I G+VG GMM  +S QL+ ++
Sbjct: 195 DAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYISAQLTGVM 254

Query: 275 LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
           L   PP++  A V+G++IRN +++LQ   G LT+VAEEQL+  +T+QS+  E  E+ RY 
Sbjct: 255 LLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGERKEIRRYA 314

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
             +R +F+VG               L+G+++ L +L  G+ ++    +++G+L++FM+Y 
Sbjct: 315 EEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGELSSFMMYA 374

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-YQPERGVIEFKDVSF 453
            YTG+++FGLS+FYSE+M+GAGAASR+FEL DR P I PT G          IEFK+V F
Sbjct: 375 VYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEIEFKNVKF 434

Query: 454 SYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 513
           SYP+R +  +F  LN KI PG  VC+VGPSG GKSTI+ LLLR+Y+  +G I I  Q+I 
Sbjct: 435 SYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVITIGGQNIK 494

Query: 514 KLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGL--TYTPTKEEIRSVAKQCFCHNFITKF 571
             N +  RR +GIVQQEP+L +G+I+DNI Y L       K  +    +   C  FI+ F
Sbjct: 495 DFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANCTRFISNF 554

Query: 572 PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQL 631
           P+  DT++GP GT LSGGQKQRIAIARA I  P+ILILDEATSALD +SE  I       
Sbjct: 555 PDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDIIAQALRAR 614

Query: 632 MKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
            +S  +TI SIAHR+STI  S  VIVL  +G V E G F +L     S L++LL++
Sbjct: 615 SESGKITI-SIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNKLLSK 669

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  500 bits (1288), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 280/681 (41%), Positives = 399/681 (58%), Gaps = 32/681 (4%)

Query: 48  LHTRSPIIGKTL-ILSSFRYISSKTKLQAPLPXXXXXXXXXXXXXXXTEQSKTDDYKDII 106
           L  R+P+  K L  L   R+ SS  K     P               + +  +  ++DI 
Sbjct: 39  LAIRTPMPSKPLGSLMQARWNSSNAKQ----PNTTNTDKTGQIAELSSNEKNSSGFRDIT 94

Query: 107 RLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSD------------ 154
           RL  LA+ +             S ++ M +P VIG +LD  K+SS S+            
Sbjct: 95  RLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSPSENEKQESGDGDDK 154

Query: 155 -FFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLH 213
                +  I+     +F        + G  AN GR I+L++  ER+VARLR   +K  L 
Sbjct: 155 DKDKEEGTIYGFTPKQFCVIMGGIFVAGAFANCGRIIILKVTGERLVARLRTRTMKAALD 214

Query: 214 QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL 273
           QD+ F D ++VGDLISRL SD+ +V++S+TQ VSDG +A+I G VG GMM  +S QL+ +
Sbjct: 215 QDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAVIQGFVGFGMMTYISWQLTCV 274

Query: 274 LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRY 333
           +    PP+   A ++GK+IRN SK LQ + G LT+VAEEQL   KT+QS+V E  E+ RY
Sbjct: 275 MGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQLGATKTIQSYVGEKKEIRRY 334

Query: 334 NVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLY 393
              +R +F +G                +G++S L +L  G+ ++    +++GDL++FM+Y
Sbjct: 335 AKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSGASMIQSGLITVGDLSSFMMY 394

Query: 394 TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGV-IEFKDVS 452
             YTG ++FGLS FYSE+M+GAGAA+R+FEL DRKP+I+PT+G      R + I FKDVS
Sbjct: 395 AVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAPTLGKGPTSIRNLPISFKDVS 454

Query: 453 FSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDI 512
           F+YPTR + +IF  LN  I PG  +CI GPSG GKSTIA LL+RYY+   G I I + D+
Sbjct: 455 FTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIASLLVRYYDVDQGGISIGDTDL 514

Query: 513 TKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK--QCFCHNFITK 570
              N +  RR IG+V QEPVL +GTI +NI Y +  +  ++E R  A   +  C  F++ 
Sbjct: 515 RTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQDERRVSAAIGKANCSKFLSN 574

Query: 571 FPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQ 630
           FP+  +T++GP G  LSGGQKQR+A+ARA +  P +L+LDEATSALD +SE  +  T  +
Sbjct: 575 FPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLDEATSALDSQSEEIVARTLQE 634

Query: 631 LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAA 690
            ++ + +T +SIAHR+STI  S  V+VLG DG VVE G F+EL     S L+ LL+ +  
Sbjct: 635 RVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPFQELIDRPNSELNYLLSLQ-- 691

Query: 691 PGPSDQQLQIEKVEEKEDTNE 711
                   Q E+ E KE+ +E
Sbjct: 692 --------QDEREEIKENPSE 704

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  499 bits (1284), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 273/622 (43%), Positives = 383/622 (61%), Gaps = 25/622 (4%)

Query: 94  TEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK----T 149
           +E+  +  +KDI RLF LA+ + K           S S+ M +P VIG ++D  K    +
Sbjct: 76  SEEQNSSSWKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVPGVIGKLMDVAKEDGTS 135

Query: 150 SSGSDF----------------FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLR 193
           SS +D                  D +  I  L L +F        ++G AAN GR ++L+
Sbjct: 136 SSEADGKRGDATDKTDGSTAADTDSEKLILGLTLPQFYGGLFSLFVVGAAANMGRIVILK 195

Query: 194 ILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 253
           +  E++VARLR   +K  L QDA F DN+KVGDLISRL SDA +VS+S+TQ +SDG ++L
Sbjct: 196 VTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSL 255

Query: 254 ICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
           I G VG GMM  +S +L+ +++   PP+   A V+G++IRN S+ LQ + G LT+ AEEQ
Sbjct: 256 IQGFVGFGMMSYISWKLTCVMMLLAPPLAVMALVYGRKIRNLSRTLQASVGGLTKAAEEQ 315

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
           LS  +T+Q++  E   +  Y   +R ++QVG               L+G+ + L +L  G
Sbjct: 316 LSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSAVLALLLTG 375

Query: 374 SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP 433
           + ++    +++GDL++FM+Y  YTG+++FG+S+FYSE+M+GAGAA+R+FEL DRKP+I P
Sbjct: 376 TSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRKPAIHP 435

Query: 434 TVGHK-YQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIAL 492
           T G       R  +EFK V F+YPTR    IF+ L+ +I PG  VCIVGPSG GKST+A 
Sbjct: 436 TKGRDPVSLARKPVEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHVCIVGPSGGGKSTVAS 495

Query: 493 LLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTK 552
           LLLR+Y+   G I+I  Q+I   N +  RR +GIVQQEP+L +GTI +NI Y +      
Sbjct: 496 LLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTILENILYTVPQRLLN 555

Query: 553 EEIRSVAK---QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
           EE   VA+   Q  C  F++ FP+   T++GP GT LSGGQKQRIA+ARA +  P +LIL
Sbjct: 556 EEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRIALARAFLLDPDLLIL 615

Query: 610 DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
           DEATSALD  SE  I  T      ++  T +SIAHR+STI+ S  VIVLG +G VVE G 
Sbjct: 616 DEATSALDSRSEEVIARTL-HSRTTRGKTTISIAHRVSTIQHSTRVIVLGRNGGVVETGT 674

Query: 670 FKELYANSTSALSQLLNERAAP 691
           F EL +N+ S L++LL +   P
Sbjct: 675 FDELASNTDSQLNKLLRKEEEP 696

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  491 bits (1264), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 260/598 (43%), Positives = 368/598 (61%), Gaps = 5/598 (0%)

Query: 94  TEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGS 153
           T        KD+ RLF LA+ + K           S ++ M+IP VIG +LD  +     
Sbjct: 74  TATGNASGAKDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVAREDVEQ 133

Query: 154 DFFDLKIPI-FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTL 212
           +  D +  + + LP  +F    +    +G  AN GR ++L+   ER+VARLR   +K  L
Sbjct: 134 ESGDEEEAVLYGLPEKQFYLALSGIFAVGALANMGRIVVLKTTGERLVARLRTRTMKAAL 193

Query: 213 HQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSI 272
            Q+  F D+++VGDLISRL SDA +VS+S+TQ  SDG +A+I G VG GMM  +S QL+ 
Sbjct: 194 EQEGAFLDSNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGAVGFGMMSYISWQLTA 253

Query: 273 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332
           ++    PP++  A+ +G+++RN S++LQ   G LT+VAEEQL+  +TVQ++  E  E+ R
Sbjct: 254 VMTLLAPPLVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNATRTVQAYCGERREIRR 313

Query: 333 YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 392
           Y   +R++F VG                +G+ + L +L  G+ ++    +S+G+L++FM+
Sbjct: 314 YATEVRNVFDVGLKEALISGSFFGATGFVGNATLLALLLTGTSMIKGGGISVGELSSFMM 373

Query: 393 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERG-VIEFKDV 451
           Y  YTG+++F LS+FYSE+M+GAGAA R+FEL DRKP I PT+G       G  I F  V
Sbjct: 374 YAVYTGSSLFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIGKDPVSLTGKTIAFNSV 433

Query: 452 SFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQD 511
           +F+YPTRP  Q+F  ++  I PG  VCIVGPSG GKST+A LLLR+Y+P +G+I I  +D
Sbjct: 434 NFAYPTRPHHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLLRFYDPISGSITIGGED 493

Query: 512 ITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFIT 569
           I   N    RR +GIVQQEPVL + +I +NITY L    TK+  R     +   C  F+ 
Sbjct: 494 IRLFNLSKYRRMMGIVQQEPVLFNASILENITYALPLHLTKDPARIDRALRLSNCSAFVG 553

Query: 570 KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629
            FP    T +GP GT LSGGQKQR+A+ARA ++ P ILILDEATSALD +SE  +  T  
Sbjct: 554 SFPEGLQTAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLL 613

Query: 630 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
           Q  +   +TI SIAHR STI+ S  VIVL   G V+E G +++L  +  S+LS LL++
Sbjct: 614 QRCQEAKITI-SIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQLIGDPGSSLSGLLSK 670

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  488 bits (1255), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 263/608 (43%), Positives = 378/608 (62%), Gaps = 17/608 (2%)

Query: 95  EQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSD 154
           E+  +  +KDI RLF LA+ + +           S S+ M +P VIG ++D  K    + 
Sbjct: 77  EEHNSSSWKDIKRLFQLARPESRSMFFALALIIISSSVSMLVPGVIGKLMDAAKDDQQAS 136

Query: 155 FF-----------DLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARL 203
                             IF L + +F        ++G AAN GR ++L++  E++VARL
Sbjct: 137 KLVENDSDAAAPDADGRQIFGLTMPQFYGVLFSVFVVGAAANMGRIVILKVTGEKLVARL 196

Query: 204 RAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMM 263
           R   +K +L QDA F DN+KVGDLISRL SDA +VS+S+TQ +SDG ++LI G VG GMM
Sbjct: 197 RTRTLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMM 256

Query: 264 CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSF 323
             +S +L+ +++   PP+   A ++GK+IRN S+ LQ + G LT+ AEEQLS  +T+Q++
Sbjct: 257 SYISWKLTCVMMLLAPPLAAMALIYGKRIRNLSRTLQASVGGLTKAAEEQLSATRTIQAY 316

Query: 324 VAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS 383
             E + + +Y   +R ++QVG               L+G+++ L +L  G+ ++    ++
Sbjct: 317 GGEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVGNVAVLALLLTGTSMIRTGAMT 376

Query: 384 IGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPER 443
           +GDL++FM+Y  YTG+++FG+S+FYSE+M+GAGAA+R+FEL DR+P+I PT G       
Sbjct: 377 LGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRRPAIHPTRGIDPVSLA 436

Query: 444 GV-IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 502
           G  +EF++V F+YPTR    IF++L F+I  G  VCIVGPSG GKST+A LLLR+Y+  T
Sbjct: 437 GKPVEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPSGGGKSTVASLLLRFYDVDT 496

Query: 503 GTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK-- 560
           G I I  Q I   N +  RR +G+VQQEP+L +GTI DNI Y +  +   +E R VA+  
Sbjct: 497 GAITIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIVYSVPQSLLNDENR-VARAI 555

Query: 561 -QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
            Q  C  F++ FP+   T++GP GT LSGGQKQRIA+ARA +  P +LILDEATSALD  
Sbjct: 556 GQANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSR 615

Query: 620 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
           SE  +         ++  T +SIAHR+STI+ S  VIVLG  G VVE G F EL ++  S
Sbjct: 616 SEEVVARALYS-RSTRGKTTISIAHRVSTIQHSSRVIVLGRSGYVVETGTFDELISDPDS 674

Query: 680 ALSQLLNE 687
            L+ LL +
Sbjct: 675 QLNLLLRK 682

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  476 bits (1225), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 262/618 (42%), Positives = 376/618 (60%), Gaps = 31/618 (5%)

Query: 94  TEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDT---LKTS 150
           +  +K    +DI  LF LAK +             + ++ M +P VIG +LD    ++ +
Sbjct: 88  STNTKGKTREDIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDISTGIEFA 147

Query: 151 SGSDFFD----------------LKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRI 194
           S  D  D                 +  I+      F S   V  ++G  AN GR I+L++
Sbjct: 148 SNKDENDESSKEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIILKL 207

Query: 195 LSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI 254
             ER+VARLR   +K  L QD +F D++KVGDLISRL SD+ +VS ++T+ VSDG +A+I
Sbjct: 208 TGERIVARLRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVI 267

Query: 255 CGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQL 314
            G VGVGMM  +S +LS ++LF  PP+   A ++G++IRN SK LQE+ G LT+++EEQL
Sbjct: 268 QGCVGVGMMSFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQL 327

Query: 315 SGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
           +G +T+QS+V E  E+ +Y   +R ++ VG               L+G+ + L++L  G 
Sbjct: 328 NGTRTIQSYVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGC 387

Query: 375 YLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPT 434
            ++    LSIG L++FM+Y  YTG+++FGLS+FYSEIM+G+GAASR+FE+    P I+ T
Sbjct: 388 NMISNGTLSIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINAT 447

Query: 435 VG-----HKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKST 489
            G      + +P    IEF+ + F+YPTR    IF+ LN KI PG  VCI+GPSG GKST
Sbjct: 448 KGIDPISFQDKP----IEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKST 503

Query: 490 IALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGL--T 547
           I+ LLLRYY+P  GTI I  +DI + + +  R+ +G+V QEPVL +GTI +NI Y +   
Sbjct: 504 ISSLLLRYYDPLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEE 563

Query: 548 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTIL 607
               KE + +  +   C+ F+   P   +T +GP GT LSGGQKQR+A+ARA + +PT+L
Sbjct: 564 IANDKERLSNAIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLL 623

Query: 608 ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
           +LDEATSALD  SE  +  T  Q   +K  T +SIAHR+STI+ S  V+VL   G VVE 
Sbjct: 624 VLDEATSALDPRSESIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVLDKVGHVVET 682

Query: 668 GKFKELYANSTSALSQLL 685
           G ++EL     SAL++LL
Sbjct: 683 GPYEELLGIKDSALNKLL 700

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  469 bits (1208), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 257/598 (42%), Positives = 362/598 (60%), Gaps = 22/598 (3%)

Query: 94  TEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGS 153
           T+  KT  +  + +L  LAK + K           S ++ MS+P VIG ++D   T    
Sbjct: 23  TDLKKTQTWTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLIDHASTPDA- 81

Query: 154 DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLH 213
                  PI+ L   +FL       ++G  AN GR I+L+I  E++VARLR   +K  L 
Sbjct: 82  -------PIYGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVARLRTKTMKSMLS 134

Query: 214 QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL 273
           QDA F D H+VGDLISRL SDA +VS+S+T  +SDG +A + G+VG+GMM  +S +L+ +
Sbjct: 135 QDATFLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMTYISLKLTTV 194

Query: 274 LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRY 333
           +    PP+   A ++G +I+  S+ LQ+  GQL++ +EEQL+ +KTVQ++  E  EL RY
Sbjct: 195 MTMMVPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYAGERKELQRY 254

Query: 334 NVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLY 393
           +  +R +F +G               L+G+++ + +L  G+     S +++G+L++FM+Y
Sbjct: 255 SNEVRSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITLGELSSFMMY 311

Query: 394 TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGV----IEFK 449
             YTG++VFGL+ FYSE+M+G GAA R+ EL + K  ISPT G    P + +    I F 
Sbjct: 312 GVYTGSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKG--ISPPKTLKGLPITFN 369

Query: 450 DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 509
           +VSF+Y    SV     +NF+I PG  VC VG SG GKSTI+ LLLRYY   +G I I N
Sbjct: 370 NVSFAYSNGKSV--LSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGN 427

Query: 510 QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 569
            DI+  N +  RR +G+VQQEP+L +GTI DNITYGL +  +  ++    K   C  FI 
Sbjct: 428 YDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGL-HDKSLTDLNMALKAANCDQFIK 486

Query: 570 KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629
           +     DT++GP G  LSGGQ+QRIA+AR  ++ P ILILDEATSALD +SE  IN    
Sbjct: 487 ESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKEL- 545

Query: 630 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
           Q  +   MT +SIAHRLSTIR S  VIV+  DG VVE G F +L +   S L++LL E
Sbjct: 546 QRRQEAGMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQLRSTRDSELNKLLKE 602

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  213 bits (542), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 156/525 (29%), Positives = 275/525 (52%), Gaps = 38/525 (7%)

Query: 178  LLIGCAA-----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISR 230
            L++G AA     NF +  LL   SE  V  LR  V++K   ++ ++F  +N+K  ++ + 
Sbjct: 765  LVLGVAAADGIFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISAL 824

Query: 231  LGSDAYVVSRSMTQKVSDGVKAL--ICGIVGVGMMCSL--SPQLSILLLFFTPPVLFSAS 286
            + +D     R +   VS+ + A+     +  +G++ +L    +LS++ +   P ++  ++
Sbjct: 825  VLNDL----RDLRSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSA 880

Query: 287  VFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGN-ELSRYNVAIRDIFQVGX 345
            ++G  ++    D + +  QL     + ++ IKT++   AE + +L+ +++ I+ + Q+  
Sbjct: 881  IYGGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIK-MQQIAS 939

Query: 346  XXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLS 405
                         +++       +  YG  LV+  + +  ++        +T  +   L 
Sbjct: 940  KRAIATGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLV 999

Query: 406  TFYSEIMQGAGAASRLFELTDRKPSI-------SPTVG---HKY--QPERGVIEFKDVSF 453
            +   +I +G  AAS ++ + D K +        + TVG   H Y  + ++ ++  ++++F
Sbjct: 1000 SQIPDISRGQRAASWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTF 1059

Query: 454  SYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 513
            +YP+ P+  ++K++NF +  G ++ I+G SG GKST+ LLL + YN   G I ID  D+ 
Sbjct: 1060 AYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVN 1119

Query: 514  KLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 573
              N  SLR++I +V+Q+P+L +GTIRDN+TYGL     + E+    K    H+F+   P 
Sbjct: 1120 DWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQ 1179

Query: 574  TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMK 633
              DT I    TLLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN    +++K
Sbjct: 1180 GLDTRIDT--TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIIN----EIVK 1233

Query: 634  SK--SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
                ++  + I H    +R   ++ VL  DG VVE G F  LY N
Sbjct: 1234 KGPPALLTMVITHSEQMMRSCNSIAVL-KDGKVVERGNFDTLYNN 1277

 Score =  174 bits (441), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 139/513 (27%), Positives = 239/513 (46%), Gaps = 37/513 (7%)

Query: 195 LSERVVARLRAHVIKKTLHQD-AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKA- 252
           + ER   R+R+ +++  L +   E++DN++      +L  D   ++R + +  S   +A 
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNE------KLLGDFTQINRCVEELRSSSAEAS 152

Query: 253 --------LICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATG 304
                    IC ++G     S S  L++++L  +P + F A VF + I   S+     T 
Sbjct: 153 AITFQNLVAICALLGTSFYYSWS--LTLIILCSSPIITFFAVVFSRMIHVYSEKENSETS 210

Query: 305 QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL 364
           +  ++    ++  + V+ +  +  E  ++   I +                     L   
Sbjct: 211 KAAQLLTWSMNAAQLVRLYCTQRLERKKFKEIILNCNTFFIKSCFFVAANAGILRFLTLT 270

Query: 365 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            F+    +GS ++ + +L+I D+          G+ +         + +G  A  ++  L
Sbjct: 271 MFVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTL 330

Query: 425 ----TDRKPSISPTVGHKYQPERGV--IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVC 478
               + R P ++ TV H++  +     + F +VSFSYP+RPS  + K+++   + G    
Sbjct: 331 LKDGSKRNP-LNKTVAHQFPLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTF 389

Query: 479 IVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTI 538
           IVG SG GKST++ LLLR+Y+   G+I I+  +I  ++ K L   I +V+Q   L + T+
Sbjct: 390 IVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTL 449

Query: 539 RDNITYGLT---------YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGG 589
           R NI  G T             +  I+   +      FI   P+  +T+IG  G  LSGG
Sbjct: 450 RKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGG 509

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 649
           Q+QR+AIARA I+   IL LDEA SALD+     +        K K+  I++  H LS I
Sbjct: 510 QQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT--HELSQI 567

Query: 650 RRSENVIVLGHDGSVVEMGKFKELYANSTSALS 682
             S++ + L  +G VVE G   EL A+ T+  S
Sbjct: 568 -ESDDYLYLMKEGEVVESGTQSELLADPTTTFS 599

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  209 bits (531), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 155/520 (29%), Positives = 251/520 (48%), Gaps = 58/520 (11%)

Query: 185  NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISR----------LG 232
            NF ++ L    SE  + +LR  V+++   ++ ++F  + HK  ++ +           L 
Sbjct: 750  NFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERHKASEVSALLLNDLRDLRALA 809

Query: 233  SDAYVVSRSMTQKVSDGV-KALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQ 291
            SD  +   S     S G+  ALI G            +LS++ +   P ++  ++V+G  
Sbjct: 810  SDFLIAVSSFAVVSSVGIIWALIIGW-----------KLSLVCISMFPLIVIFSAVYGMA 858

Query: 292  IRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN--------VAIRDIFQV 343
            ++      + A   L  +  E  +GIKT++    E N L +Y         +A R     
Sbjct: 859  LQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHMRVIASRRAITT 918

Query: 344  GXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL---TAFMLYTEYTGNA 400
            G              ++L          Y   LV+  Q +   +      +L+T  T N 
Sbjct: 919  GLGVAVIEALAMSIQAIL--------FYYALKLVIDGQYTTKKMFETLTLLLFTIMTCNI 970

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERG-------VIEFKDVSF 453
               L +   +I +G  AA+R+ ++ D K         K Q   G       VI  ++V+F
Sbjct: 971  ---LISQVPDISRGQRAANRILQMLDEKLEREKPHQEKKQTTSGSVSESSAVISLQNVTF 1027

Query: 454  SYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 513
            +YP+ PS+ IF SL  ++  G +  +VG SG GKST+  LL + Y PT+GT++++N+D+ 
Sbjct: 1028 AYPSAPSIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYRPTSGTVLVENKDVN 1087

Query: 514  KLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 573
            + N + LRRQ+ +V+Q P + SGT+R+N+ YGL + P + E+  V +    H+FI+K P 
Sbjct: 1088 EWNIRDLRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVLRYVGIHDFISKLPL 1147

Query: 574  TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMK 633
              DT I     LLSGGQ QR+ IARA++K+P ILILDE TSALD  S   IN    +   
Sbjct: 1148 GLDTTIDID--LLSGGQLQRLCIARAILKRPKILILDECTSALDPFSSHVINNIVRR--G 1203

Query: 634  SKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
              +   +SI H +  ++  + +I L  +G V   G F  L
Sbjct: 1204 CPAPLTISITHNVDMMKACDEIIFL-KNGRVAGTGSFDAL 1242

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 126/487 (25%), Positives = 235/487 (48%), Gaps = 19/487 (3%)

Query: 194 ILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVV--SRSMTQKVSDGV- 250
           +L ER    +R  ++ K L    E++D  K  D+          V  +R+   + S  + 
Sbjct: 84  LLGERCGFGIRRRLLYKYLENPFEWYD--KTEDICGNFTQQNRCVEEARASCAEASAVIT 141

Query: 251 KALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA 310
           ++L+  I  +G     S  L+++ L   P ++     F ++++  +    E T + +++ 
Sbjct: 142 RSLVTIIALIGTSFYASWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENEQTSKASQLL 201

Query: 311 EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVL 370
           +  ++  + ++    E  E+  +   +++                     L    F+   
Sbjct: 202 DWSMTAAQFIRLSGTELREIKSFKNCVQNCTNNFVKMCQYSSINLATLKFLSLAMFVQAF 261

Query: 371 AYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE-LTDRKP 429
            +GS ++ + +++IGD+          G+ + G       I +G+ A + + + L D K 
Sbjct: 262 WFGSTMIRKGKMNIGDVITCFHSCILLGSTISGTLQQLVIIQKGSVAVNIVSKFLADDKT 321

Query: 430 SISPTVGHKYQ----PE-RGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSG 484
           + +     ++Q    PE +G I F++V FSYP+RP   + +S++     G +  ++G SG
Sbjct: 322 ATTDI--RRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKTTFLLGKSG 379

Query: 485 RGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITY 544
            GKS+++ LLL++Y   TG I +D ++I  ++   L + I +V+Q   + +GT+++NI  
Sbjct: 380 SGKSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNGTLKENIII 439

Query: 545 GLTYTPTKE---EIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALI 601
           G+     +E   +++ V +     NFI    +  +T+IG  G  LSGGQ+Q++AIARAL+
Sbjct: 440 GIDGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSGGISLSGGQQQKVAIARALM 499

Query: 602 KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
           K P ILILDE+ SALDV   G I        K K+  I++  H L+ I  S +   L   
Sbjct: 500 KDPQILILDESLSALDVLQRGLILRAIRTHRKEKTTIILT--HELNQI-GSNDFCYLIES 556

Query: 662 GSVVEMG 668
           G  +E G
Sbjct: 557 GQCIEHG 563

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  199 bits (507), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 143/465 (30%), Positives = 235/465 (50%), Gaps = 22/465 (4%)

Query: 252 ALICGIVGVGMMCSLSP-QLSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
           +++CGI+      S +    + +LL+  FT    F  + +  + R ++     A  +   
Sbjct: 251 SVVCGILTYQFGTSFAAVTFATMLLYSIFT----FKTTAWRTEFRRSA---NRADNKAAS 303

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           VA + L   + V+ F  E     +Y+ ++ +                   +L+   +   
Sbjct: 304 VALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQIKVAQSLAFLNSGQNLIFTSALTA 363

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           ++  G   V+   LS+GDL             +  L + Y E+ Q       LF+L   K
Sbjct: 364 MMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNK 423

Query: 429 PSI----SPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSG 484
            +I    +P +  K +P    I+F++V+F Y   P  +I ++ NF +  G    IVGPSG
Sbjct: 424 VNIQNSKTPLMLPKDKPCE--IKFENVTFGY--HPDRKILENANFTLPAGWKTAIVGPSG 479

Query: 485 RGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITY 544
            GKSTI  L+ R+Y+P  G I+ID +DI +L+ KSLRR IG+V Q+  L + TI +N+ +
Sbjct: 480 SGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIGVVPQDTPLFNDTIWENVKF 539

Query: 545 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKP 604
           G   T T ++IR    +      I   P   +T++G  G ++SGG+KQR+AIAR L+K  
Sbjct: 540 G-KITATDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLMISGGEKQRLAIARVLLKDT 598

Query: 605 TILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 664
            I+  DEATSALD  +E A+  T  +     S T + IAHRL TI  ++ ++VL  +G V
Sbjct: 599 PIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHRLRTIADADKIVVL-ENGRV 657

Query: 665 VEMGKFKELYANSTSALSQLLNERAAPGPSDQQLQIEKVEEKEDT 709
            E GK  EL +  TS  S+L N +      +++++++K  +++DT
Sbjct: 658 KEEGKHAELLSKPTSLYSELWNIQENLDLLEEEIEMDK--KQQDT 700

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  199 bits (507), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 173/599 (28%), Positives = 279/599 (46%), Gaps = 38/599 (6%)

Query: 138 KVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSF------------FTVALLIGCAAN 185
           KV   VL  L    GS   ++++P F   + + ++              T  +L   AA 
Sbjct: 105 KVKARVLIALSLLVGSKVLNVQVPFFFKQIVDSMNIEWADPTAVLPIAVTAMILSYGAAR 164

Query: 186 FGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM--- 242
           FG  +L   L   + A +    I +   Q  +      +G  +SR       ++R+M   
Sbjct: 165 FGS-VLFGELRNAIFASVAQSAITRVSLQTFQHLMKLDLGWHLSRQTGG---LTRAMDRG 220

Query: 243 TQKVSDGVKALICGI----VGVGMMCS-LSPQL--SILLLFFTPPVLFSASVFGKQIRNT 295
           T+ +S  + A++  I    V +G +C  L+ Q   S   + FT  +L+S   F      T
Sbjct: 221 TKGISYVLSAMVFHIIPITVEIGAVCGILTYQFGASFAAMTFTTMLLYSIFTFKTTAWRT 280

Query: 296 S--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXX 353
              K   +A  +   VA + L   + V+ F  E    ++Y+ ++                
Sbjct: 281 EFRKSANKADNKAATVAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAF 340

Query: 354 XXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ 413
                + +   +   ++  G   V+   LS+GDL             +  L + Y E+ Q
Sbjct: 341 LNAGQNFIFTSALTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQ 400

Query: 414 GAGAASRLFELTDRKPSIS----PTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNF 469
                  LF+L   K  I     P +    +P +  I F++VSF Y   P   I K+ +F
Sbjct: 401 SLIDMESLFQLQRNKVKIQNKEKPLMLSSQRPSK--IVFENVSFGYD--PDRMILKNSSF 456

Query: 470 KIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQ 529
            +  G    IVGPSG GKSTI  L+ R+Y+P  G I++D +D+ +L+ +SLRR IG+V Q
Sbjct: 457 TMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQ 516

Query: 530 EPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGG 589
           +  L + +I +N+ +G   + + EEIR   ++    + + + P   DT++G  G ++SGG
Sbjct: 517 DTPLFNDSIWENVRFG-KISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGG 575

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 649
           +KQR+AIAR L+K   I+  DEATSALD  +E A+  T      + S T V IAHRL TI
Sbjct: 576 EKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTI 635

Query: 650 RRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQLQIEKVEEKED 708
             ++ +IV+   G V E GK  EL A   S  ++L N +      +++LQ E+ +EK D
Sbjct: 636 ADADKIIVI-QQGQVKEEGKHAELLAKPGSLYAELWNVQENLDVLNEELQREETQEKGD 693

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  197 bits (502), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 146/458 (31%), Positives = 223/458 (48%), Gaps = 16/458 (3%)

Query: 254 ICGIVGVGMMCSLSPQ-LSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA 310
           +CGI+      S +    S +LL+  FT    F  + +  + R   K   +A  +   VA
Sbjct: 273 VCGILTYQFGGSFAAMTFSTMLLYSIFT----FKTTAWRTEFR---KSANKADNKAASVA 325

Query: 311 EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVL 370
            + L   + V+ F  E    ++Y+ ++                     +L+   +   ++
Sbjct: 326 VDSLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNLIFTSALTAMM 385

Query: 371 AYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS 430
             G   V+  +LS+GDL             +  L + Y E+ Q       LF+L   K S
Sbjct: 386 YMGCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQRNKVS 445

Query: 431 ISPTVGHKYQPER--GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKS 488
           I  +      P      I FK+VSF Y   P   I K+ +F I  GS   IVGPSG GKS
Sbjct: 446 IQNSKKPLMLPPNVPSEIVFKNVSFGYD--PDRLILKNASFTIPTGSKTAIVGPSGSGKS 503

Query: 489 TIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTY 548
           TI  L+ R+Y+P  G I++D +D+ +L+ +SLRR IG+V Q+  L + +I DN+ +G   
Sbjct: 504 TILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESIWDNVKFG-RI 562

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI 608
             T +EI     +      I + P   DT++G  G ++SGG+KQR+AIAR L+K   I+ 
Sbjct: 563 DATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKDAPIMF 622

Query: 609 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            DEATSALD  +E A+  T  +   + S T V IAHRL TI  ++ +IVL H G V E G
Sbjct: 623 FDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIVLEH-GRVKEEG 681

Query: 669 KFKELYANSTSALSQLLNERAAPGPSDQQLQIEKVEEK 706
           K  EL A   S  ++L N +      +++L+ +  + K
Sbjct: 682 KHAELLATPKSLYAELWNVQENLDDLNKELERDLADHK 719

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  194 bits (494), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 138/454 (30%), Positives = 224/454 (49%), Gaps = 11/454 (2%)

Query: 252 ALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 311
           +++CGI+      S + +++ + +          + +  Q R   +D  +A  +   +A 
Sbjct: 261 SVVCGILTHQFGASFA-EITFMTMLLYSIFTIKTTAWRTQFR---RDANKADNKGASIAL 316

Query: 312 EQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLA 371
           + L   + V+ F  E    S+YN A+ D                   +L+   +   ++ 
Sbjct: 317 DSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFLNSGQNLIFTTALTGMMY 376

Query: 372 YGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSI 431
            G   V+   L++GDL             +  L + Y E+ Q       LF+L   +  I
Sbjct: 377 LGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNEVKI 436

Query: 432 SPTVGHKY-QPERGVIE--FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKS 488
                 K    E G  E  F++V+F Y      +I K+ +F I  G    IVGPSG GKS
Sbjct: 437 HNIENPKIILKEDGPFEITFENVTFGY--HADRKILKNASFTIPAGWKTAIVGPSGSGKS 494

Query: 489 TIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTY 548
           TI  L+ R+Y+P  G I+I+  D+ ++   SLR+ IG+V Q+  L + +I +N+ +G   
Sbjct: 495 TILKLVFRFYDPEEGRILINGIDVREIELDSLRKLIGVVPQDTPLFNDSIWENVKFG-RI 553

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI 608
                EI  V ++    + I K P +Y+T++G  G ++SGG+KQR+AIAR L+K  +++ 
Sbjct: 554 DALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGLMISGGEKQRLAIARVLLKDASVMF 613

Query: 609 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            DEATSALD  +E A+  T     K+ S T + IAHRL TI  ++ +IVL  DG+V E G
Sbjct: 614 FDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAHRLRTIADADKIIVL-EDGTVREEG 672

Query: 669 KFKELYANSTSALSQLLNERAAPGPSDQQLQIEK 702
              EL A STS   +L N +      +++++IEK
Sbjct: 673 THNELLAKSTSLYKELWNVQENLDLIEREIEIEK 706

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  193 bits (491), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 140/461 (30%), Positives = 224/461 (48%), Gaps = 16/461 (3%)

Query: 252 ALICGIVGVGMMCSLSPQLSILLL---FFTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
           +++CGI+      S +    + +L   FFT    F  + +  + R ++     A  +   
Sbjct: 264 SVVCGILTYQFGSSFAAMTFVTMLLYSFFT----FKTTAWRTEFRRSA---NRADNKAAS 316

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           VA + L   + V+ F  E    ++Y+ ++                     + +   +   
Sbjct: 317 VALDSLINFEAVKYFNNEEYLANKYHQSLSKYRDSQIKVAQSLAFLNAGQNFIFTSALTA 376

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           ++  G+  V++  L++GDL             +  L + Y E+ Q       LF+L    
Sbjct: 377 MMYMGASGVMEGALTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNP 436

Query: 429 PSISPTVGHKYQPER--GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRG 486
             I  T      PE     I+F++V+F Y  +P   I K+  F IAPG    IVGPSG G
Sbjct: 437 ILIKNTERPLMLPEHLPCEIKFENVTFGY--QPDRNILKNATFTIAPGKKTAIVGPSGSG 494

Query: 487 KSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGL 546
           KSTI  L+ R+Y+P  G I++D +DI +L+   LRR +G+V Q+  L + TI +N+ +G 
Sbjct: 495 KSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQDTPLFNDTIWENVKFG- 553

Query: 547 TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTI 606
               T  EI +  ++    + I K P   +T++G  G ++SGG+KQR+AIAR L+K   I
Sbjct: 554 RINATDNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLAIARVLLKDTPI 613

Query: 607 LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 666
           +  DEATSALD  +E ++  T  +     + T V IAHRL TI  ++ +IVL  +G+V E
Sbjct: 614 MFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHRLRTIADADKIIVL-ENGAVRE 672

Query: 667 MGKFKELYANSTSALSQLLNERAAPGPSDQQLQIEKVEEKE 707
            G    L AN  S  S+L N +      + +L+ E   EKE
Sbjct: 673 EGTHNALLANPNSLYSELWNIQENLDMLEDELEDELKLEKE 713

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  196 bits (499), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 152/526 (28%), Positives = 260/526 (49%), Gaps = 44/526 (8%)

Query: 178  LLIGCAA-----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISR 230
            +++G AA     NF +  LL   SE  +  LR  ++ K   ++  +F  +++K  ++ + 
Sbjct: 766  IVLGVAAADGFFNFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITAL 825

Query: 231  LGSDAYVVSRSMTQKVSDGVKAL--ICGIVGVGMMCSL--SPQLSILLLFFTPPVLFSAS 286
            + +D     R +   VS+ + A+     +  +G++ +L    +LS++ +   P ++  ++
Sbjct: 826  VLNDL----RDLRSLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSA 881

Query: 287  VFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 346
            ++G  ++    D + +  QL     + ++ IKT++   AE +    Y+   + + Q+   
Sbjct: 882  IYGGILQKYETDYKTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYK 941

Query: 347  XXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYTGNAVFG 403
                        +++       +  YG  LVL  + +   + +    +L+T  +  ++ G
Sbjct: 942  RAIATGFGISVTNMIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVG 1001

Query: 404  LSTFYSEIMQGAGAASRLFELTD-------------RKPSISPTVGHKYQPERGV--IEF 448
                  +I +G  AAS ++ + D             R   IS   G +Y  +R +  I  
Sbjct: 1002 Q---IPDISRGQRAASWIYRILDEEEDTLEIENNDARALDIS---GAEYYGDRNIPIISI 1055

Query: 449  KDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
            +++SF+YP+ P+V IFK ++  +    ++ IVG SG GKST+ALLL R YN    +I+ID
Sbjct: 1056 RNLSFAYPSAPNVPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIID 1115

Query: 509  NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
              D+   N  SLR+QI +V+Q+P    G+IRDN+TYG      + EI  V K    ++F+
Sbjct: 1116 GTDVNDWNLTSLRKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFV 1175

Query: 569  TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
               P   DT +  +  LLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN   
Sbjct: 1176 ASLPQGLDTRVDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIV 1233

Query: 629  GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
             +      +  + I H    +R   ++ VL H G VVE G F  LY
Sbjct: 1234 RK--GPPGLLTLVITHSEQMMRCCNSIAVLKH-GKVVEEGNFDNLY 1276

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 122/460 (26%), Positives = 206/460 (44%), Gaps = 51/460 (11%)

Query: 254 ICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
           IC ++G     S S  L++++L  +P +   A +F + I   ++     T    ++    
Sbjct: 163 ICALIGTSFYYSWS--LTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSNAAQLFTWS 220

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
           ++  + V+ +  +  E  ++   I                       L    F+    +G
Sbjct: 221 MNAAQLVRLYCTQPLERQKFQEIILSCNTFFIKSCLYVAANAGILRFLTLTMFVQGFWFG 280

Query: 374 SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--------- 424
           S ++ + +L+I D+                ++ F+S IM G+   S L ++         
Sbjct: 281 STMIRKGKLNINDV----------------ITCFHSCIMLGSTLNSTLHQIVVLQKGEVA 324

Query: 425 ---------TDRKPSISPTVGHKYQP---ERGVIEFKDVSFSYPTRPSVQIFKSLNFKIA 472
                    +  K + S T  H   P       + F++VSF+YP+RPS  + +++N K  
Sbjct: 325 LQKIMALLESGSKQNASNTREHLQPPLNFATSDLVFENVSFAYPSRPSETVLQNVNLKFP 384

Query: 473 PGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPV 532
            G    IVG SG GKSTI+ LLL +Y+   G+I+I+ ++   +  K L   I +V+Q   
Sbjct: 385 SGQFTFIVGKSGSGKSTISNLLLNFYDNYDGSILINGRNTQSIQQKLLVSNITVVEQRCT 444

Query: 533 LMSGTIRDNITYGLTYTPTKEE---------IRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
           L + T++ NI  G T +    +         I+   +       I   P+  +T+IG  G
Sbjct: 445 LFNDTLKKNILLGSTGSIGNADTNTIGNNNLIKDACRMALLDRLILDLPDGLETLIGSGG 504

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 643
             LSGGQ+QR+AIARA I+   IL LDEA SALD+     +        K K+  I++  
Sbjct: 505 VSLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT-- 562

Query: 644 HRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQ 683
           H LS I   +++ V+  +G VVE G   EL A+S +  S+
Sbjct: 563 HELSQIESDDHLYVM-QEGRVVESGIQSELLADSATTFSK 601

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  191 bits (484), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 138/508 (27%), Positives = 249/508 (49%), Gaps = 24/508 (4%)

Query: 183  AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSR 240
             +NF +  +L   SE  +  LR   +++   +  E+F  + +K  ++ + L +D   +  
Sbjct: 763  VSNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRS 822

Query: 241  SMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
             ++Q +S     L   +VG+    +   +LS++ +   P ++  + ++G  ++N     +
Sbjct: 823  LVSQFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYK 882

Query: 301  EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
                 L  +  E ++G+KT++    + +    Y+    ++ Q+               + 
Sbjct: 883  TKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTA 942

Query: 361  LGDLSFLTVLAYGSYLVLQSQLSIGDLT---AFMLYTEYTGNAVFGLSTFYSEIMQGAGA 417
            +       +  YG  LV+  + S   +      +L+T  T N+   L +   +I +G  A
Sbjct: 943  IATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNS---LISQIPDISRGQRA 999

Query: 418  ASRLFELTD-----RKPSISP------TVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKS 466
            AS ++ + +     ++ +I+         G K    + ++   ++ F+YPT   V I+ +
Sbjct: 1000 ASWIYRIIEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYDN 1059

Query: 467  LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGI 526
            L+  +  G +V IVG SG GKST+  LL + Y      I ID  D+ + + ++LRRQI +
Sbjct: 1060 LSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQISV 1119

Query: 527  VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
            V+Q+PVL  GT+R+N+ YGL ++P + +I  + K    ++FI   P   +T +    +L+
Sbjct: 1120 VEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--SLI 1177

Query: 587  SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRL 646
            SGGQ QR+ IARAL++KP ILILDE TSALD  S   IN    +     S+  +SI H  
Sbjct: 1178 SGGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITHNE 1235

Query: 647  STIRRSENVIVLGHDGSVVEMGKFKELY 674
              +R    V VL  DG + E G F +L+
Sbjct: 1236 QMMRSCNTVAVL-KDGKICETGPFNKLF 1262

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 154/628 (24%), Positives = 268/628 (42%), Gaps = 76/628 (12%)

Query: 96  QSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDF 155
           + K   +K+ I +++  KRDW            +  +      + G V D LK     DF
Sbjct: 3   KKKVSVWKENIYMYVQFKRDWLLIATMVLTTIANGLVPAVTSILTGKVFDLLK-----DF 57

Query: 156 FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRI-----LSERVVARLRAHVIKK 210
            D  IP     LY  L   +++L+   A  F   I   I       E     +R  ++  
Sbjct: 58  ADPNIPK-DHNLYHQLVLRSMSLMALAACAFP-LIWTSISTWMSFGEGQGFTVRYRMLNS 115

Query: 211 TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL---- 266
            L +  E++D  +       L  D   ++R + +  +   +A    +  +  M SL    
Sbjct: 116 YLDKSMEWYDKKE------NLSGDFTQLNRCVEELRASSAEASAITLQNISSMLSLIGVS 169

Query: 267 ---SPQLSILLLFFTPPVLFSASVFGKQIR------NTSKDLQE-------ATGQLTRVA 310
              S  L++++L  TP ++  A +F + I+      NT   L          + Q+ +++
Sbjct: 170 FYYSWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMNSAQMIKLS 229

Query: 311 EEQLSGIKTVQSFVAEGNE----LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSF 366
             QL  I++ +    + N+    LS Y  A                        L    F
Sbjct: 230 CTQLKEIESFEELTLKCNDYFIKLSLYVAA-----------------NISTLRFLSLAMF 272

Query: 367 LTVLAYGSYLVLQSQLSIGD-LTAF--MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423
           +    +G+  + +  L+I D +T F   L    T N   G   F    +Q    A R  +
Sbjct: 273 VQGFWFGNTEIRKGNLNISDVITCFSSCLMLGSTLNTTLGYLIF----LQKGQVALRKIQ 328

Query: 424 --LTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVG 481
             L D K  I  +   +    +  I F+ VSFSYP+RP+  +   ++     G +  IVG
Sbjct: 329 SFLNDNKVEIDESALKQIDISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVG 388

Query: 482 PSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDN 541
            SG GKST++ LLL+ Y+   G I I +  I +++ + L + I +V+Q   L + T+ +N
Sbjct: 389 RSGSGKSTLSNLLLKLYDEYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNN 448

Query: 542 ITYG-----LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAI 596
           I  G      +    +++++   K     + I    N  DT++G  G  LSGGQ+QR+A+
Sbjct: 449 ILLGSQDEDKSSPVVQKKLKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVAL 508

Query: 597 ARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 656
           ARA ++   +LILDEA SALD+     +     +  + ++  I++  H LS I   + + 
Sbjct: 509 ARAYMRDTEVLILDEAVSALDIVHREQLMSNITKWRQGRTTIILT--HELSQISIQDYLY 566

Query: 657 VLGHDGSVVEMGKFKELYANSTSALSQL 684
           V+  +G ++E G   +L  +  SA  ++
Sbjct: 567 VV-EEGRIIESGFQGQLMYDPDSAFCRM 593

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  187 bits (474), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 183/353 (51%), Gaps = 8/353 (2%)

Query: 365 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423
           S LT + Y G   +L   L++GDL             +  L + Y E+ Q       LF+
Sbjct: 342 SALTAMMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFK 401

Query: 424 LTDRKPSISPTVGHKYQPERGV---IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 480
           L   +  I      K  P  G    I F++V+F Y   P   I K+ +F IA G  + IV
Sbjct: 402 LRRNEVVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDRTILKNASFVIAAGKKIAIV 459

Query: 481 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRD 540
           GPSG GKSTI  L+ R+Y+P  G I+I+  D+ +++  SLR+ IG+V Q+  L + TI +
Sbjct: 460 GPSGSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVPQDTPLFNDTIWE 519

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600
           N+ +G     T EE+ +  ++      I+K     DT++G  G ++SGG+KQR+AIAR L
Sbjct: 520 NVRFG-RIDATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISGGEKQRLAIARVL 578

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660
           +K   I+  DEATSALD  +E  +  T     K+ S T + IAHRL TI  ++ +IVL  
Sbjct: 579 LKNADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRTIADADKIIVL-E 637

Query: 661 DGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQLQIEKVEEKEDTNEGE 713
           DGSV E G   EL A   S    L + +      +++L ++  E     + GE
Sbjct: 638 DGSVKEEGTHTELLARDHSLYKDLWDIQENLEVIEEELGLDSSEADSQLSPGE 690

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  190 bits (482), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 148/523 (28%), Positives = 260/523 (49%), Gaps = 24/523 (4%)

Query: 179  LIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHK--VGDLISRLGSDAY 236
            +I   +NF +  LL I SE  +  LR   +K+ L +  ++F + K    ++ + + +D  
Sbjct: 780  IIDGISNFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDL- 838

Query: 237  VVSRSMTQKVSDGVKALICGIVG--VGMMCSL--SPQLSILLLFFTPPVLFSASVFGKQI 292
               R +   VS+ + A+   IV    G++ +L    +L+++ +   P ++  ++++G  +
Sbjct: 839  ---RDLRSLVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVL 895

Query: 293  RNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXX 352
            + +  D + +   L  +  + +S IKT++S   EG+    Y VA   +  V         
Sbjct: 896  QKSETDYKSSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTG 955

Query: 353  XXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIM 412
                  + +       +  YG  L++  + ++  +        +T      L     ++ 
Sbjct: 956  LGISITNTITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMS 1015

Query: 413  QGAGAASRLFEL----TDRKPSISPTV----GHKYQPERGVIEFKDVSFSYPTRPSVQIF 464
            +G  AAS ++ +     D K    P       +    +  +++ K+++F+Y + PS+++ 
Sbjct: 1016 RGQRAASWVYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYESTPSIKVL 1075

Query: 465  KSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQI 524
              L  K+ PG  + I G SG GK+T+  LL+++Y+     I  + +DI     +SLR  I
Sbjct: 1076 DGLTLKLFPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAI 1135

Query: 525  GIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGT 584
             IV+Q+P ++SG+IRDN+        +  E+  V K     +FI   P+  DT+I    T
Sbjct: 1136 VIVEQKPSVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT--T 1193

Query: 585  LLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
            LLSGGQ QRI IARAL++KP ILILDE TSALD  S   IN    + +    +TI+SI H
Sbjct: 1194 LLSGGQAQRICIARALLRKPKILILDECTSALDAMSADIINNLVSKEL--NGVTIISITH 1251

Query: 645  RLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
              S +   +NV VL  +G +VE+G +  L A S+S L +LL++
Sbjct: 1252 SESMMTSCQNVAVL-KNGKIVEVGTYDSL-ATSSSHLGKLLSK 1292

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 107/292 (36%), Positives = 160/292 (54%), Gaps = 28/292 (9%)

Query: 446 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           I F+++SF+YP+RP+  I   +N      ++  IVG SG GKST++ LLL++Y    G I
Sbjct: 358 ISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSGSGKSTLSNLLLKFYETYKGDI 417

Query: 506 MIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLT-----YTPTK----EEIR 556
           +IDN +I  LN K+L   I IV+Q+  L + TIR+NI +G++     Y   +    E ++
Sbjct: 418 LIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILFGVSNFTNQYASNRPNLNERLK 477

Query: 557 SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
           +        +F+   PN  DTVIG  G  LSGGQ+QR+A+ARA ++ P ILILDEA SAL
Sbjct: 478 NACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRVALARAYMRDPPILILDEAVSAL 537

Query: 617 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
           DV     +     +L +S   TI+ + H L+ I   + + V+ H G ++E GK KEL  +
Sbjct: 538 DVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDFLYVIKH-GRIIEHGKRKELITD 594

Query: 677 STSALSQL--------LNE-------RAAPGPSDQQLQIEKVEEKEDTNEGE 713
             +   +L        LNE            P D++  IE V+ + DT + E
Sbjct: 595 PNTEFHKLVAIQNNNNLNEDFDLETDTFNGSPRDEKNYIE-VDYEADTPKAE 645

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  188 bits (477), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 145/522 (27%), Positives = 251/522 (48%), Gaps = 36/522 (6%)

Query: 178  LLIGCAA-----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISR 230
            +++G AA     NF +  LL   SE  +  LR  +++K   ++  +F  +N+K  ++ + 
Sbjct: 766  VVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISAL 825

Query: 231  LGSDAYVVSRSMTQKVSDGVKALICGIV--GVGMMCSL--SPQLSILLLFFTPPVLFSAS 286
            + +D     R +   VS+ + A+   I    +G++ +L    +LS++ +   P ++  + 
Sbjct: 826  VMNDL----RDLRSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSV 881

Query: 287  VFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 346
            ++G  ++    D + +  QL     + ++ IKT++   AE +    Y+     +  +   
Sbjct: 882  IYGSSLQTYETDYKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASK 941

Query: 347  XXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLST 406
                        +++       +  YG  LV+  + +   + A      +T  +   L  
Sbjct: 942  RAIATGFGVSMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVG 1001

Query: 407  FYSEIMQGAGAASRLF----------ELTDRKPSISPTVGHKY--QPERGVIEFKDVSFS 454
               +I +G  AAS ++          E+ D    +    G  Y     + ++  ++++F+
Sbjct: 1002 QIPDISRGQRAASWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNLTFA 1061

Query: 455  YPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITK 514
            YP+ P++ I+K ++  +  G +V IVG SG GKST+ LLL   Y    G I ID  D+  
Sbjct: 1062 YPSAPNISIYKRMDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVND 1121

Query: 515  LNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT 574
             N  SLRR+I +V+Q+P L  G+IRDN+TYG        E+    K    ++F+   P +
Sbjct: 1122 WNLTSLRREISVVEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFVASLPQS 1181

Query: 575  YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS 634
             DT I  +  LLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN     ++K 
Sbjct: 1182 LDTRIDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DIVKK 1235

Query: 635  K--SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
               ++  + I H    +R   +V+V   DG +VE G F  LY
Sbjct: 1236 GPPALLTMVITHNEEMMRCCSSVVVF-KDGKIVEEGSFDTLY 1276

 Score =  160 bits (406), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 136/509 (26%), Positives = 238/509 (46%), Gaps = 27/509 (5%)

Query: 195 LSERVVARLRAHVIKKTLHQD-AEFFDNHK--VGDL--ISRLGSDAYVVSRSMTQKVSDG 249
           + ER   R+R+ +++  L +   E++D ++  +GD   I+R   +    S   +      
Sbjct: 100 IGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDFTQINRCVEELRSSSAEASAITFQN 159

Query: 250 VKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRV 309
           + A IC ++G     S S  L++++L  +P +   A  F + I   +K     TG+  ++
Sbjct: 160 LVA-ICALIGTSFFYSWS--LTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQL 216

Query: 310 AEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTV 369
               ++  + V+ +  +  E  ++   + +                     L    F+  
Sbjct: 217 LTWSMNAAQLVRLYCTQPLERKKFEEIVSNCNTFFIKSCFYLAANAGVLRFLTLTMFVQG 276

Query: 370 LAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP 429
             +GS ++ + +L+I D+          G  +         + +G  A  ++  L +  P
Sbjct: 277 FWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLLENGP 336

Query: 430 --SISPTVGHKYQP----ERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPS 483
             + S T+   YQP      G + F++VSF+YP+RP+  I ++   K   G    IVG S
Sbjct: 337 KRNTSNTI-ELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFTFIVGKS 395

Query: 484 GRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNIT 543
           G GKSTI+ LLL++Y+   G+I I+ ++I  +  KSL   I +V+Q   L + T+++NI 
Sbjct: 396 GSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNTLKNNIL 455

Query: 544 YGLTYTPTKEE---------IRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRI 594
            G T +    +         I+   +       I   P+  +T+IG  G  LSGGQ+QR+
Sbjct: 456 LGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGITLSGGQQQRV 515

Query: 595 AIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 654
           AIARA I+   IL LDEA SALD+     +        K K+  I++  H+LS I  +++
Sbjct: 516 AIARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGKTTIILT--HQLSQI-EADD 572

Query: 655 VIVLGHDGSVVEMGKFKELYANSTSALSQ 683
            + L  DG V+E G   EL  +ST+  S+
Sbjct: 573 YLYLMQDGKVIESGIQSELLVDSTTTFSK 601

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  184 bits (467), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 136/438 (31%), Positives = 213/438 (48%), Gaps = 16/438 (3%)

Query: 252 ALICGIVGVGMMCSLSP-QLSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
           +++CGI+      S +    S +LL+  FT       + +    R   +D   A  +   
Sbjct: 245 SVVCGILTYQFGASFAAITFSTMLLYSIFT----IKTTAWRTHFR---RDANRADNKAAS 297

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           VA + L   + V+ F  E    S+YN ++ +                   +L+   +   
Sbjct: 298 VALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTA 357

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           ++  G   V+   L++GDL             +  L + Y ++ Q       LF+L   +
Sbjct: 358 MMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRKNE 417

Query: 429 PSISPTVGHKYQPERGVIE--FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRG 486
             I         PE    E  F++V+F Y   P  +I K+ +F I  G    IVG SG G
Sbjct: 418 VKIKSVERPLMLPEHVPYEITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSGSG 475

Query: 487 KSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGL 546
           KSTI  L+ R+Y+P +G I+I+ +DI + +  +LRR IG+V Q+  L + TI +N+ +G 
Sbjct: 476 KSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVPQDTPLFNDTIWENVKFG- 534

Query: 547 TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTI 606
               T EE+++  ++      I K P  ++T++G  G ++SGG+KQR+AIAR L+K   I
Sbjct: 535 RIDATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISGGEKQRLAIARVLLKNARI 594

Query: 607 LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 666
           +  DEATSALD  +E A+  T      S S T V IAHRL TI  ++ +IVL  +G+V E
Sbjct: 595 MFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVL-DNGTVKE 653

Query: 667 MGKFKELYANSTSALSQL 684
            GK  EL A   S   +L
Sbjct: 654 DGKHIELLATPGSLYREL 671

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  182 bits (463), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 156/525 (29%), Positives = 247/525 (47%), Gaps = 24/525 (4%)

Query: 176 VALLIGC--AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           + L I C   A FG  +L   L   V AR+  + I+    Q  +      +G  +SR   
Sbjct: 154 IGLTILCYGVARFGS-VLFGELRNAVFARVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTG 212

Query: 234 DAYVVSRSM---TQKVSDGVKALICGIV----GVGMMCS-LSPQL--SILLLFFTPPVLF 283
               ++R+M   T+ +S  + A++  I+     + ++C  L+ Q   S   + F+  +L+
Sbjct: 213 G---LTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLY 269

Query: 284 SASVFGKQIRNTS--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
           S          T   +D  +A  +   VA + L   + V+ F  E     +YN ++    
Sbjct: 270 SMFTIKTTAWRTKFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYR 329

Query: 342 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAV 401
                            +L+   +   ++  G   V+   L++GDL             +
Sbjct: 330 DSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPL 389

Query: 402 FGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGV--IEFKDVSFSYPTRP 459
             L + Y ++ Q       LF+L   +  I         PE     I F++V+F Y   P
Sbjct: 390 NFLGSVYRDLKQSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPYDITFENVTFGY--HP 447

Query: 460 SVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKS 519
             +I K+ +F I  G    IVG SG GKSTI  L+ R+Y+P +G I+I+ +DI + +  +
Sbjct: 448 DRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYDINA 507

Query: 520 LRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVI 579
           LR+ IG+V Q+  L + TI +N+ +G     T EE+ +V ++      I K P  +DT++
Sbjct: 508 LRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVMTVVEKAQLAPLIKKLPQGFDTIV 566

Query: 580 GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTI 639
           G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S T 
Sbjct: 567 GERGLMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGSRTS 626

Query: 640 VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
           V IAHRL TI  ++ +IVL  +G V E GK  EL A   S   +L
Sbjct: 627 VYIAHRLRTIADADKIIVL-DNGRVREEGKHLELLATPNSLYREL 670

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  183 bits (464), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 135/436 (30%), Positives = 211/436 (48%), Gaps = 12/436 (2%)

Query: 252 ALICGIVGVGMMCSLSP-QLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA 310
           +++CGI+      S +    S +LL+     +F+      +  N  +D   A  +   VA
Sbjct: 247 SVVCGILTYQFGASFAAITFSTMLLY----SMFTIKTTAWRT-NFRRDANRADNKAASVA 301

Query: 311 EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVL 370
            + L   + V+ F  E     +YN ++ +                   +L+   +   ++
Sbjct: 302 LDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAFLNSGQNLIFTSALTAMM 361

Query: 371 AYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS 430
             G   V+   L++GDL             +  L + Y E+ Q       LF+L   +  
Sbjct: 362 YMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEALFKLRKNEIK 421

Query: 431 ISPTVGHKYQPERGV--IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKS 488
           I         PE     I F++V+F Y   P  +I K+ +F I  GS   IVG SG GKS
Sbjct: 422 IKNAERPLMLPEHVPYDITFQNVTFGY--HPDRKILKNASFTIPAGSKTAIVGSSGSGKS 479

Query: 489 TIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTY 548
           TI  L+ R+Y+P +G I+I+ +DI + +  +LR+ IG+V Q+  L + TI +N+ +G   
Sbjct: 480 TILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFG-RI 538

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI 608
             T EE+ +V ++      I K P  ++T++G  G ++SGG+KQR+AIAR L+K   I+ 
Sbjct: 539 DATDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGLMISGGEKQRLAIARVLLKNARIMF 598

Query: 609 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            DEATSALD  +E A+  T      S S T V IAHRL TI  ++ +IV   +G V E G
Sbjct: 599 FDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVF-DNGKVREEG 657

Query: 669 KFKELYANSTSALSQL 684
           K  EL A   S   +L
Sbjct: 658 KHLELLATPGSLYREL 673

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  182 bits (461), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 121/328 (36%), Positives = 176/328 (53%), Gaps = 11/328 (3%)

Query: 365 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423
           S LTV+ Y G   ++   L++GDL             +  L + Y E+ Q       LF+
Sbjct: 372 SALTVMMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQ 431

Query: 424 LTDRKPSISPTVGHKYQ-PERG----VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVC 478
           L  + P I   V       E+G     I F++V+F Y  +   +I K+ +F+I  G    
Sbjct: 432 L-KKNPIIIKNVEKPLMLAEKGHMPMTIRFENVTFGYDKQR--KILKNASFQIESGQKTA 488

Query: 479 IVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTI 538
           IVGPSG GKSTI  LL R+Y+P  G I+++  D  + +  SLR+ IG+V Q+  L + TI
Sbjct: 489 IVGPSGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVIGVVPQDTPLFNDTI 548

Query: 539 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIAR 598
            +N+ +G     + +EI  V  +      + K P   +T++G  G ++SGG+KQR+AIAR
Sbjct: 549 WENVRFG-RIGASDDEITQVINKAQLGPLLVKLPQGRETIVGERGLMISGGEKQRLAIAR 607

Query: 599 ALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
            L+K   I+  DEATSALD  +E A+  T  +  K  S T V IAHRL TI  ++ +IVL
Sbjct: 608 VLLKDADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSVYIAHRLRTIADADKIIVL 667

Query: 659 GHDGSVVEMGKFKELYANSTSALSQLLN 686
             +G+V E GK  EL A S S   +L N
Sbjct: 668 -QEGTVREEGKHSELLARSGSLYKELWN 694

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  181 bits (459), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 136/438 (31%), Positives = 212/438 (48%), Gaps = 16/438 (3%)

Query: 252 ALICGIVGVGMMCSLSP-QLSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
           +++CGI+      S +    S +LL+  FT       + +    R   +D  +A  +   
Sbjct: 244 SVVCGILTYQFGASFAAITFSTMLLYSIFT----IKTTAWRTHFR---RDANKADNKAAS 296

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           VA + L   + V+ F  E     +YN ++ +                   +L+   +   
Sbjct: 297 VALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTA 356

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           ++  G   V+   L++GDL             +  L + Y ++ Q       LF+L   +
Sbjct: 357 MMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRKNE 416

Query: 429 PSISPTVGHKYQPERGV--IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRG 486
             I         PE     I F++V+F Y   P  +I K+ +F I  G    IVG SG G
Sbjct: 417 VKIKNAERPLMLPENVPYDITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSGSG 474

Query: 487 KSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGL 546
           KSTI  L+ R+Y+P +G I+I+ +DI + +  +LR+ IG+V Q+  L + TI +N+ +G 
Sbjct: 475 KSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFG- 533

Query: 547 TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTI 606
               T EE+ +V ++      I K P  +DT++G  G ++SGG+KQR+AIAR L+K   I
Sbjct: 534 RIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARI 593

Query: 607 LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 666
           +  DEATSALD  +E A+  T      S S T V IAHRL TI  ++ +IVL  +G V E
Sbjct: 594 MFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADKIIVL-DNGRVRE 652

Query: 667 MGKFKELYANSTSALSQL 684
            GK  EL A   S   +L
Sbjct: 653 EGKHLELLAMPGSLYREL 670

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  181 bits (459), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 150/526 (28%), Positives = 244/526 (46%), Gaps = 37/526 (7%)

Query: 183 AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM 242
           AA FG  +L   L   + A++  + IK    Q    FD+    DL   L      ++R+M
Sbjct: 180 AARFGA-VLFGELRNAIFAKVAQNTIKTISLQT---FDHLMKLDLGWHLSRQTGGLTRAM 235

Query: 243 ---TQKVSDGVKALICGIV----GVGMMCS-LSPQLSILLLFFTPPVLFSASVFGKQIRN 294
              T+ +S  + A+I  I+     + ++C  L+ Q        T   +    +F   +R 
Sbjct: 236 DRGTKGISYVLTAMIFHIIPITFEISVVCGILTYQFGASFAGITFTTMLLYGIF--TLRT 293

Query: 295 TS------KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXX 348
           T+      +   +A  +   +A + L   + V+ F  E    S+YN +++   +      
Sbjct: 294 TAWRTKFRRQANKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVA 353

Query: 349 XXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFY 408
                     +L+   +   ++  G   +L   LS+GDL             +  L + Y
Sbjct: 354 QSLAFLNSGQNLIFTSALTAMMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVY 413

Query: 409 SEIMQGAGAASRLFEL--------TDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPS 460
            ++ Q       LF+L         ++ P+I       +      IEFK+V+F Y   P+
Sbjct: 414 RDLKQSLIDMESLFKLRKNEVKILNNKNPAILSLKDGPFN-----IEFKNVTFGYD--PN 466

Query: 461 VQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSL 520
            +I ++ +F I  G    +VGPSG GKSTI  L+ R+Y+P  G ++++  D+   +  SL
Sbjct: 467 RKILRNASFIIPAGVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSL 526

Query: 521 RRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 580
           RR IG+V Q+  L + TI +N+ +G   T T E+I +  ++      I K P  Y+T++G
Sbjct: 527 RRAIGVVPQDTPLFNDTIWENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVG 585

Query: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIV 640
             G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E  +  T        S T V
Sbjct: 586 ERGLMISGGEKQRLAIARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSV 645

Query: 641 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
            IAHRL T+  S+ +IVL  +GS+ E G    L +   S    L N
Sbjct: 646 YIAHRLRTVADSDKIIVL-KEGSIFEEGTHLGLLSKPNSLYKDLWN 690

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  182 bits (463), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 151/501 (30%), Positives = 236/501 (47%), Gaps = 31/501 (6%)

Query: 192  LRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSMTQKVSDG 249
            L  +SE  +  LR   ++   +++ E+F  D +K  +L + + +D   +   +++ +S  
Sbjct: 769  LGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFISAM 828

Query: 250  VKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRV 309
               ++  + G+    +   +LS++ +   P ++  ++++G  ++      +     L   
Sbjct: 829  STFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENC 888

Query: 310  AEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTV 369
              E + GIKT++    E + + RY+V    +  +G              + L       +
Sbjct: 889  VYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAIL 948

Query: 370  LAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ------GAGAASRLFE 423
              YG  LV      IG+ T   ++  +T   +F + T  S I Q      G  AASR+F 
Sbjct: 949  FYYGLKLVF-----IGEYTTMKMFKTFTL-LLFTIMTCTSLINQIPDVTRGQRAASRIFR 1002

Query: 424  L---TDRKPSISPTVGH-----KYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGS 475
            +   +DR    S   G      K    + +I   ++ F YP+  S  +F  LN +IA   
Sbjct: 1003 ILDESDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQ 1062

Query: 476  SVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMS 535
            +V +V  SG GKST+  LL R Y     +I ID  DI +    SLR  I IV+Q+P L  
Sbjct: 1063 TVAVVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFE 1122

Query: 536  GTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIA 595
            G+IR N+ YG        +I  V KQ    +F+T  PN  DT +    +LLSGGQ QRI 
Sbjct: 1123 GSIRKNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQRIC 1180

Query: 596  IARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAHRLSTIRRSE 653
            IARAL++K  ILILDE TSALD ES     +    L+KS    +  ++I H    +R   
Sbjct: 1181 IARALLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACG 1236

Query: 654  NVIVLGHDGSVVEMGKFKELY 674
            NVIVL  DG   + G F ELY
Sbjct: 1237 NVIVL-QDGETAQQGTFDELY 1256

 Score =  126 bits (317), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 129/516 (25%), Positives = 243/516 (47%), Gaps = 56/516 (10%)

Query: 202 RLRAHVIKKTLHQDAEFFDNHK--VGDLIS--------RLGSDAYVVSRSMTQKVSDGVK 251
           R+R  ++   L +  E+FD +   +GD +         R GS     + ++T +    + 
Sbjct: 103 RIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGSAE---ASAITFQNFVAII 159

Query: 252 ALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 311
           AL+C           S  L++++L  +P ++  A+ F + I N +K   + TG   +   
Sbjct: 160 ALVCTSF------YYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQSLT 213

Query: 312 EQLSGIKTVQSFVAEGNELSRY-NVAIR--DIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
             ++  + V+ +  +  E+ ++  + IR  D F                 SL     F+ 
Sbjct: 214 WSMNAAQLVKLYCTQDFEIKKFKEIVIRCNDYFINAWFYVSANTSILRFLSLA---MFVQ 270

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFG--LSTFYSEI--MQGAGAA-SRLFE 423
              +GS ++ ++++S+  +      T ++   + G  L+T   +I  +Q A    +R+ +
Sbjct: 271 GFWFGSTMIKKNKMSVDQVI-----TCFSSCLMLGSILNTTLPQIVLLQKAHVGLNRVQD 325

Query: 424 LTDRKPSISPTVGHKYQPERG----VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI 479
             + K  ++     +           I F  +SF YP+RP   + K+++    P  +  I
Sbjct: 326 FLEDKSEMATDRDRQTSINLDNVPISISFDAISFCYPSRPDDMVLKNISMNFDPNKTTFI 385

Query: 480 VGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIR 539
           VG SG GKST++ LLL++YN   G I ++  ++  ++   + + + +V+Q+  L + T+R
Sbjct: 386 VGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTLFNDTLR 445

Query: 540 DNITYGLTYTPTKEEIRS-VAKQC---FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIA 595
           +N+  GL++    E++ S + + C      N I K P+  DT +G  G  LSGGQ+QR+A
Sbjct: 446 NNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQRVA 505

Query: 596 IARALIKKPTILILDEATSALDVESEGAINYTFGQLMK-----SKSMTIVSIAHRLSTIR 650
           +ARA ++   ++ILDEA SALD  +         QLM+     ++S T + + H L+ I 
Sbjct: 506 LARAYLRDTPVVILDEAISALDARNR-------RQLMENIRIWTRSKTAIILTHELNQIL 558

Query: 651 RSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
            S+  + L  +G + E G   EL  N  S   +  +
Sbjct: 559 PSD-FLYLMENGQIKEEGYQNELIENVESTFCKFFH 593

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  182 bits (462), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 142/491 (28%), Positives = 239/491 (48%), Gaps = 22/491 (4%)

Query: 196  SERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 253
            SE  +  LR   ++K  +   E+   DN+K  +L + L +D   +  S +  +S     +
Sbjct: 776  SEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELSALLMNDLRDLRTSTSNFISFVSSFV 835

Query: 254  ICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
            I   VG+        +LS++ +   P ++  + ++G  ++    + +    +L  V  E 
Sbjct: 836  IVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIYGILLKKYETEYKNTIAKLENVQYEV 895

Query: 314  LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
            ++G+KT++    E +  +++NV  +    +G              + L  +S   +L Y 
Sbjct: 896  VTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQRRAIVTGFGVAVSNGL-TMSIQGILYYY 954

Query: 374  SY-LVLQSQLSIGDLT---AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD--R 427
            +  LV+  + +   +      +L+T  T N    L     +I +G  AAS+++ + +   
Sbjct: 955  AIKLVIHGEYTTKKMFETFTLLLFTIMTCN---NLVNQIPDIRRGQRAASKIYRILEGID 1011

Query: 428  KPSISPTVGHKY-----QPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGP 482
            +     T GH+       P   +I F D+SF+YPT P+V+I K L+ +I  G  + IVG 
Sbjct: 1012 ESECFETEGHRIVPIVENPTGPIIRFNDLSFAYPTAPTVKILKHLSMEIYSGDRIAIVGE 1071

Query: 483  SGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNI 542
            SG GKST+  ++ R Y   + ++ +DN D+       LR QI +V+Q+P L  GTIR+N+
Sbjct: 1072 SGCGKSTLVNIITRLYECPSNSLFVDNTDVNDWALPKLREQIAVVEQKPTLFKGTIRENL 1131

Query: 543  TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIK 602
             YG        ++ ++ K    ++F    P   +T I     LLSGGQ QR+ IARAL++
Sbjct: 1132 VYGSPLGTADVDVFNMLKYVGIYDFFATLPEGLETKI--DSGLLSGGQNQRLCIARALLQ 1189

Query: 603  KPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 662
            +P ILILDE TSALD  S   IN    +     +M  +SI H    +R    V VL   G
Sbjct: 1190 RPKILILDECTSALDTMSSHIINEIIRE--GPPTMLTISITHDEQMVRACNKVAVLDQ-G 1246

Query: 663  SVVEMGKFKEL 673
             +VEMG  ++L
Sbjct: 1247 HIVEMGNREDL 1257

 Score =  155 bits (391), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 138/560 (24%), Positives = 249/560 (44%), Gaps = 27/560 (4%)

Query: 163 FSLPLYEFLSFFTVALLIGCAANFGRFILLR---ILSERVVARLRAHVIKKTLHQDAEFF 219
           +S P++E      V L +G  +    +I +    +L ER   R+R  +I   L +  +++
Sbjct: 54  WSDPIHELRLRSMVILALGAGSIVIIWICISSWMLLGERQNFRVRTQLIDSYLQKPMKWY 113

Query: 220 DNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL-------SPQLSI 272
           D++        L  D    +R + +  S   +A       +  + +L       S  L++
Sbjct: 114 DDNDT------LTGDLTQTNRCVEELRSSSAEASALTWKNLVTILALTVTSFYYSWSLTL 167

Query: 273 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332
           + +   P ++  A  F + I   S+     T   +++    +   + V+    +  E+  
Sbjct: 168 VTMCGAPVIVLCAIFFSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQLVEVQN 227

Query: 333 YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 392
           + +A++   +                  L    F+    +GS ++ + +L I D+     
Sbjct: 228 FQLAVKKCSKNFMKMCLYASANTAILKFLTLTIFVQAFWFGSTMIRKHKLRIEDVITCFQ 287

Query: 393 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTV--GHKYQPERGV---IE 447
                G  + G       + +G      + E   +   +        ++  + G+   IE
Sbjct: 288 SCVLLGATINGTLHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNRRFYLDGGISEKIE 347

Query: 448 FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI 507
            ++V F+YP+RP+V   K+++  +  G    +VG SG GKS++  LLL+ Y+   G+I I
Sbjct: 348 LRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKLYDDYNGSISI 407

Query: 508 DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPT---KEEIRSVAKQCFC 564
           D  DI  ++ KS+ + I +V+Q   L + T+R+NI +G   T      E +++  +    
Sbjct: 408 DGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFGSKETDELVRDESLKAACRISLL 467

Query: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
            NFI   P   DT+IG  G   SGGQ+QRIAIARA ++   IL+LDEA SALD+   G +
Sbjct: 468 DNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEAVSALDIIHRGLL 527

Query: 625 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
                   +S+  TI+ + H LS I   +++I L  DG VVE G+ + L  N       +
Sbjct: 528 MNAIRN-WRSEKTTII-LTHDLSEI-GPDDMIYLLEDGEVVEQGQQRNLLLNQQGRFFNM 584

Query: 685 LNERAAPGPSDQQLQIEKVE 704
           ++  A    +D    I  +E
Sbjct: 585 VSLGAGTDLADSSSLITTIE 604

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  179 bits (453), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 136/445 (30%), Positives = 214/445 (48%), Gaps = 25/445 (5%)

Query: 252 ALICGIVGVGMMCSLSPQLSILLLFFTPPVLFS-----ASVFGKQIRNTSKDLQEATGQL 306
           +++CGI+      S +       + FT  +L+S      + +  Q R   +D  +A  + 
Sbjct: 243 SVVCGILTYQFGASFAA------ITFTTMILYSIFTIRTTAWRTQFR---RDANKADNKG 293

Query: 307 TRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSF 366
             VA + L   + V+ F  E     +Y+ ++                     +L+   + 
Sbjct: 294 ASVALDSLINFEAVKYFNNEKYLADKYHTSLIKYRDSQIKVSQSLAYLNSGQNLIFTSAL 353

Query: 367 LTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD 426
             ++  G   V+   L++GDL             +  L + Y E+ Q       LF+L  
Sbjct: 354 TAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQL-- 411

Query: 427 RKPSISPTVGHK---YQPERGVIE--FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVG 481
           RK  I    G      +   G  E  F++V+F Y ++   +I  + +F I  G    +VG
Sbjct: 412 RKNEIKIENGTNPIVLKASDGPFEITFENVTFGYDSKR--KILNNASFTIPGGLKTAVVG 469

Query: 482 PSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDN 541
           PSG GKSTI  L+ R+Y+P  G I+I+  D+ + +  SLRR +G+V Q+  L + TI +N
Sbjct: 470 PSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVMGVVPQDTPLFNDTIWEN 529

Query: 542 ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALI 601
           + +G     T EE+ +V ++      I K P  Y+T++G  G ++SGG+KQR+AIAR L+
Sbjct: 530 VKFG-RIDATDEEVHTVIEKAQLAPLIKKLPQGYETIVGERGMMISGGEKQRLAIARVLL 588

Query: 602 KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
           K   I+  DEATSALD  +E A+  T     +S S T V IAHRL TI  ++ +IVL  D
Sbjct: 589 KNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAHRLRTIADADKIIVL-ED 647

Query: 662 GSVVEMGKFKELYANSTSALSQLLN 686
           G+V E G    L A   S  + L N
Sbjct: 648 GAVKEEGTHSGLLATPGSLYANLWN 672

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  178 bits (451), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 113/330 (34%), Positives = 175/330 (53%), Gaps = 10/330 (3%)

Query: 363 DLSFLTVLAYGSYL----VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 418
           +L F + L    Y+    V++  L++GDL             +  L + Y E+ Q     
Sbjct: 355 NLIFTSALTAVMYMACSGVMEGSLTVGDLVLINQLIFQLSLPLNFLGSVYRELKQSLIDM 414

Query: 419 SRLFELTDRKPSISPTVGHKYQPER--GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSS 476
             LF L   K +I   +  +  PE+    I F++V+F Y   P  +I K+  F I  G  
Sbjct: 415 ESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKNATFTIPAGKK 472

Query: 477 VCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSG 536
             IVGPSG GKSTI  L+ R+Y P  G I+ID +DI +++  SLR+ IG+V Q+  L + 
Sbjct: 473 TAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQDTPLFND 532

Query: 537 TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAI 596
           TI +N+ +G     + ++I +  ++      I   P   +T++G  G ++SGG+KQR+AI
Sbjct: 533 TIWENVKFG-RIDASDKDITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGEKQRLAI 591

Query: 597 ARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 656
           +R L+K   ++  DEATSALD  +E ++  T  +  + +S T V IAHRL TI  ++ +I
Sbjct: 592 SRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIADADKII 651

Query: 657 VLGHDGSVVEMGKFKELYANSTSALSQLLN 686
           VL ++  V E G  K L     S  S+L N
Sbjct: 652 VL-NNSRVHEEGDHKTLLKTPGSLYSELWN 680

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  180 bits (456), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 150/554 (27%), Positives = 261/554 (47%), Gaps = 39/554 (7%)

Query: 152  GSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKT 211
            GS F+ LK  +  L +    +F T          F +  ++   SE  +  LR  V++  
Sbjct: 744  GSSFYLLKWSLIVLSVAIIDAFCT----------FSKTFIMGYCSEYWIMDLRKKVMRTI 793

Query: 212  LHQDAEFFD--NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ 269
             +   E+F    +K  ++ +   +D   +   +T+ ++     L+    G+        +
Sbjct: 794  TYNKFEWFQLAENKPSEVSALALNDLRDLRTLVTEFLATASTFLVVSTCGLIWALVAGWK 853

Query: 270  LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
            LS++ +   P ++  + V+G  ++    D + A  QL     E +  +KT++    + + 
Sbjct: 854  LSLVSISMFPLIIVFSGVYGAALQKCETDYKSAVAQLENCLYEVVVSMKTIRCLQLQTHF 913

Query: 330  LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS---IGD 386
             +RY+   + +  +G                L       +  YG  LV+  + +   + +
Sbjct: 914  QNRYDRRKQRMLSLGRRRSVITGCGIAITHTLTLCIQAILYYYGIKLVIDGKYTSKKMFE 973

Query: 387  LTAFMLYTEYTGNAVFG----------LSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 436
            +   +L+T  T   +             +T+   I++ A A     ++ +R   IS T  
Sbjct: 974  VFTLILFTIMTCTNLINQIPEVTRGQRAATYIYRILKEAAATREHQDMHNRTLPISNT-- 1031

Query: 437  HKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
                 +  ++  KD++F+YP  PS  +++ LN  +   +SV +VG SG GKSTI  LL +
Sbjct: 1032 ---SEKDTMVLVKDLTFAYPATPSKHVYEHLNLNLKSDTSVALVGESGSGKSTIISLLTK 1088

Query: 497  YYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKE-EI 555
             Y+     I +D  D+++ +  SLR QI +V+Q   L++GTIR+N+TYGL    T E ++
Sbjct: 1089 LYDVPEKHIYVDGTDLSEWDTNSLRNQISVVEQSANLLNGTIRENLTYGLPEEDTTEVDL 1148

Query: 556  RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
              + K    ++F+++ PN  DT++     LLSGGQ QR+ IARAL+K   ILILDE TSA
Sbjct: 1149 IGILKLVSIYDFVSRLPNGIDTIVDRD--LLSGGQAQRLCIARALVKPHRILILDECTSA 1206

Query: 616  LDVESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
            LD  S    N     + K    T I++I H    +R  E+V++L  +G++VE G F EL 
Sbjct: 1207 LDALST---NIIIDIVRKGIPNTLIIAITHDEHMMRSCESVLLL-KNGAIVEQGSFVELM 1262

Query: 675  ANSTSALSQLLNER 688
                S   + LN R
Sbjct: 1263 QQD-SEFKKCLNGR 1275

 Score =  151 bits (381), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 130/516 (25%), Positives = 234/516 (45%), Gaps = 27/516 (5%)

Query: 202 RLRAHVIKKTLHQDAEFFDNHK---VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIV 258
           R+R +++   L +   ++D +    +G+  ++L      V +S ++  +  +++ +  + 
Sbjct: 95  RIRINMLGSYLSKSWTWYDGNGKRLLGEF-TQLSRCIEEVRQSSSESAAITLQSFVSVLS 153

Query: 259 GVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGI- 317
            +G     S  L++++L  TP +   A  F K + N   DL+    + T  A E L+   
Sbjct: 154 LIGTSFYYSWSLTLIILCSTPIITAIAIYFAK-LTNKYTDLE---NKETSYAAELLTWSM 209

Query: 318 ---KTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
                V+ + A+  E+S+++ ++     +                 L    F+    +G+
Sbjct: 210 RFNDMVKFYTAQNEEISKFDTSVTRCNSLFIKACLYSALNSSIIRFLTLCMFVQGFWFGA 269

Query: 375 YLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPT 434
            ++ +++L I D+          G  V    +  + I +G  A  +L    + +      
Sbjct: 270 TMIRRNKLDINDVITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFLELEGKTIMQ 329

Query: 435 VGHKYQPERGV--IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIAL 492
              K  P+     I F ++SF YP R S    ++++ ++  G    I+G SG GKST+A 
Sbjct: 330 AALKCPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKSTLAK 389

Query: 493 LLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYG------- 545
           LLLR+Y   +G+I +DN  I  LN + L   I +V+Q   L + T+R+NI  G       
Sbjct: 390 LLLRFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILLGSENQSEP 449

Query: 546 LTYTPTKEEIRSVAKQC---FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIK 602
                 +E  R + K C     +  +    +  DTVIG  G  LSGGQ+QR+A+ARA ++
Sbjct: 450 ARMESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRVALARAFLR 509

Query: 603 KPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 662
              I+I DE+ SALDV     +        + K  T + + H LS I  ++ + ++ H G
Sbjct: 510 NTPIMIFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINPTDFIYIMEH-G 566

Query: 663 SVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQL 698
            V E G  ++L  + TS  S+    +A  G   + L
Sbjct: 567 RVCEYGYQEDLLKSETSYFSRFYQHQAPEGAVHESL 602

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  176 bits (446), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 130/433 (30%), Positives = 207/433 (47%), Gaps = 16/433 (3%)

Query: 252 ALICGIVGVGMMCSLSP-QLSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
           +++CGI+      S +    S +LL+  FT    F  + +  + R   +D  +A  +   
Sbjct: 243 SMVCGILTYQFGASFAAITFSTMLLYSIFT----FRTTAWRTRFR---RDANKADNKAAS 295

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           VA + L   + V+ F  E     +Y+ ++                     +L+   +   
Sbjct: 296 VALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLNTGQNLIFTTALTA 355

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           ++      V+Q  L++GDL             +  L + Y ++ Q       LF+L   +
Sbjct: 356 MMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLQKNQ 415

Query: 429 PSISPTVGHKYQPERGV--IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRG 486
            +I  +   +  P      I F++V+F Y   P  +I  +++F I  G    IVGPSG G
Sbjct: 416 VTIKNSPNAQNLPIHKPLDIRFENVTFGYD--PERRILNNVSFTIPAGMKTAIVGPSGSG 473

Query: 487 KSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGL 546
           KSTI  L+ R+Y P  G I++   DI  L+  SLR+ IG+V Q+  L + TI +N+ +G 
Sbjct: 474 KSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQDTPLFNDTIWENVKFGN 533

Query: 547 TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTI 606
             +   E +R++ K       +   P    TV+G  G ++SGG+KQR+AIAR L+K   +
Sbjct: 534 ISSSDDEILRAIEKAQLT-KLLQNLPKGASTVVGERGLMISGGEKQRLAIARVLLKDAPL 592

Query: 607 LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 666
           +  DEATSALD  +E A+ +T  Q   S S T V +AHRL TI  ++ +IVL   GSV E
Sbjct: 593 MFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIADADKIIVL-EQGSVRE 651

Query: 667 MGKFKELYANSTS 679
            G    L A+  S
Sbjct: 652 EGTHSSLLASQGS 664

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  176 bits (445), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 154/562 (27%), Positives = 260/562 (46%), Gaps = 40/562 (7%)

Query: 176 VALLIGC--AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           +AL + C  AA FG  +L   L   V AR+  + I+       E F +    DL   L  
Sbjct: 150 IALTVICYGAARFGS-VLFGELRNAVFARVAQNAIRTV---SLETFKHLMKLDLGWHLSR 205

Query: 234 DAYVVSRSM---TQKVSDGVKALI-------------CGIVGVGMMCSLSP-QLSILLLF 276
               ++R+M   T+ +S  + A++             CGI+      S +    + +LL+
Sbjct: 206 QTGGLTRAMDRGTKGISYVLSAMVFHILPITFEISVVCGILTYQFGASFAGITFATMLLY 265

Query: 277 --FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
             FT  V    + F        +D  +A  +   VA + L   + V+ F  E     +Y+
Sbjct: 266 SIFTIKVTAWRTAF-------RRDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYH 318

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
            ++                     + +   +   ++  G   V+   L++GDL       
Sbjct: 319 NSLMKYRDSQVKIAQSLAFLNAGQNFIFTSALSAMMYMGCTGVIGGDLTVGDLVLINQLV 378

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERG---VIEFKDV 451
                 +  L + Y E+ Q       LF L + K  I         PE      I+F++V
Sbjct: 379 FQLSVPLNFLGSVYRELKQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENV 438

Query: 452 SFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQD 511
           +F Y TR   +I ++ +F I  G    IVGPSG GKSTI  L+ R+Y+P +G ++++ +D
Sbjct: 439 TFGYDTRR--KILRNASFTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKD 496

Query: 512 ITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF 571
           + + +  S R+ IG+V Q+  L + TI +N+ +G     T +E+ +  ++      I K 
Sbjct: 497 VREYDLDSFRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDDEVTNAIEKAQLAPLIHKL 555

Query: 572 PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQL 631
           P    T++G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  + 
Sbjct: 556 PVGSATIVGERGLMISGGEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIREN 615

Query: 632 MKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAP 691
               S T V +AHRL TI  ++ ++VL  +G V E G   EL +   S   QL + +   
Sbjct: 616 FDRGSRTSVYVAHRLRTIADADKILVL-EEGCVREEGSHTELLSRPNSLYKQLWDIQENL 674

Query: 692 GPSDQQLQIEK-VEEKEDTNEG 712
              DQ+++ E+ +E++ + ++G
Sbjct: 675 DVIDQEIKQERQLEDQLNQHKG 696

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  175 bits (444), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 158/548 (28%), Positives = 256/548 (46%), Gaps = 39/548 (7%)

Query: 161 PIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFD 220
           P  +LP+   L+ F+  +     A FG  +L   L   V A++  + I+       E F 
Sbjct: 177 PTIALPMSICLTIFSYGV-----ARFGA-VLFGELRNAVFAKVAQNAIRTV---SLETFQ 227

Query: 221 NHKVGDLISRLGSDAYVVSRSM---TQKVSDGVKALICGIVGVGMMCS-----LSPQL-- 270
           +    DL   L      ++R+M   T+ +S  + A++  I+ +G   S     L+ Q   
Sbjct: 228 HLMKLDLGWHLKRQTGGLTRAMDRGTKGISYVLSAMLFHIIPIGFEISVVCGILTYQFGA 287

Query: 271 SILLLFFTPPVLFS-----ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 325
           S   + FT  +L+S      + +  Q R   +D  +A  +   VA + L   + V+ F  
Sbjct: 288 SFAGITFTTMLLYSIFTIRTTAWRTQFR---RDANKADNKGASVALDSLINFEAVKYFNN 344

Query: 326 EGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIG 385
           E    ++Y+ ++                     +L+   +   ++  G   V++  L++G
Sbjct: 345 ETYLSNKYHDSLLQYRDSTIKVAQSLAFLNSGQNLIFTSALTMMMYLGCTGVIEGNLTVG 404

Query: 386 DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL-------TDRKPSISPTVGHK 438
           DL             +  L + Y E+ Q       LF+L        + K   +P +  K
Sbjct: 405 DLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLRKNPIKIQNAKTGPAP-IMLK 463

Query: 439 YQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
                  I+F++V+F Y T  + +I K+ +F I  G    +VGPSG GKSTI  L+ R+Y
Sbjct: 464 SSDGPFEIKFENVTFGYDT--NRKILKNASFIIPAGLKTAVVGPSGSGKSTILKLVFRFY 521

Query: 499 NPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSV 558
           +P  G ++I+  ++ + +  SLRR +G+V Q+  L + TI +N+ +G       EEI+ V
Sbjct: 522 DPEEGRVLINGINVQRYDIDSLRRVMGVVPQDTPLFNDTIWENVKFG-RINANDEEIKQV 580

Query: 559 AKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            ++      I K P    T++G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD 
Sbjct: 581 IEKAQLAPLIEKLPQREKTIVGERGLMISGGEKQRLAIARVLLKDANIMFFDEATSALDT 640

Query: 619 ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANST 678
            +E A+  T      S + T + IAHRL TI  ++ +IVL  DG V E G   EL A   
Sbjct: 641 HTEQALLNTIRANFPSGTRTSIYIAHRLRTIADADKIIVL-EDGKVKEEGSHNELLATKG 699

Query: 679 SALSQLLN 686
           S  S L N
Sbjct: 700 SLYSNLWN 707

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
            YKL209C (REAL)
          Length = 1316

 Score =  177 bits (448), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 151/540 (27%), Positives = 271/540 (50%), Gaps = 39/540 (7%)

Query: 177  ALLIGCAA-----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLIS 229
             +++G AA     NF +  LL   SE  +  LR  V++K   +   +F  +++K  ++ +
Sbjct: 790  CIVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSA 849

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGIV--GVGMMCSLSP--QLSILLLFFTPPVLFSA 285
             + +D     R +   VS+ + A+   I    +G++ +L+   +LS++ +   P ++  +
Sbjct: 850  LVLNDL----RDLRSLVSEFLSAITSFITVSFIGLVWALASGWKLSLVCISMFPLIIIFS 905

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 345
            +++G  ++    D + +  QL     + ++ IKT++   AE +    Y+     + Q+  
Sbjct: 906  AIYGSILQKHETDYKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIAS 965

Query: 346  XXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLS 405
                         +++       +  YG  LV+  + +   +        +T  +   L 
Sbjct: 966  KRAIATGFGISMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLV 1025

Query: 406  TFYSEIMQGAGAASRLFELTDRKP-----------SISPTVGHKYQPERG--VIEFKDVS 452
            +   +I +G  AAS ++ + D K            SI   +G  Y  ++   ++  ++++
Sbjct: 1026 SQIPDISRGQRAASWIYRILDEKQVTLEIEDNNARSIG-IIGETYHEKQTTPMLSIQNLT 1084

Query: 453  FSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDI 512
            F+YP+ PSV I+K++N  +  G ++ IVG SG GKST+ LLL R Y+   G+I +D  D+
Sbjct: 1085 FAYPSAPSVLIYKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDV 1144

Query: 513  TKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFP 572
               N   LRR+I +V+Q+P+L +GTIRDN+TYG      + EI    K    ++F+   P
Sbjct: 1145 NDWNLTVLRREISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLP 1204

Query: 573  NTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLM 632
                T I  +  LLSGGQ QR+ IARAL++KP ILILDE TSALD  S   I     +++
Sbjct: 1205 LGLGTRIDTN--LLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIK----EIV 1258

Query: 633  KSK--SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAA 690
            K    ++  + I H    +R  +++ V   DG V+E G F  LY N+   + ++++E+ A
Sbjct: 1259 KKGPPALLTLVITHDEQMMRCCDSIAVF-KDGKVIEEGSFDTLY-NNCGEMFRIVSEKNA 1316

 Score =  162 bits (409), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 138/509 (27%), Positives = 232/509 (45%), Gaps = 30/509 (5%)

Query: 192 LRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVK 251
           LRI S+ + A L    +K     D    D  ++   +  L S +   S    Q +     
Sbjct: 131 LRIRSQLLEAYLEKKPMKWYDVNDTLLGDFTQINRCVEELRSSSAEASAITFQNL----- 185

Query: 252 ALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 311
             IC ++G     S S  L++++L  +P + F A  F + +   S+   E T +  ++  
Sbjct: 186 VAICALLGTSFYYSWS--LTLIILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFA 243

Query: 312 EQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS---FLT 368
             ++  + V+ +  +  E  ++    R I                   +L  L+   F+ 
Sbjct: 244 WSMNAAQLVRLYCTQPLERKKFQ---RIILSCNTFFIKSCLFVAANAGILRFLTLTMFVQ 300

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
              +GS ++ Q +L+I D+          G+ +         + +G  A  ++  L +  
Sbjct: 301 GFWFGSTMIKQGKLNINDVITCFHSCILLGSTLNNTLHQIVVLQKGEVALQKIMNLLENG 360

Query: 429 PSISPTVG---HKYQPERGV--IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPS 483
           P  +P      H+Y  +     + F +VSFSYP+RPS  + ++ + K   G    IVG S
Sbjct: 361 PKCNPPNEIELHQYPLDYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFIVGKS 420

Query: 484 GRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNIT 543
           G GKST++ LLL++Y+   G+I I+ ++I  +  K L + I +V+Q   L + T+R NI 
Sbjct: 421 GSGKSTLSSLLLKFYDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLRKNIL 480

Query: 544 YGLT-------YTPTKEE--IRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRI 594
            G T       Y+  K    I+   +       I   P+  +T+IG  G  LSGGQ+QR+
Sbjct: 481 LGSTELAKNADYSTNKNTNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLSGGQQQRV 540

Query: 595 AIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 654
           A+ARA I+   IL LDEA SALD+     +        K K+  I++  H L  +  S++
Sbjct: 541 AMARAFIRDTPILFLDEAVSALDIIHRNLLMKAIRHWRKGKTTIILT--HELGQV-ESDD 597

Query: 655 VIVLGHDGSVVEMGKFKELYANSTSALSQ 683
            + L  +G V+E G   EL A+STS  S+
Sbjct: 598 HLYLMQEGKVIESGTQSELLADSTSTFSK 626

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  174 bits (440), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 117/328 (35%), Positives = 173/328 (52%), Gaps = 12/328 (3%)

Query: 365 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423
           S LT + Y G   V+   L++GDL             +  L + Y E+ Q       LF+
Sbjct: 365 SALTAIMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFK 424

Query: 424 LTDRKPSISPTVGHK--YQPERGV---IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVC 478
           L  RK  I     H+    P       I+F++V+F Y      +I K+ +F I  G    
Sbjct: 425 L--RKNEIKIQNVHRPLMLPNELTPFEIKFENVTFGYDKER--KILKNASFTIPAGWKTA 480

Query: 479 IVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTI 538
           +VGPSG GKSTI  L+ R+Y+P  G I+++  DI +++  SLR+ IG+V Q+  L + TI
Sbjct: 481 VVGPSGSGKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTI 540

Query: 539 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIAR 598
            +N+ +G       E ++++ K       I K P   +T++G  G ++SGG+KQR+AIAR
Sbjct: 541 WENVKFGRIEATDNEILQAIEKAQLAP-LIKKLPKGRETIVGERGLMISGGEKQRLAIAR 599

Query: 599 ALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
            L+K   I+  DEATSALD  +E ++  T  +     S T V IAHRL TI  ++ +IVL
Sbjct: 600 VLLKNSGIMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL 659

Query: 659 GHDGSVVEMGKFKELYANSTSALSQLLN 686
             DG V E G  ++L A   S  S+L N
Sbjct: 660 -KDGQVEEEGTHRQLIAKKESLYSELWN 686

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  172 bits (435), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 150/533 (28%), Positives = 243/533 (45%), Gaps = 35/533 (6%)

Query: 176 VALLIGC--AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           + L + C  AA FG  +L   L   V AR+  + I+       E F +    DL   L  
Sbjct: 149 IMLTVVCYGAARFGA-VLFGELRNAVFARVGQNAIRNV---SMETFRHLMKLDLGWHLSR 204

Query: 234 DAYVVSRSM---TQKVSDGVKALICGIV----GVGMMCS-LSPQL--SILLLFFTPPVLF 283
               ++R+M   T+ +S  + A++  I+     + ++C  L+ Q   S   + FT  +L+
Sbjct: 205 QTGGLTRAMDRGTKGISYVLSAMVFHIIPITFEISVVCGILTYQFGASFAGITFTTMLLY 264

Query: 284 SASVFGKQIRNTS--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
           S   F      T   ++  +A  +   VA + L   + V++F  E     +Y  ++    
Sbjct: 265 SIFTFRTTAWRTKFRREANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYR 324

Query: 342 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAV 401
                            +L+   +   ++  G   ++   L++GDL             +
Sbjct: 325 DSQVRVAQSLAFLNSGQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPL 384

Query: 402 FGLSTFYSEIMQGAGAASRLFELTDR--------KPSISPTVGHKYQPERGVIEFKDVSF 453
             L + Y E+ Q       LF L +         KP + P     +      I F++V+F
Sbjct: 385 NFLGSVYRELKQSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFD-----IVFENVTF 439

Query: 454 SYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 513
            Y   P  +I ++ +F I  G    +VGPSG GKST+  L+ R+Y+P  G I+++  DI 
Sbjct: 440 GYD--PRRKILQNASFVIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIR 497

Query: 514 KLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 573
           + +  SLRR IG+V Q+  L + TI +N+ +G      +E  RS+ K       + + P 
Sbjct: 498 EYDLDSLRRAIGVVPQDTPLFNDTIWENVKFGRIDADDQEVTRSIEKAHLAP-LVYRLPG 556

Query: 574 TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMK 633
             +T++G  G ++SGG+KQR+AIAR L+K  +I+  DEATSALD  +E A+  T      
Sbjct: 557 GLNTIVGERGLMISGGEKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFD 616

Query: 634 SKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
             S T V IAHRL TI  ++ +IVL  +G   E G   EL     S   +L N
Sbjct: 617 RGSKTSVYIAHRLRTIADADKIIVL-EEGRPREEGTHHELLQKEDSLYRELWN 668

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  174 bits (440), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 138/518 (26%), Positives = 238/518 (45%), Gaps = 42/518 (8%)

Query: 195 LSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKA-- 252
           L ER    +R  ++ + L +  E++D H       +L  D   V+R + +  S   +A  
Sbjct: 100 LGERQGFAIRKRLLNEYLVKPMEWYDCH------DKLLGDFTQVNRCVEELRSSSAEASA 153

Query: 253 -----LICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLT 307
                 +  +  +G     S  L++++L   P ++  A +F   I   ++     TG+  
Sbjct: 154 ITFQNFVAMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAA 213

Query: 308 RVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS-- 365
           ++    ++  + V+ +  +  E+  +   +    Q                S+L  LS  
Sbjct: 214 QLLNWSMNSAQLVKLYCTQAYEIHSFKELVG---QCNDLFIKSCFYVSANTSILRFLSLS 270

Query: 366 -FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            F+    +G+ +V + +LSI D+          G+ +         + +G  A  ++ + 
Sbjct: 271 MFVQGFWFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDF 330

Query: 425 ---TDRKPSISPTVGHKYQPE----RGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSV 477
              + R PS+ P     Y+P      G I F+++SF+YPTRP   + K ++    PG S 
Sbjct: 331 ISFSQRSPSLEP----PYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRST 386

Query: 478 CIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGT 537
            I+G SG GKST+A LLL++YN   G+I I N ++ K+N   L   I +V+Q   L + T
Sbjct: 387 FIIGKSGSGKSTLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDT 446

Query: 538 IRDNITYGLTYTPTKEE---------IRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSG 588
           +R+N+  G++ +  K E         ++   +       I + P+  DT+IG  G  LSG
Sbjct: 447 LRNNLLLGISNSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSG 506

Query: 589 GQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 648
           GQ+QR+AIARA IK  ++LILDEA SALD+     I          K+  I++  H LS 
Sbjct: 507 GQQQRVAIARAYIKDSSVLILDEAVSALDIIHRELIMKAIKNWRSGKTTIILT--HDLSQ 564

Query: 649 IRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
           +   + + V   DG V E G  + L  +  +  S+L +
Sbjct: 565 LDYDDFLYVF-EDGEVKESGYQQALLQDEKTIFSKLYD 601

 Score =  173 bits (438), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 143/520 (27%), Positives = 245/520 (47%), Gaps = 25/520 (4%)

Query: 184  ANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMT 243
            +NF +  +L   SE  +  LR   +   +++  ++F   +  +  S L +      R + 
Sbjct: 781  SNFLKSYILGYCSELWIMDLRNEAMAAIMNKRLDWFSKEE--NKSSELSALLLNDLRDLR 838

Query: 244  QKVSDGVKALICGIVG--VGMMCSL--SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDL 299
              VS+ + A+   IV   VG++ +L    +LS++ +   P ++  + ++G  ++      
Sbjct: 839  SLVSEFLSAMTTFIVVSLVGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMY 898

Query: 300  QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 359
            + A  +L     E ++ IKT++   A    +  Y V   ++ ++               +
Sbjct: 899  KTAVAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITN 958

Query: 360  LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 419
             +       +  YG  LV + + S   +        +T  +   L +   +I +G  AAS
Sbjct: 959  TIAVCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAAS 1018

Query: 420  RLFELTDRKPSISPTVGHKYQPERGVIE----------FKDVSFSYPTRPSVQIFKSLNF 469
             L+ + D       +V    +    +I            K++ FSYP+  +V+I+K++  
Sbjct: 1019 WLYRILDESDDNKESVDSGSRSADIIISGNTNSVPLISIKNLRFSYPSAQTVEIYKNITL 1078

Query: 470  KIAPGS-SVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQ 528
             +     ++ IVG SG GKST+  LL + Y     +I ID  D+ + +   LR+QI +V+
Sbjct: 1079 HVTSSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQISVVE 1138

Query: 529  QEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSG 588
            Q P L  GT+RDN+ YG     ++ EI  V K    + FI   P   D+ I     L+SG
Sbjct: 1139 QNPTLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLDSRIDTK--LVSG 1196

Query: 589  GQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 648
            GQ QR+ IARAL++KPTILILDE TSALD  S   IN     L+K+   T+++I    S 
Sbjct: 1197 GQAQRLCIARALLRKPTILILDECTSALDAASAHLIN----NLVKNGLPTVLTIVITHSK 1252

Query: 649  -IRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
             +  + N + +  DG + E G F EL  N+ S L +++NE
Sbjct: 1253 QMMEACNSLAVIKDGRLAEQGNFAELMKNN-SELRRIINE 1291

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  173 bits (438), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 137/522 (26%), Positives = 255/522 (48%), Gaps = 30/522 (5%)

Query: 184  ANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRS 241
            +NF +  +L   SE  +  LR   ++  L++D  +F  D +K  +L + L +D   +   
Sbjct: 774  SNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLNDLRDLRSL 833

Query: 242  MTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE 301
            +++ +S     ++  ++G+        +LS++ L   P ++  ++V+G  ++      + 
Sbjct: 834  VSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGTMLQKYETTYKT 893

Query: 302  ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLL 361
            +   L     E ++GIKT++S  AE + +  Y+    ++  +               +++
Sbjct: 894  SVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIATGFGISVTNMI 953

Query: 362  GDLSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYTGNAVFGL----------STFY 408
                   +  YG  LV + + S   + +    +L+T  T  ++             +TF 
Sbjct: 954  TICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVNQIPDISRGQRSATFL 1013

Query: 409  SEIM-QGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSL 467
              I+ +G  +    FE   +   ++P    K  P   +I+ ++++F+YP+  +V +++ L
Sbjct: 1014 YRILDEGLASDESEFETHRKAEIVAPKQESKSNP---LIKIQNLTFAYPSETNVNVYEDL 1070

Query: 468  NFKI-APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGI 526
            N ++ A   ++ +VG SG GKST+  LL + Y     +I +D  D+      +LR QI +
Sbjct: 1071 NLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNLRTQISV 1130

Query: 527  VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
            V+Q+P L  GT+R+N++YG++      E+  + K    + F+   P   DT I     LL
Sbjct: 1131 VEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDTRIDTK--LL 1188

Query: 587  SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS--KSMTIVSIAH 644
            SGGQ QRI IARAL++KP ILILDE TSALD  S   I      ++K+   ++  + I H
Sbjct: 1189 SGGQAQRICIARALLRKPKILILDECTSALDALSANII----IDIVKNGPPALLTIVITH 1244

Query: 645  RLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
                + R+ N I +  +G ++E G FKEL  N    L ++++
Sbjct: 1245 S-EKMMRACNTIAVLKNGKIIEKGGFKEL-VNGNGELKKIID 1284

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 127/517 (24%), Positives = 231/517 (44%), Gaps = 43/517 (8%)

Query: 195 LSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL- 253
           L ER    +R  ++++ L +   ++D++        L  D   ++R + +  S   +A  
Sbjct: 102 LGERQGFAVREKILQEYLTKPITWYDSN------DNLSGDFTQINRCVEELRSSSAEASA 155

Query: 254 --------ICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEA-TG 304
                   I  ++G     S S  L IL    T P++ + +VF   + +   +L+   TG
Sbjct: 156 IIFQNLVSILALIGTSFYYSWSLTLIILC---TAPIIIAFAVFFSHMIHKYTELENTETG 212

Query: 305 QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL 364
           +  ++A   +  I+ V+ +  +  E+  +     +   +                 L   
Sbjct: 213 KAAQLANWAMDSIQLVKLYCTQFREVRNFRELTSNCNDLFIKCCLYVSANTALLRFLSLS 272

Query: 365 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            F+    +G+ +V + +L I ++          G+ +         + +G  A  ++   
Sbjct: 273 MFIQGFWFGATMVRKGKLQISNVVTCFQSCLMLGSTLSNTLQVIVILQKGDVALKKILGF 332

Query: 425 TDRKPSISPTVGHK-----YQPER----GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGS 475
                 +S +V H      Y+PE       I F +++FSYP+RPS  + K+++    P  
Sbjct: 333 ------LSTSVDHGADEPIYEPETPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPTK 386

Query: 476 SVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMS 535
              I+G SG GKST++ LLL++Y+   GTI +   D+ ++N   L   + +V+Q   L +
Sbjct: 387 FTFIIGKSGSGKSTLSNLLLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFN 446

Query: 536 GTIRDNITYGLT------YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGG 589
            T+R+NI  G++      +   +++++           +   P+  +T+IG  G  LSGG
Sbjct: 447 DTLRNNILLGVSKDQLEDHESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGG 506

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 649
           Q+QR+AIARA ++   ILILDEA SALD+     +     Q    K  T + + H LS I
Sbjct: 507 QQQRVAIARAFMRNKPILILDEAVSALDIIHRELLMKNIRQWRSGK--TTILLTHELSQI 564

Query: 650 RRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
              +   V+  +G V E G  K+L    TS  + +LN
Sbjct: 565 EPDDYTYVI-QEGEVKENGYQKDLKQKKTSVFNHMLN 600

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  172 bits (437), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 152/542 (28%), Positives = 261/542 (48%), Gaps = 29/542 (5%)

Query: 163  FSLPLYEFLSFFT--VALLIGC--AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEF 218
            ++ P  E+L  F+  V+L+  C   + F +   L    E  +  LR     K +     +
Sbjct: 696  YNSPGSEYLLKFSLIVSLIALCDGVSTFIKLFFLGYSGEFWIFELRQETFIKIIKNPISW 755

Query: 219  FD--NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLF 276
            F   N+K   L + L +D   +   +T+ +S     ++   +G+    ++  +LS++ + 
Sbjct: 756  FSKSNNKAPILSTLLINDLRDLRNLVTEFLSVITTLILVTSIGLVWAIAIGWKLSLVCIA 815

Query: 277  FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336
              P V+    ++G  +  T    + +   L  +  E + G+KT+QS   +     ++N  
Sbjct: 816  IIPLVVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCK 875

Query: 337  IRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL---TAFMLY 393
            I+ + + G              ++L  L    +  YG  LVL  + +   L    A +L+
Sbjct: 876  IKLLEKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLF 935

Query: 394  TEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISP-----TVGHKYQPERGVI 446
            T  T   V  L T   +I +G  + S + ++   D + +I P     T    + P + VI
Sbjct: 936  TIVT---VASLVTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLSTTKGIWNPNQPVI 992

Query: 447  EFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 506
            E  ++SF+Y    + +   ++N ++       IVG SG GKST+  L+   Y+ + G+I 
Sbjct: 993  EVSNLSFTYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSIN 1052

Query: 507  IDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
            I + DI K + K L + + ++QQ PVL   TIR+N+ YGLT T   E + +V +     +
Sbjct: 1053 ICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKS 1112

Query: 567  FITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
            FI    N  D+ +    +LLSGGQ QR+ +AR +++ P +LILDE TSALDV S   IN 
Sbjct: 1113 FIISLNNGLDSKLDD--SLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKIND 1170

Query: 627  TFGQLMKSKSMTIVSI--AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
              G    S+S+  V+I  +H+  TI+  + +  L  DG+V  MG ++EL  N+     +L
Sbjct: 1171 IIG----SRSLAPVTIIVSHQKETIKLCDKIFFLV-DGTVAMMGTYEELMENNWE-FRKL 1224

Query: 685  LN 686
            LN
Sbjct: 1225 LN 1226

 Score =  164 bits (415), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 143/501 (28%), Positives = 236/501 (47%), Gaps = 31/501 (6%)

Query: 175 TVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQD-----AEFFDNHK---VGD 226
           T+++LI    N   F  L I    ++   ++++I+K L  +       +FD ++   +G+
Sbjct: 74  TMSILILGMGNLP-FNWLAIYGWMMLGERQSYIIRKKLFHEYFNLPCSWFDKYRSDIMGE 132

Query: 227 LISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSAS 286
             ++L      V  S  +  +   ++L+  I  +G     S  L++++   TP ++  A 
Sbjct: 133 F-TQLHRCIEEVRSSSAEASAIMSQSLVAVIALIGTAFYFSWSLTLIIFCSTPFIIICAV 191

Query: 287 VFGKQI-RNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 345
           +F K I + T K+  E+     R+A   L  I+ V+    +  E+S Y   I    +   
Sbjct: 192 IFSKYIHKYTEKENTESECAAERLAW-MLKNIEFVRLHNGDDFEISMYTHYIAQANEYYI 250

Query: 346 XXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD-LTAF--MLYTEYTGNAVF 402
                         LL  L F+    +GS ++ Q +L+I   +T+F   L      N+  
Sbjct: 251 KASLFISANISILRLLSLLMFVQGFWFGSSMIKQGKLNIDSVITSFHCCLMLGSIINSAL 310

Query: 403 GLSTFYSEIMQGAGAASRLFELTDRKPS-----ISPTVGHKYQPERGVIEFKDVSFSYPT 457
           G +     + +G  A  RL ++ DR P      I    G    P    I F +VSF YP 
Sbjct: 311 GQAVV---LQKGDVAMKRLLKMIDRTPRESLAFIDAISGIDLLP----IVFNNVSFCYPE 363

Query: 458 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNC 517
           R + ++F  +NF I P     ++GPSG GKST+  L+L +Y+   G+IM+ + DI  +N 
Sbjct: 364 RKTDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINR 423

Query: 518 KSLRRQIGIVQQEPVLMSGTIRDNITYGLTYT--PTKEEIRSVAKQCFCHNFITKFPNTY 575
             +   I +V Q P L + TIR+NI     +T  P+K E+  + K     N I + P+  
Sbjct: 424 NIILENITLVSQTPTLFNDTIRNNILACSNWTNLPSKLEMECICKFALLENLIAELPDGL 483

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
           DT IG  G  LSGGQ Q++A+ARA  +  +IL+LDE  SA+D+     +     +    K
Sbjct: 484 DTRIGSGGIKLSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGK 543

Query: 636 SMTIVSIAHRLSTIRRSENVI 656
             T V I H L  IR ++N++
Sbjct: 544 --TTVIITHDLEFIRNTDNIL 562

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  171 bits (433), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 138/502 (27%), Positives = 231/502 (46%), Gaps = 23/502 (4%)

Query: 186  FGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSMT 243
            F +   L   SE  +  LR   I+K   QD  +F  D +K  ++ + + +D   +   ++
Sbjct: 808  FLKNFFLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDLRSLVS 867

Query: 244  QKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEAT 303
            + +S     +I   VG+        +LS++ +   P  +  +  +G  ++    D +   
Sbjct: 868  EFLSSISTLIIVSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTKV 927

Query: 304  GQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGD 363
             +L     E   GI T++    E   L +Y    + + +                + L  
Sbjct: 928  AELENQLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRAITIGFGVAASNTLTL 987

Query: 364  LSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420
                 +  YG  LV     S   + +    +L+T  T  ++ G      +I +G  AA+ 
Sbjct: 988  AVQAILFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAATY 1044

Query: 421  LFELTDR-----KPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGS 475
            +F + D      K        +K+  +  +I  K++SFSYP+ PS  I+K L   +  G 
Sbjct: 1045 IFRIIDNQSPAAKDEKKKIASYKFTHD-PLISVKNLSFSYPSAPSTAIYKGLKLDVFSGE 1103

Query: 476  SVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMS 535
            ++ +VG SG GKST+ LL+   Y    G+I ID  DI + +   LR  I +V+Q+P    
Sbjct: 1104 TIAVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQFFD 1163

Query: 536  GTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIA 595
            GT+ +N+ YG++   T+ +++         +F+   P   DT I    +L+SGGQ QR++
Sbjct: 1164 GTVGENLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDT--SLISGGQAQRLS 1221

Query: 596  IARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAHRLSTIRRSE 653
            IARA+++KP IL LDE TSALD  +  AI      L+K     +T + I H    +R  E
Sbjct: 1222 IARAMLRKPKILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMMRACE 1277

Query: 654  NVIVLGHDGSVVEMGKFKELYA 675
             + VL  +G V E G F +LYA
Sbjct: 1278 RIAVL-QNGKVAEDGSFDDLYA 1298

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 136/270 (50%), Gaps = 5/270 (1%)

Query: 444 GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
           G I FK+VSFSYPTRP+  + K+++       +  IVG SG GKSTI  LLL+ Y   TG
Sbjct: 367 GEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGKSTIGKLLLKSYGGYTG 426

Query: 504 TIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE-IRSVAKQC 562
            I +D  DI  +    L   I +V+Q   L + TI++NI  G       +  +R   +  
Sbjct: 427 AIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCKGKAYGDSLVREACQMA 486

Query: 563 FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                I   PN  DTV+G  G  LSGGQKQR+A+ARA ++   ILILDEA S +D+    
Sbjct: 487 LLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSPILILDEAISGMDIIHRD 546

Query: 623 AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALS 682
            +     +    K MT V + H L+ I   E+ +    +G + E G    L  N  S  +
Sbjct: 547 LLVEAIKKW--RKGMTTVIVTHELTQI-SDEDYLYFMEEGQIRESGFKCNLEKNENSHFN 603

Query: 683 QLLN-ERAAPGPSDQQLQIEKVEEKEDTNE 711
           +L   ++A  G S + +    +E+  +  E
Sbjct: 604 RLWRLQKAKTGFSRRSVSTSNLEKFPENAE 633

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  171 bits (432), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 136/512 (26%), Positives = 242/512 (47%), Gaps = 23/512 (4%)

Query: 178  LLIGCAA-----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLG 232
            ++IG A+     NF +  LL  +SE+ V +LR ++++  L +D  +   +K  ++ +   
Sbjct: 766  VVIGIASFDAVFNFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTM 825

Query: 233  SDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQI 292
            +D   +    +  +S      +   VG+     +  +L+++ L   P  +   +++G  +
Sbjct: 826  NDLRDLRNVTSILLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFV 885

Query: 293  RNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXX 352
            + +    + A  QL  +  E + G+KT++    E     RY    + + +          
Sbjct: 886  QKSEVQYKTAVSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYG 945

Query: 353  XXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIM 412
                  S L  L    +  YG  LV+  +     L        +T  +  GL +      
Sbjct: 946  SGLAITSCLVILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSS 1005

Query: 413  QGAGAASRLFELT-------DRKPSI---SPTVGHKYQPERGVIEFKDVSFSYPTRPSVQ 462
            +G  A + +F +        D   ++   +PT     +P   ++  + ++F+YP    VQ
Sbjct: 1006 RGQRAGTFVFGMLEEPLPEPDNYSAVLRKAPTNHFSREP---LVVLRALNFAYPAAKDVQ 1062

Query: 463  IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRR 522
            I+K+ N +I  G+ V IVG SG GKST+  L+   Y     ++ ID  DI      +LR+
Sbjct: 1063 IYKNFNLRINQGTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRK 1122

Query: 523  QIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPH 582
             I +V+Q+P   +GTIR+N+ YGL  T T  EI  V  +    NF+   P   +T +  +
Sbjct: 1123 IIAVVEQKPRFFNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN 1182

Query: 583  GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 642
              L+SGGQ QR++I RAL+++PT+LILDE TSALD  +  AI       +    +T++ I
Sbjct: 1183 --LVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVI 1238

Query: 643  AHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
             H    ++  + ++VL  +G+V E G F +L+
Sbjct: 1239 THSKQMMKMCDRIVVL-KNGAVAEDGSFDDLF 1269

 Score =  129 bits (324), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 133/540 (24%), Positives = 241/540 (44%), Gaps = 38/540 (7%)

Query: 194 ILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL--ISRLGSDAYVVSRSMTQKVS---- 247
           +L ER   R+R  +++  L +  +++D  K+ D+  +  + +     +R+   + S    
Sbjct: 97  LLGERQSLRIRRELLRSYLAKPMQWYD--KIDDINGMYTITNRCVEEARASCAEASGVLF 154

Query: 248 -DGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQL 306
              V ALI  +         S +L+++ L   P +     VF K ++  +    E T   
Sbjct: 155 QSAVTALILAVTAF----KFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENEQTSSA 210

Query: 307 TRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSF 366
           +      L+    V+ F  +  EL ++N A+    +                  L  + F
Sbjct: 211 SSTLSWALNSATMVKLFGTQDLELRKFNKAVNLSKKYFVRTLICSSINQAAMRFLSLMMF 270

Query: 367 LTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD 426
           +    YGS L+ + ++    +      +    +++  + +    + +G  A  ++ E  +
Sbjct: 271 VQAFWYGSILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQIAEAVN 330

Query: 427 RKPSISPT-------VGH----KYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGS 475
            +P   P        VGH    + QP    I F  VSF+YP RP  +    ++    P  
Sbjct: 331 VEPEGRPNQYAFPYEVGHIIALEDQPSE--IVFDQVSFNYPARPDTKALDGVSLTFRPNQ 388

Query: 476 SVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMS 535
              IVG SG GKST+  LLL++Y+   G I +++ ++  ++   L + I +V+Q   L +
Sbjct: 389 ITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCTLFN 448

Query: 536 GTIRDNITYGLTYTPTKEEIRSVAKQC---FCHNFITKFPNTYDTVIGPHGTLLSGGQKQ 592
           GT+ +NIT  L+  P  +   +V + C        +   P    T +G  G  +SGGQ+Q
Sbjct: 449 GTLFENIT--LSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGGQQQ 506

Query: 593 RIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 652
           R+A+ARA+++   +LILDEA SALD+     +          K+  I++  H LS +   
Sbjct: 507 RVALARAILRDAPVLILDEAISALDIIHRDLLMEVIRSWRADKTTIILT--HELSHVLDD 564

Query: 653 ENVIVLGHDGSVVEMGKFKELYANSTS---ALSQLLNERAAPGPSDQQ-LQIEKVEEKED 708
           + + ++ H G V+E G   EL +N  S   AL++L N +      +++   IE   E+ED
Sbjct: 565 DYLYMMEH-GQVIEQGYKSELLSNPNSRFRALNRLQNSKNERALEERRSFAIENKLEQED 623

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  167 bits (423), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 129/444 (29%), Positives = 212/444 (47%), Gaps = 27/444 (6%)

Query: 252 ALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTS------KDLQEATGQ 305
           +++CGI+      S +       + FT  +L+S  +F   IR T+      K+  +A  +
Sbjct: 272 SVVCGILTYQFGASFAG------ITFTTMLLYS--IF--TIRTTAWRTRFRKEANKADNK 321

Query: 306 LTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS 365
              VA + L   + V+ F  E    ++Y+ ++                     SL+   +
Sbjct: 322 GASVALDSLINFEAVKYFNNESYLANKYHNSLIKYRDSQVKVAQSLAFLNSGQSLIFTTA 381

Query: 366 FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 425
              ++  G   V+   L++GDL             +  L + Y E+ Q       LF+L 
Sbjct: 382 LTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLR 441

Query: 426 DRKPSIS-----PTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 480
             +  I       ++     P    I+F++V+F Y  +   +I K+ +F I  G    I 
Sbjct: 442 KNQVKIQNCSQPKSISKSDGPFE--IKFENVTFGYDGQR--KILKNASFTIPAGMKTAIA 497

Query: 481 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRD 540
           GPSG GKST+  L+ R+Y+P  G ++++  D+ + +   LR+ IG+V Q+  L + TI +
Sbjct: 498 GPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQDTPLFNDTIWE 557

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600
           N+ +G     + EEI  V  +    + I K P    T++G  G ++SGG+KQR+AIAR L
Sbjct: 558 NVKFG-RIEASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISGGEKQRLAIARVL 616

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660
           +K   I+  DEATSALD  +E ++  T  +   S   T V IAHRL TI  ++ +IVL  
Sbjct: 617 LKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRTIADADKIIVL-E 675

Query: 661 DGSVVEMGKFKELYANSTSALSQL 684
           +G+V E G  +EL A   S   +L
Sbjct: 676 EGTVREEGTHQELLARENSLYKEL 699

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  167 bits (423), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 131/510 (25%), Positives = 242/510 (47%), Gaps = 29/510 (5%)

Query: 185  NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSM 242
            NF +  +L   SE  +  LR  +++    +  E++   ++K  ++ +   +D   +   +
Sbjct: 739  NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEISALALNDLRDLRTLV 798

Query: 243  TQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEA 302
            T+ +S     +   ++G+    +   +LS++ +   P ++  + ++G  ++N     + A
Sbjct: 799  TEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIYGTVLQNYETSYKSA 858

Query: 303  TGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLG 362
               L  +  E ++ IKT++      + L  Y+   + + ++               + + 
Sbjct: 859  VADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRTIVTGLGLSMLTTIT 918

Query: 363  DLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYS------EIMQGAG 416
                  +  YG  LVL      G+ T+  ++  +T   +F ++T  S      ++ +G  
Sbjct: 919  TCIQSILYYYGLKLVLT-----GEYTSKTMFQTFTL-VLFTVTTCNSLVSQIPDVSRGQR 972

Query: 417  AASRLFELTDRKPSISPTVGHKYQPER--------GVIEFKDVSFSYPTRPSVQIFKSLN 468
            AAS +  + D         G   + E          +IE ++++F YP  P V +++ LN
Sbjct: 973  AASWVLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPNTPGVNVYQDLN 1032

Query: 469  FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQ 528
             KI  G ++ +VG SG GKST+  LL + Y+     I+I+  DI   +   LR +I +V+
Sbjct: 1033 LKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDILRAEICVVE 1092

Query: 529  QEPVLMSGTIRDNITYGLT-YTPTKE-EIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
            Q+P L  GTIR+NITYG++   P  E E++ + +    H F+   P   DTV+     LL
Sbjct: 1093 QKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTVVDIG--LL 1150

Query: 587  SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA--H 644
            SGGQ QR+ I R L++KP +LILDE TS+LD ++   +      L       I++I   H
Sbjct: 1151 SGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIKDLNTKLGWDILTIVITH 1210

Query: 645  RLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
                ++    ++VL   G VVE G+F +L+
Sbjct: 1211 NRQMMQCCSRLVVLDV-GRVVEDGQFDDLH 1239

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 129/540 (23%), Positives = 253/540 (46%), Gaps = 43/540 (7%)

Query: 195 LSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI 254
           L ER   R+R+ ++++ L +  E++D      L   L  D   ++R M +  S   +A  
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYD------LKENLAGDFTQLNRCMEELRSGSAEASA 146

Query: 255 C----GIVGVGMMC---SLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLT 307
                 +  + ++C     S QL++++L  +P ++  A+ F + I+  +    + T    
Sbjct: 147 VTYQNCVAIIALICVSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAAA 206

Query: 308 RVAEEQLSGIKTVQSFVAEGNELSRYNVAI---RDIFQVGXXXXXXXXXXXXXXSLLGDL 364
            +    +   +TV+    +  E+ ++   +    D F                 + +G L
Sbjct: 207 DLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKCNDYF---------IRTSLFTAANIGIL 257

Query: 365 SFLTV------LAYGSYLVLQSQLSIGD-LTAFMLYTEYTGNAVFGLSTFYSEIMQ-GAG 416
            FLT+        +GS ++ + +L+I D +T F  Y+     ++   +  +   +Q G  
Sbjct: 258 RFLTLSMFVQGFWFGSTMIRKGKLNISDVITCF--YSCLMLGSILNTTLHHVIFIQKGQV 315

Query: 417 AASRLFELTDRKPSI-SPTVGHKYQPERGV-IEFKDVSFSYPTRPSVQIFKSLNFKIAPG 474
           A +++ +  +  P + S T+         V I   +++F+YP+RP+  + K+++ KI   
Sbjct: 316 ALAKIQKFINESPELPSKTLTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSA 375

Query: 475 SSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLM 534
            +  IVG SG GKSTI  L++++Y    G I++ ++DI  +    L + I +V+Q   L 
Sbjct: 376 RTTFIVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLF 435

Query: 535 SGTIRDNITYGLTYTPTKEE---IRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQK 591
           + T+++NI  G  YT        + S+       + I+  P+  +T +G  G  LSGGQ+
Sbjct: 436 NDTLKNNILLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQ 495

Query: 592 QRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR 651
           QR+A+ARA ++   ILILDEA SALD+     +     ++ ++K+  I++  H L+ I  
Sbjct: 496 QRVALARAFLRDTDILILDEAVSALDIMQREILMRNISKVRQNKTTIILT--HDLNQIND 553

Query: 652 SENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQLQIEKVEEKEDTNE 711
           ++  I L  +  + E G  K L  +  +    + N +     +D +     + +K++  E
Sbjct: 554 ND-YIYLFENNEIKENGFKKTLMNDENTLFYNMYNLQRNAAITDSRASSPTIYDKDEVYE 612

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 138/510 (27%), Positives = 243/510 (47%), Gaps = 21/510 (4%)

Query: 176  VALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGS 233
            V++  GC     +FIL  + SE  +  LR   + +  +QD  +F  D +K  ++ + + +
Sbjct: 799  VSVTDGCFTFLKKFIL-SVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILN 857

Query: 234  DAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIR 293
            D   +   ++  +S     +    +G+        +LS++ +   P  +    ++G  ++
Sbjct: 858  DLRDLRYLVSGFLSAVTTLIFVSAIGLAWAFVSGWKLSLVCISTIPLFIGVTGIYGGVLQ 917

Query: 294  NTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXX 353
                D + A  +L     E + GIKTV+    E +  ++Y +    +             
Sbjct: 918  KYETDYKTAVAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGF 977

Query: 354  XXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT---AFMLYTEYTGNAVFGLSTFYSE 410
                 + L       +  YG  LV+  + +  +L      +++T  T +A+      +S 
Sbjct: 978  GVALSNALVIGVQAILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFS- 1036

Query: 411  IMQGAGAASRLFE-LTDRKPSISPTVGHKYQP------ERGVIEFKDVSFSYPTRPSVQI 463
              +G  AA+ +F  L  R   +S     + +P         +I  +D++F+YP+   V++
Sbjct: 1037 --RGRRAATYVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSALDVEV 1094

Query: 464  FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQ 523
            +K L+  I  G ++ IVG SG GKST+ L+L   Y     T+ ID+ DI K N  SLR+ 
Sbjct: 1095 YKKLSLTINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSSLRKH 1154

Query: 524  IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
            I +V+Q+     G+IRDN+ YGL    T  +I  V       +F+ + P   +T I  + 
Sbjct: 1155 ISMVEQKAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRIDTN- 1213

Query: 584  TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 643
             L+SGGQ QRI+I RAL+++P +LILDE TS+LD ++  AI    G  +    +T + I 
Sbjct: 1214 -LISGGQAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSL--YGITTIVIT 1270

Query: 644  HRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            H  + + +S N I+   +G + E G F+EL
Sbjct: 1271 HN-TQMMKSCNRILFFKNGRISEEGTFQEL 1299

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 129/571 (22%), Positives = 244/571 (42%), Gaps = 67/571 (11%)

Query: 182 CAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRS 241
           C A    ++LL    ER   R+R  ++   L +   ++D ++       L  D   + R 
Sbjct: 92  CWATLSSWMLL---GERQGFRVRRRLLGAYLSKTMAWYDTNE------NLEGDFTQIHRG 142

Query: 242 MTQKVSDGVKA----LICGIVGVGMMCS---LSPQLSILLLFFTPPVLFSASVFGKQIRN 294
           + +  S   ++     +  +  V ++ +    S  L++++L  TP ++  A +F K +  
Sbjct: 143 VEELRSSAAESSAVTFLNAVTVVTLLTTSLYFSWSLTLVILASTPLIIALAIIFSKLVEK 202

Query: 295 TSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXX 354
            ++     T     +    +   + ++ F  E  EL +++++++   +            
Sbjct: 203 YTELENTETSHAASILTWSMEAPQLIRLFGTEQVELQKFSISVKKCSKFFINLSKYAAAN 262

Query: 355 XXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD-LTAFMLYTEYTGNAVFGLSTFYSEIMQ 413
                 L  + F+    +G+ ++ + +L+ G  +T F        +A   L T  +  +Q
Sbjct: 263 QASLRGLSLIMFVQGFWFGNTMIKRGKLNSGQVITCF--------SACILLGTTLNNTLQ 314

Query: 414 -------GAGAASRLFELTDRKP-SISPTVGHKYQ----PERGV---------IEFKDVS 452
                  G  A  ++  + + +  ++    G  ++    P  G+         I F++VS
Sbjct: 315 HIVIMQKGKVALQKILSMVESESDALRGRRGETFEIFPSPISGMFVSPVFPKQITFENVS 374

Query: 453 FSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDI 512
           FSYP+RP+     +++    P     IVG SG GKST++ LLL+ Y+   GTI +   DI
Sbjct: 375 FSYPSRPNEYALDNVSLTFYPEKITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDI 434

Query: 513 TKLNCKSLRRQIGIVQQEPVLMSG--------TIRDNITYGLTYTPTKEEIRSVAKQCFC 564
                  L   I +V+Q   L +         T +D+          +  I+   +    
Sbjct: 435 RATKDSWLLENITLVEQSCTLFNDSLLNNLLLTAKDD-------NKNEASIKRACQMALL 487

Query: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
              +   P+   TVIG +G  LSGGQ+QR+A+ARA+++   +LILDE+ SALD+     +
Sbjct: 488 EKLLFDLPDGLSTVIGSNGISLSGGQQQRVALARAILRDTPVLILDESISALDIIHRDLL 547

Query: 625 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
                     K+  I++  H LS I   ++ + L  DG V E G  ++L + ++   ++L
Sbjct: 548 MEVIRNWRAGKTTIILT--HELSHI-LDDDYLYLMEDGKVGEHGYKRDLLSYTSGRFTEL 604

Query: 685 LNERAAPGPSDQQLQIEK---VEEKEDTNEG 712
            N      PS  +   EK   +  +E T  G
Sbjct: 605 HNAVIPSDPSAIEASHEKAIRLNTEETTGSG 635

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1271

 Score =  162 bits (411), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 138/241 (57%), Gaps = 4/241 (1%)

Query: 444 GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
           G IEF+DVSF+YPTRP   + K+++ KI  G++  IVG SG GKST+A LLL+ Y   TG
Sbjct: 355 GDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTG 414

Query: 504 TIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
            I     +I  L+   L   I +V+Q   L +GT++DN+T    Y     E++   +   
Sbjct: 415 EIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTLKDNLTIVNKYASCT-EVKQACQFAL 473

Query: 564 CHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGA 623
            +  +   PN  DT++G HG  LSGGQ+QR+A+ARA ++   +LILDE+ SALD+ S   
Sbjct: 474 LNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSREL 533

Query: 624 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQ 683
           I        K K+  I++  H  + I+  E V ++  +G+VVE G   +L  N  S  +Q
Sbjct: 534 IVEAIRHWRKGKTTIILT--HEYTQIKDDEYVYLMS-EGTVVESGFKYDLLENPDSYFAQ 590

Query: 684 L 684
           L
Sbjct: 591 L 591

 Score =  156 bits (395), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 133/505 (26%), Positives = 244/505 (48%), Gaps = 23/505 (4%)

Query: 184  ANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFD--NHKVGDLISRLGSDAYVVSRS 241
            + F +  +L   SE  + RLR   + K   +  ++F    +   +L S + +D   + R 
Sbjct: 761  STFLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDLRDL-RG 819

Query: 242  MTQKVSDGVKALICGIVGVGMMCSL--SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDL 299
            +  +    +  L+  +  +G++ +L    +LS++ +   P  +  + ++G  ++      
Sbjct: 820  LASEFLSAITTLVF-VASIGLIWALVSGWKLSLVCISLFPAFILFSGIYGSLLQVYETAY 878

Query: 300  QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 359
            +    +L     E +  +KT++    + +    +   +  +  V               +
Sbjct: 879  KTEIAELETRVHELVISMKTIKLLQLQQHFEGSFKTQLAKVRIVCKKRSVAVGFGIAVTN 938

Query: 360  LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 419
             L  +    +  +G  LV+Q + S+  +        ++      L     EI +G  AA+
Sbjct: 939  ALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQVPEISRGQRAAT 998

Query: 420  RLFELTDRKPSIS-----PTVGHKY---QPERGVIEFKDVSFSYPTRPSVQIFKSLNFKI 471
             +F++ +   S+      P+    +      R  I+  ++SF++ + P  +IF SL+ +I
Sbjct: 999  YIFKVLEDSGSVDTSKPDPSQNQSFFSTAGNRETIKISNLSFAFSSAPMNKIFNSLSCEI 1058

Query: 472  APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEP 531
                +V IVG SG GKST++LLL R Y   +G + I   DI K +  +LRR I IV+Q+P
Sbjct: 1059 CLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQKP 1118

Query: 532  VLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQK 591
                GT+R+N+ YGL    +  E+RSV K     +F+   PN  +T +  H  L+SGGQ 
Sbjct: 1119 KFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRV--HDGLMSGGQA 1176

Query: 592  QRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS--KSMTIVSIAHRLSTI 649
            QR++IAR L+++P I+ILDE TSALD  +  AI     +L+++  K++T++ I H    +
Sbjct: 1177 QRLSIARTLLRQPKIIILDECTSALDAANSFAI----AELIRTVLKNVTVIVITHSEQLM 1232

Query: 650  RRSENVIVLGHDGSVVEMGKFKELY 674
            +  + V+VL   G V E G + EL+
Sbjct: 1233 QICDRVLVL-KKGKVKEEGSYAELF 1256

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 161/572 (28%), Positives = 259/572 (45%), Gaps = 84/572 (14%)

Query: 154  DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLH 213
            D F  + P F + LY F  FF+  L     + F     + +LS + +  LRA  +K+ LH
Sbjct: 956  DKFKNRAPSFYMGLYSFFVFFSYIL---TTSQFTLLCCIGVLSSKWL-NLRA--VKRILH 1009

Query: 214  QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGIVGVGMMCSLS-PQ 269
                + D   +G +++R   D    + S+  ++++ V+ L+     IVGV +MC +  P 
Sbjct: 1010 TPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRMLLYQFANIVGVCIMCIIYLPW 1065

Query: 270  LSILLLFFTPPVLFSASVF-GKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSFV 324
             +I +     P LF   V      +++ ++++  EA  +  +     E L G+ T++S+ 
Sbjct: 1066 FAIAI-----PFLFVGFVLIADHYQSSGREIKRLEAIQRSFVYNNFNEVLGGMDTIKSYR 1120

Query: 325  AEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ----- 379
            +E   +++ +  I  + + G                     FL V+A    L++      
Sbjct: 1121 SENRFIAKSDFLIDKMNEAGYLVVAVQRWVAI---------FLDVIAVCFALIITLLCVT 1171

Query: 380  -----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG-----AASRLFELTDRKP 429
                 S  S+G L  ++L      N V    T     M  A      A     E   RKP
Sbjct: 1172 RAFPISAASVGVLLTYVLQLPGLLNGVLRSLTQTENDMNSAERLVTYATELPLEADYRKP 1231

Query: 430  SISPTVGHKYQPERGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKS 488
             +SP    +  P +G I F++V FSY P  P+V   K+L+  I  G  + I G +G GKS
Sbjct: 1232 EVSPP---EEWPTKGEIHFENVDFSYRPGLPTV--LKNLSLDIKSGEKIGICGRTGAGKS 1286

Query: 489  TIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDN------- 541
            TI   L R    ++G ++ID+ DI+ +    LRR++ I+ Q+PVL  GTIR N       
Sbjct: 1287 TIMSALYRLNEISSGKMIIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEH 1346

Query: 542  ---------ITYGLTYTPTKEEIRSVA-KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQK 591
                     +  G        EI++    +   H+ + KF    D ++   G   S G++
Sbjct: 1347 QDEHLWNALVRGGAIEQKELNEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGANFSLGER 1404

Query: 592  QRIAIARALIKKPTILILDEATSALDVESEGAINY----TFGQLMKSKSMTIVSIAHRLS 647
            Q +A+ RAL+++  ILILDEATS++D E++G I       FG        TI+ IAHRL 
Sbjct: 1405 QLLALTRALVRQARILILDEATSSVDYETDGKIQARIVEEFGHC------TILCIAHRLK 1458

Query: 648  TIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
            TI   + ++VL   G V E    K L+A   S
Sbjct: 1459 TILTYDRILVL-EKGEVAEFDTPKTLFAQEDS 1489

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 115/222 (51%), Gaps = 20/222 (9%)

Query: 464 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           F  LNF+I  G  + +VGP G GK+++      + N  +G I I N D+  L C      
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQI-NGDL--LLCGY---- 701

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
                  P + + +++DNI +G  Y   K +   V + C   + +   P    T IG  G
Sbjct: 702 -------PWIQNASVKDNIIFGSPYNKAKYD--EVIRVCSLKSDLDILPAGDLTEIGERG 752

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++  F  L+K K+  + + 
Sbjct: 753 ITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDKTRILAT- 811

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
            H+LS + R+  VIVLG+DGS  ++G  +EL   S++ ++ L
Sbjct: 812 -HQLSLLERASRVIVLGNDGS-FDIGTVEELKQRSSTLVNLL 851

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 137/520 (26%), Positives = 235/520 (45%), Gaps = 36/520 (6%)

Query: 168  YEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHK---- 223
            + FL  FT++    C  N+ R +           RLRA   K   +++  +F++ +    
Sbjct: 789  FTFLKCFTLS---KCGENWIRAL-----------RLRA--FKNISNRELAWFNSEQNSTS 832

Query: 224  -VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVL 282
             V  L+     D   ++      V+  V    CG++      +   +LS++ +   P  +
Sbjct: 833  NVSSLVINDLRDLRALASEFLAAVTTLVVVSFCGLI---WALASGWKLSLVCISLIPAFI 889

Query: 283  FSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQ 342
                 +G  ++    + + A   +       +  IKT++    E   +  Y V       
Sbjct: 890  LFTGAYGGLLQKCEANYKSAVASMEDQLYSAVRRIKTIRCLQVEERVIKEYEVLEGKAKL 949

Query: 343  VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVF 402
             G              + L  ++   +L YG  LV+  + S   +   +    +T     
Sbjct: 950  AGRKRALGTGFGVALSNALTLITQSILLYYGMKLVITGEYSSERMFQTLTLLLFTIMTCM 1009

Query: 403  GLSTFYSEIMQGAGAASRLFELTDRKPSISPT--VGHKYQPERG-----VIEFKDVSFSY 455
             L     EI +G  AA+ LF + D +   +     G      RG     +I  KD+ FSY
Sbjct: 1010 SLIAQIPEISRGQRAATYLFRILDSETQFADANLEGESALTSRGCSNEALIFIKDLRFSY 1069

Query: 456  PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKL 515
                +  +++ LN  +  G +V +VG SG GKST+  L+ R Y   +G+I  D  D+ + 
Sbjct: 1070 SFLNNPMVYRGLNLSVKAGETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEW 1129

Query: 516  NCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY 575
               +LR++I +V+Q P L  G+I DN+TYGL+ +  + EIR + +     +F+   P   
Sbjct: 1130 EEWALRKRIAVVEQRPSLFRGSIFDNLTYGLSTSVDEREIRELLELVGMMDFVNSNPLGL 1189

Query: 576  DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
             + I     +LSGGQ QR+AI RAL++KP +L+LDE TSALD +  G I   F +   S+
Sbjct: 1190 QSFIDTD--VLSGGQLQRLAIVRALLRKPQLLVLDECTSALDAQ-HGFIMSEFVR-QGSQ 1245

Query: 636  SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYA 675
            S T + + H    + R+ N I+   +G+++E G F+ LY+
Sbjct: 1246 STTTLVLTHS-EQMMRACNRILTFANGNIIEDGSFERLYS 1284

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 130/507 (25%), Positives = 224/507 (44%), Gaps = 27/507 (5%)

Query: 195 LSERVVARLRAHVIKKTLHQDAEFFD-NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 253
           L ER   RLR  +++  L +   ++D N ++    ++L      +  S  +  +   + +
Sbjct: 99  LGERQAFRLRRKMLQSYLDKSMAWYDANEQISGDFTQLNRCVEELRSSSAESSAIVFQNV 158

Query: 254 ICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
           +     +G     S  L+++++  +P V+  A  F +++   +K     T          
Sbjct: 159 VTVAALLGSALYYSWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMAWS 218

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
           L   K V+    +  EL+R+   ++   Q                  L    F+    YG
Sbjct: 219 LDAAKMVRLLGTQDRELARFEACVQKCRQHFNKMSLFSSLNYSVLRFLTLCMFVQGFWYG 278

Query: 374 SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ------GAGAASRLFELTDR 427
           +     S+++IG L    + T ++ + V   ST  S + Q      GA    ++    + 
Sbjct: 279 N-----SRINIGKLKPGDVVTCFS-SCVLLASTLNSTLHQIIILQKGAVGLQKIMAFVNS 332

Query: 428 KPSISPTVGHKYQ---------PERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVC 478
           + + S +  +K +          ER  I F++V F+YPTRP   + K ++     G +  
Sbjct: 333 RDA-SESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTF 391

Query: 479 IVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTI 538
           ++G SG GKSTI  LLL +Y   +GTI ++ QD+ ++N   L R I +V+Q   L + T+
Sbjct: 392 VIGKSGSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTETL 451

Query: 539 RDNITYGLTYTPTKE-EIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIA 597
            +N+T G       E  ++   +     N I       +T IG  G  LSGG++QR+A+A
Sbjct: 452 ANNVTIGEAGVDDDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVALA 511

Query: 598 RALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIV 657
           RA  +   ILILDEA SA D   +  +     +    K+  I++  H LS I  ++ V V
Sbjct: 512 RAYFRNAPILILDEALSAQDRIHKSLLMEAIRKWRADKTTIILT--HELSDILDTDYVYV 569

Query: 658 LGHDGSVVEMGKFKELYANSTSALSQL 684
           +  DG + E G    L +N  S  S L
Sbjct: 570 MS-DGQIREHGYKSGLLSNPKSEFSNL 595

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  157 bits (398), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 156/554 (28%), Positives = 250/554 (45%), Gaps = 66/554 (11%)

Query: 163  FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 222
            F + LY   SFF  A   G      +F LL  +  R    L    + + LH    + D  
Sbjct: 950  FYMGLY---SFFVFA---GYLFTSSQFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTT 1003

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGIVGVGMMCSLS-PQLSILLLFFT 278
             +G +++R   D    + S+  ++++ ++ ++     IVGV +MC +  P  +I +    
Sbjct: 1004 PLGRILNRFTKD----TDSLDNELTESIRLMLFQTANIVGVCVMCIIYLPWFAIAI---- 1055

Query: 279  PPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
            P +    ++     ++T ++++  EA  +  +     E L G+ T++S+ +E   L++ +
Sbjct: 1056 PFLFIGFTLITDHYQSTGREVKRLEAIQRSFVYNNFNEILGGMDTIKSYGSEERFLAKSD 1115

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLG-DLSFLTVLAYGSYLVLQSQLSIGDLTAFMLY 393
              I  + + G               L+    + +  L   +     S +S+G L  ++L 
Sbjct: 1116 YLINKMNEAGYLSVALQRWVAIFLDLVAVCFALIITLLCVTRAFHISAVSVGVLLTYVLQ 1175

Query: 394  TEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTVGHKYQPERGVIEF 448
                 N V    T     M  A      A+ L  E   R+P +SP    +  P  G IEF
Sbjct: 1176 LPGLLNGVLRALTQTENDMNSAERLVSYATELPLEAAYRRPEVSPP---ENWPSEGKIEF 1232

Query: 449  KDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI 507
            K V FSY  RP + I  K L+  I  G  + I G +G GKSTI   L R    + G I+I
Sbjct: 1233 KHVDFSY--RPGLPIVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEILI 1290

Query: 508  DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE---------IRSV 558
            DN DI+KL    LRR++ I+ Q+PVL  GTIR N+       P  E          +R  
Sbjct: 1291 DNVDISKLGLYDLRRKLAIIPQDPVLFRGTIRKNL------DPFNEHDDDLLWDSLVRGG 1344

Query: 559  AKQCFCHNFITK------------FPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTI 606
            A +    N I              F    D ++   G   S G++Q +A+ RAL+++  +
Sbjct: 1345 AIERAALNKIKNQKVDKDGTHADMFKFHLDQLVEEEGANFSLGERQLLALTRALVRQAKV 1404

Query: 607  LILDEATSALDVESEGAINYTFGQLMKS-KSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 665
            LILDEATS++D E++G I     +++K     TI+ IAHRL+TI   + ++VL   G V 
Sbjct: 1405 LILDEATSSVDYETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRILVL-EKGEVA 1460

Query: 666  EMGKFKELYANSTS 679
            E  K K L+    S
Sbjct: 1461 EFEKPKVLFDQEDS 1474

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 108/223 (48%), Gaps = 20/223 (8%)

Query: 464 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           F  +   I  G  + +VGP G GK++    L  + N T G I + N D+  L C      
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQV-NGDL--LLCGY---- 679

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
                  P + + T+RDNI +G  Y   K E   V + C     +   P    T IG  G
Sbjct: 680 -------PWIQNATVRDNILFGSPYDKKKYE--EVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK RI +AR + KK  I + D+  SA+D    +  ++  F  L+K+++  + + 
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNETRILAT- 789

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLL 685
            H+LS + R+  VIVLG DGS  E+G    L   + + ++ LL
Sbjct: 790 -HQLSLLERASRVIVLGTDGS-FEIGPVDVLKRTNQTLINLLL 830

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  154 bits (390), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 136/518 (26%), Positives = 241/518 (46%), Gaps = 47/518 (9%)

Query: 171  LSFFTVALLIGCA-ANFGRFILL--RILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            + + ++  LIG A A  G   +L    L  +   ++   ++KK +H    FFD+  +G +
Sbjct: 1106 MYYLSIYFLIGIAQALLGSLKVLINFFLGVKASRKIFIDLLKKVMHSKLRFFDSTPIGRI 1165

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ-LSILLL-----FFTPPV 281
            ++R   D   + + +   V     +L+  +  + ++  ++PQ LS+ +L     +     
Sbjct: 1166 MNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTILLITFITPQFLSVAILVTGLYYLIGYF 1225

Query: 282  LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEG----NELSRYNVAI 337
              +AS   K+  + +K        + +   E L G+ T+++F  EG      LS+ +   
Sbjct: 1226 YLAASREFKRFDSITK------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLSKIDENN 1279

Query: 338  RDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-SQLSIGDLTAFMLYTEY 396
            R  F +               +L+       V   GS+++     +  G     + Y   
Sbjct: 1280 RPFFYLWVANRWLSFRIDMVGALV-------VFGSGSFIIWNIKNIDAGMAGISLTYAIS 1332

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISPTVGHKYQ-PERGVIEFKDVSF 453
                   L   YS +     +  RL E    +++P    T     + P+ G IE  D+S 
Sbjct: 1333 FTEGALWLVRLYSNVEMNMNSVERLKEYMKIEQEPYEDATCTPPPEWPQEGKIEVCDLSL 1392

Query: 454  SYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 513
             Y      ++ K++ F +AP + + IVG +G GKSTI   L R+ +P TG I IDN DIT
Sbjct: 1393 RY-AEGLPRVIKNVTFTVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNIDIT 1451

Query: 514  KLNCKSLRRQIGIVQQEPVLMSGTIRDNIT-YGL-----TYTPTK------EEIRS-VAK 560
             +N   LRR I I+ Q+P L +GTI+ N+  YG       +T  +      E++ S +  
Sbjct: 1452 SINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIET 1511

Query: 561  QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
            +      + KF N  +  I   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S
Sbjct: 1512 ESISSQNVNKFLN-LNNEISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASIDYNS 1570

Query: 621  EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
            +  I  T  +  +  S TI++IAHRL ++   + ++V+
Sbjct: 1571 DAKIQETIRK--EFNSSTILTIAHRLRSVIDYDKILVM 1606

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 135/548 (24%), Positives = 235/548 (42%), Gaps = 66/548 (12%)

Query: 170 FLSFFTVALLIGCAANFGRFILLRI----LSERVVARLRAHVIKKTLHQDAEFFDNHKV- 224
           FLS   V++  G A   GR + +RI    +SE     LR  V  K+    AE  D   V 
Sbjct: 412 FLSRILVSICEGQALFLGRRVCIRIKSIVISEIYNKALRRKVSVKSNKVSAEDLDPQDVN 471

Query: 225 -------------------GDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCS 265
                              G +I+ +  DA+ VS  +   +   V+A +  I+ + ++  
Sbjct: 472 EQKHIDGDEESSDPSSANLGGIINLMAVDAFKVSE-VCAYLFAFVEATVMAIISLTLLYR 530

Query: 266 L--SPQL--SILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLT--RVAE--EQLSGI 317
           L  S  +  +I++L   P   + A++ GK        +Q+AT  +T  R+ +  E L  I
Sbjct: 531 LIGSSAIIGTIVILIAAPANYYFATLLGK--------IQKATLLVTDKRIQKLNESLQAI 582

Query: 318 KTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL--SFLTVLAYGSY 375
           + ++ F  E N    +  +I D+ +                S +  +  S +T  A+  Y
Sbjct: 583 RIIKFFSWEDN----FEKSINDVREQELQLLLKRSMAWVCSSFVWFVTPSLVTAAAFAFY 638

Query: 376 LVLQSQLSIGDL--TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL---TDRKPS 430
           + +Q ++    +  TA  L+T    N +  LS   S ++Q   +  R+ +    TD    
Sbjct: 639 IYVQKEVLTTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRIRDFLLETDTAKY 697

Query: 431 ISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI 490
              TV     P+   +EFK+ + S+ +       K LN     G    ++GP+G GK+++
Sbjct: 698 DQLTVA----PQGDQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSL 753

Query: 491 ALLLLRYYNPTTGTIMI---DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLT 547
            + LL       G I++   D ++   ++       I    Q   L++ T+R+NI +   
Sbjct: 754 LMALLGEMKIMEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFNSP 813

Query: 548 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTIL 607
           Y   +    SV + C              T IG  G  LSGGQKQR+++ARA+      +
Sbjct: 814 YNEAR--YTSVIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHI 871

Query: 608 ILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 665
           +LD+  SA+D  +   I  N   G LM  ++  +VS  H ++   ++ +++V+  DG V 
Sbjct: 872 LLDDCLSAVDSHTALWIYDNCITGPLMDGRTCILVS--HNIALTLKNADLVVILEDGKVK 929

Query: 666 EMGKFKEL 673
           + G   EL
Sbjct: 930 DQGDPMEL 937

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 134/493 (27%), Positives = 226/493 (45%), Gaps = 45/493 (9%)

Query: 202  RLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVG 261
            R+   ++ K LH    F D+  +G +++R   D   V + +T  +      L+  I  + 
Sbjct: 1141 RIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTII 1200

Query: 262  MMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGI 317
            ++  ++PQ     LF    V     + G    NTS++L+         + +   E L+G+
Sbjct: 1201 LITFITPQF----LFVAVLVCVLYYLVGYFYINTSRELKRIESITKSPIYQHFSETLTGV 1256

Query: 318  KTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV 377
             T+++F   G+E+      +  I +                  +  +  L +   G +++
Sbjct: 1257 ATIRAF---GDEIRFIMHNLEKIDENNKPFFYLWVANRWLAFRIDMIGALIIFGSGVFIL 1313

Query: 378  LQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD--RKPS 430
            L      S ++   LT  + +TE        L  FYS +     +  RL E  D  ++P 
Sbjct: 1314 LNLNRIDSGMAGISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYMDVPQEPY 1369

Query: 431  ISPTVG-HKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKST 489
               T+      P  G IE KD+S  Y      ++ K ++F I P + V IVG +G GKST
Sbjct: 1370 NEGTITTSTNWPTEGKIEVKDLSLRYAENLP-RVIKEVSFDIEPHNMVGIVGRTGAGKST 1428

Query: 490  IALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYT 549
            I   L R+  P TG+I ID  DIT ++ ++LRR I I+ Q+P L +GTIR N+     Y 
Sbjct: 1429 IITALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNLDPFGKY- 1487

Query: 550  PTKEEIRSVAKQCFCHN----------------FITKFPNTYDTVIGPHGTLLSGGQKQR 593
            P +E  R + +     +                 + KF N  +  I   G  LS GQKQ 
Sbjct: 1488 PDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLNL-ENEITEGGNNLSQGQKQL 1546

Query: 594  IAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 653
            + +ARAL++ P +++LDEAT+++D  S+  I  T   +      T+++IAHRL ++   +
Sbjct: 1547 MCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLRSVIDYD 1604

Query: 654  NVIVLGHDGSVVE 666
             ++V+   G V+E
Sbjct: 1605 KILVMDA-GEVIE 1616

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 107/460 (23%), Positives = 198/460 (43%), Gaps = 30/460 (6%)

Query: 223 KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL---SPQLSILLLFFTP 279
            +G +I+ +  DA+ VS  +   +   ++A++  +V   ++  L   +  + IL++    
Sbjct: 493 NIGAIINLMAVDAFKVSE-ICAYLHTFIEAMVMSVVAFSLLYKLLGYAAIVGILIVIGMI 551

Query: 280 PVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
           PV F   S+ GK      K     T +  +   E L  I+ ++ F  E N  S     I 
Sbjct: 552 PVNFKLVSLMGKY----QKKALGITDKRIQKLNEALQAIRIIKFFSWEDNFFSE----ID 603

Query: 339 DIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQLSIG--DLTAFMLYT 394
           +I +                + +  L+   +T  ++  Y+ +Q Q+       TA  L+ 
Sbjct: 604 EIREAEIQMYINKAYAWAFSAFIWFLTPTIVTGASFTVYIYVQKQVLTAPVAFTALALF- 662

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFS 454
           +     +  LS   S ++Q   +  R+    D + +       K  P+   + F++ + +
Sbjct: 663 QLLKQPLDQLSNMLSYVIQSKVSLDRVQNFLDEEDT-QKYNQLKVAPDGNKLAFENATIA 721

Query: 455 YPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITK 514
           +         K L+     G    ++GP+G GK+++ L LL      +G I++ + D   
Sbjct: 722 WSNNNQDFKLKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGEMQLLSGRIVVPSLDARH 781

Query: 515 ---LNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE-IRSVAKQCFCHNFITK 570
              ++   +   I    Q   L++ T+R+NI   L Y+P  E+  + V   C        
Sbjct: 782 EMLIDSDGMTNSIAYCSQSAWLLNDTVRNNI---LFYSPYNEDRYKEVIIACGLKRDFEL 838

Query: 571 FPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTF 628
           F     T IG  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +   I  N   
Sbjct: 839 FDAGDQTEIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAVDSHTAAWIYDNCIT 898

Query: 629 GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
           G LM+ ++  +VS  H ++   ++  ++V+  +G +   G
Sbjct: 899 GPLMEGRTCVLVS--HNIALTLKNAELVVMLENGRITNRG 936

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  152 bits (385), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 143/529 (27%), Positives = 249/529 (47%), Gaps = 51/529 (9%)

Query: 203  LRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGIVG 259
            L  + + + LH    + D   +G +++R   D    + S+  ++++ V+ +   +  IV 
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRLMLFQVGNIVA 1002

Query: 260  VGMMCSLS-PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATG-QLTRVAE---EQL 314
            V +MC +  P  +I +    P + F   +     ++TS++++     Q + V     E L
Sbjct: 1003 VIVMCIVYLPWFAIAV----PFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNNLNEVL 1058

Query: 315  SGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
             G+ T++S+  +    ++ +  I  + + G               ++  + F  ++A  S
Sbjct: 1059 GGMDTIKSYKGQKRFQAKSDYLINKMNEAGYLLVSVQRWVSIFLDMVA-IIFALIIALLS 1117

Query: 375  Y--LVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDR 427
               +   S  S+G L  ++L      N+V    T     M  A      A++L  E   +
Sbjct: 1118 VTGVFSLSASSVGVLLTYVLQLPGLLNSVLRALTQTENDMNSAERLVNYATKLPLEAAYK 1177

Query: 428  KPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGK 487
            KP +SP    +  P +G I F DV F+Y +   V + K LN  I  G  + I G +G GK
Sbjct: 1178 KPELSPP---ESWPSKGEIRFLDVDFAYRSGLPV-VLKGLNLDIKSGEKIGICGRTGAGK 1233

Query: 488  STIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLT 547
            STI   L R    T+G I+ID+ DI+ L    LRR++ I+ Q+PVL  GTIR N+     
Sbjct: 1234 STIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNLDPFSN 1293

Query: 548  YTPT-------------KEEIRSVAKQCF----CHNFITKFPNTYDTVIGPHGTLLSGGQ 590
            Y  +             KE +  V  +       H  + KF    D ++   G+  S G+
Sbjct: 1294 YDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVEEEGSNFSLGE 1351

Query: 591  KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 650
            +Q +A+ RAL+++  ILILDEATS++D E++G I     +  +  + TI+ IAHRL TI 
Sbjct: 1352 RQVLALTRALVRQSKILILDEATSSVDYETDGKIQKRIVE--EFDNCTILCIAHRLKTIL 1409

Query: 651  RSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQLQ 699
            + + ++VL   G + E  +  +L+++  S    +  ER+    SD ++Q
Sbjct: 1410 QYDRILVL-EKGVIAEFDQPFKLFSDKDSIFRSMC-ERSNITESDFKIQ 1456

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 120/246 (48%), Gaps = 21/246 (8%)

Query: 464 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           F +L+F+I  G  + I GP G GKS++      + N T G I + N D+  L C      
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQV-NGDL--LFCGY---- 640

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
                  P + + T++DNI +G  +   KE+  +V + C     +   P    T IG  G
Sbjct: 641 -------PWIQNATVKDNILFGSPFI--KEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     L++ K+  + + 
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGKTRILAT- 750

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQLQIEK 702
            H+LS I +++ VIVLG DGS  ++G   EL       L+ LL+       ++ + +   
Sbjct: 751 -HQLSLIEKADRVIVLGTDGS-FDIGTVDEL-KQRNQTLTNLLDYSTTERENENRDESPV 807

Query: 703 VEEKED 708
            +E+ D
Sbjct: 808 ADEEND 813

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  151 bits (381), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 152/558 (27%), Positives = 244/558 (43%), Gaps = 60/558 (10%)

Query: 156  FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQD 215
            F  + P F + LY   SFF  A  I     F     + I++ + +  LRA  +K+ LH  
Sbjct: 926  FKNRPPSFYMGLY---SFFVFAAFIFMNGQFTILCAMGIMASKWL-NLRA--VKRILHTP 979

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLS-PQLSILL 274
              + D   +G +++R   D   +   +T+ +   + +    IVGV +MC +  P  +I +
Sbjct: 980  MSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAI 1038

Query: 275  LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
             F     +  A  +    R   +        +     E L G+ T++++ ++   L++ +
Sbjct: 1039 PFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSD 1098

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ----------SQLSI 384
              I  + + G                     FL ++A    L++           S  S+
Sbjct: 1099 FLINKMNEAGYLVVVLQRWVGI---------FLDMVAIAFALIITLLCVTRAFPISAASV 1149

Query: 385  GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG-----AASRLFELTDRKPSISPTVGHKY 439
            G L  ++L      N +    T     M  A      A     E + RKP ++P    + 
Sbjct: 1150 GVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPP---ES 1206

Query: 440  QPERGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
             P  G I F++V F+Y  RP + I  K+LN  I  G  + I G +G GKSTI   L R  
Sbjct: 1207 WPSMGEIIFENVDFAY--RPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLN 1264

Query: 499  NPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP-------- 550
              T G I+IDN DI++L    LRR++ I+ Q+PVL  GTIR N+      T         
Sbjct: 1265 ELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALV 1324

Query: 551  -----TKEEIRSVAKQ----CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALI 601
                  K+++  V  Q       H  + KF    D  +   G+  S G++Q +A+ RAL+
Sbjct: 1325 RGGAIAKDDLPEVKLQKPDENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALV 1382

Query: 602  KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
            ++  ILILDEATS++D E++G I     +  +    TI+ IAHRL TI   + ++VL   
Sbjct: 1383 RQSKILILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-EK 1439

Query: 662  GSVVEMGKFKELYANSTS 679
            G V E      L++   S
Sbjct: 1440 GEVAEFDTPWTLFSQEDS 1457

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/228 (31%), Positives = 113/228 (49%), Gaps = 20/228 (8%)

Query: 458 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNC 517
           + S + FK LNF I  G  + I GP G GKS++   +      T G + + N D+  L C
Sbjct: 598 KTSFRGFKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEV-NGDL--LMC 654

Query: 518 KSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + + ++RDNI +G  +   KE+   V + C     +   P    T
Sbjct: 655 GY-----------PWIQNASVRDNIIFGSPFN--KEKYDEVVRVCSLKADLDILPAGDMT 701

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKS 636
            IG  G  LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++     ++ +K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKT 761

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
             + +  H+LS I R+  VIVLG DG  V++G   EL A + + ++ L
Sbjct: 762 RILAT--HQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQTLINLL 806

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 130/510 (25%), Positives = 237/510 (46%), Gaps = 32/510 (6%)

Query: 183  AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFD--NHKVGDLISRLGSDAYVVSR 240
            A  F +  +L    E  +  LR +  +  + +D  +F   N+   ++ S + +D     R
Sbjct: 787  AFTFLKCYILSRCGENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDL----R 842

Query: 241  SMTQKVSDGVKAL----ICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTS 296
             +    S+ + AL    +  + G+        +LS++ +   P  +  + ++G  ++N  
Sbjct: 843  DLRALASEFLAALSTLAVVSLCGLLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQNYE 902

Query: 297  KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXX 356
               +    +L     + +  +KT++    E N+++R +  + ++   G            
Sbjct: 903  ARYKTCIAELENELYKAIRCMKTIKCLQME-NKVAR-SYEMLEVTSKGAARKRAMGTGFG 960

Query: 357  XXSLLGDLSFLT---VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ 413
              S    L+F+T   +L +G  LV+  + + G +   +    +T      L +   EI +
Sbjct: 961  VASS-NALTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISR 1019

Query: 414  GAGAASRLFELTDRKPSISPTV-GHKYQP------ERGVIEFKDVSFSYPTRPSVQIFKS 466
            G  AA+ LF+L   +     +V   ++ P      ++ +I  K + FSY    +  ++K+
Sbjct: 1020 GQRAATYLFKLFGNEHEEGASVLKERHAPIIKTCSKQTLISIKHLKFSYSNINNPMVYKN 1079

Query: 467  LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGI 526
            L+ K+  G  V ++G SG GKST+  LL R Y    G+I ID  DI + + K+LR  I +
Sbjct: 1080 LSLKVDRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAV 1139

Query: 527  VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
            V+Q+P+  SG+I +N+TYGL    + EE+  +        F+   P    +VI     LL
Sbjct: 1140 VEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ--LL 1197

Query: 587  SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAH 644
            SGGQ QR+AI RAL++KP +L+LDE TSALD       ++   + +K      T + + H
Sbjct: 1198 SGGQVQRLAIVRALLRKPQLLVLDECTSALDARH----SFIMSEFVKHHLYHTTTLVVTH 1253

Query: 645  RLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
                +R    ++   + G +VE G    L+
Sbjct: 1254 SEQMMRSCHRILTF-NKGEIVEEGSIDNLF 1282

 Score =  149 bits (375), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 155/597 (25%), Positives = 261/597 (43%), Gaps = 51/597 (8%)

Query: 114 RDWKXXXXXXXXXXXSCSIGMSI-PKVIGIVLDTLKTSSGSDFFDLKIPIFSL-----PL 167
           RDW             CS+   I P V  I++       G+ F  L+ P+         L
Sbjct: 24  RDWWLLMIISI-----CSVAYGIVPAVTSILM-------GAVFNLLQKPVIQQFDSVNTL 71

Query: 168 YEFLSFFTVALLIGCAANFGRFILLRI-----LSERVVARLRAHVIKKTLHQDAEFFD-N 221
              L+  T+A+LI   A+   F  L I     L ER   RLR  +++    +   ++D N
Sbjct: 72  MRDLTIRTMAILITGIASIP-FCWLSIYAWMSLGERQGFRLRRKLLRSYFEKSMAWYDIN 130

Query: 222 HKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPV 281
            ++    ++L      +  S  +  +   + L+  I  +G     S  L+++++  +P V
Sbjct: 131 EQISGEYTQLNRCVEELRSSSAEASAIIFQNLVTVIALLGTALYYSWSLTLVIMANSPLV 190

Query: 282 LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
           +  A    + +    K     T     +    L+  K V+    +  E++++  ++    
Sbjct: 191 IGFAIYCSRNVEKYGKIENSETSVAADIMAWSLNAAKMVRLLGTQDYEIAKFRASVLKCR 250

Query: 342 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD-LTAFMLYTEYTGNA 400
                              L    F+    YG+  +    L  GD +T F        + 
Sbjct: 251 MNFNKMSLFSSLNYSILRFLTLCMFVQGFWYGNVRIKSGNLKPGDVMTCF-------SSC 303

Query: 401 VFGLSTFYSEIMQ------GAGAASRLFEL--TDRKPSISPTVGHKYQP---ERGVIEFK 449
           +   ST  S + Q      GA    ++ E   +D        V   + P   E+  I F+
Sbjct: 304 ILLASTLNSTLHQVVTLQKGAVGLKKIQEFLTSDVVQGKECVVNSMHLPLLWEQAQISFE 363

Query: 450 DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 509
           +VSF+YP+R    + K+LN K+  G    IVG SG GKSTI+ LLL+ Y P +G I +++
Sbjct: 364 NVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVND 423

Query: 510 QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNF 567
            DI ++N + L R I +V+Q   L   +I++NI   LT    +++ R     +       
Sbjct: 424 VDIREINQQDLFRSITLVEQNSPLFEDSIKNNIQ--LTSDEHRDDGRLSQACQAAMLEGV 481

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           I       DT+IG  G  LSGG++QR+A+ARA ++   ILILDEA SA D   +  +   
Sbjct: 482 IRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLLMEA 541

Query: 628 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
                K ++  I++  H L+ I   ++ ++L  DG+V+E G+  +L ++STS  S L
Sbjct: 542 IRFWRKGRTTIILT--HELNDILE-DDFVLLMEDGNVIERGQKSDLLSDSTSKFSLL 595

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 153/571 (26%), Positives = 253/571 (44%), Gaps = 75/571 (13%)

Query: 168  YEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            Y    +FT+      A      IL    + +   +L + +          FF+   +G +
Sbjct: 984  YYLFIYFTLGFASSLANLIQTIILWIFCTIQGSKQLHSSMTSSIFRAPMSFFETTPIGRI 1043

Query: 228  ISRLGSDAY----VVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLF 283
            ++R  +D Y    ++ RS +Q   + ++     +V    +CS + Q     +F   P+ F
Sbjct: 1044 LNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIVV----ICSTTWQF----IFLIIPMAF 1095

Query: 284  SASVFGKQIRNTSKDLQ--EATGQLTRVA--EEQLSGIKTVQSFVAEGNELSRYNVAIRD 339
                + +    TS++L+  ++T +    A  +E L G+ T++ F A+ +     N +   
Sbjct: 1096 LYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGF-AQQDRFIHINQS--- 1151

Query: 340  IFQVGXXXXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
              +V                L   L FL +++  G+  +   +L  G LTA M+      
Sbjct: 1152 --RVDSNMMAYYPSINSNRWLAFRLEFLGSLIILGAATLSIFRLKNGSLTAGMI------ 1203

Query: 399  NAVFGLSTFYS-EIMQGAGAASRL-------------FELTDRKPSISPTVGHKYQPE-- 442
                GLS  Y+ ++ Q      R+              E     PS +P +    +P   
Sbjct: 1204 ----GLSMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYSHLPSEAPLIIENNRPSEE 1259

Query: 443  ---RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
               +G IEFK+ S  Y  RP +  + K++N KI P   V IVG +G GKS++ L L R  
Sbjct: 1260 WPSKGAIEFKNYSTRY--RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRII 1317

Query: 499  NPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSV 558
              ++G+I ID  +I +L    LR ++ I+ Q+  +  G+IR+NI    T   +++EI + 
Sbjct: 1318 EASSGSIEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENI--DPTQQFSEQEIWNA 1375

Query: 559  AKQCFCHNFITKF---------------PNTYDTVIGPHGTLLSGGQKQRIAIARALIKK 603
             +       I K                 N  D  I   G+ LS GQ+Q I +ARAL+  
Sbjct: 1376 LEMAHLKPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLVP 1435

Query: 604  PTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGS 663
              +LILDEAT+A+DVE++  I +T     K +  TI++IAHR++TI  S+ +IVL  +G 
Sbjct: 1436 SNVLILDEATAAVDVETDELIQHTIRTAFKDR--TILTIAHRINTIMDSDKIIVLD-NGE 1492

Query: 664  VVEMGKFKELYANSTSALSQLLNERAAPGPS 694
            V E  K + L  N  S    L  E     P+
Sbjct: 1493 VAEFDKPEILLTNKNSLFYSLCYESGVLKPN 1523

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 121/250 (48%), Gaps = 20/250 (8%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           + +F +  +P  ++  K++NF+   G   CIVG  G GKS     +L             
Sbjct: 619 NATFLWKRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSIL------------- 665

Query: 509 NQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    S+   +  V Q   +M+GT++DNI +G  Y P  E      K C     
Sbjct: 666 -GDLFRVKGFASIHGNVAYVSQLAWIMNGTVKDNIIFGHRYDP--EFYEKTIKACALTID 722

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           ++  P+   T++G  G  LSGGQK R+++ARA+  +  I +LD+  +A+D   S+  I  
Sbjct: 723 LSILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQN 782

Query: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
             G     KS T +   +++  +  ++++ +L  +G + E G + ++ A   S+LS+L+ 
Sbjct: 783 VLGAKGLLKSKTRILTTNKIPVLSIADSITLL-ENGEITEQGTYFDVMATEGSSLSKLIT 841

Query: 687 ERAAPGPSDQ 696
           E      S +
Sbjct: 842 EYGKKKDSSE 851

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 134/521 (25%), Positives = 247/521 (47%), Gaps = 56/521 (10%)

Query: 173  FFTVALLIGCAANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLIS 229
            + ++  LIG   +     + +L  +L  R   ++   ++ +TLH    FFD   +G +++
Sbjct: 1108 YLSIYFLIGLTQSLLAASKSVLNFVLGIRASRKIFESLLYRTLHAKLGFFDATPIGRIMN 1167

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ-LSILLL-----FFTPPVLF 283
            R   D   V + +T  +      L+  I  + ++  ++PQ LS+ +L     +       
Sbjct: 1168 RFSKDIESVDQELTPYLEAAFFCLVQCIATMALITFITPQFLSVAILVGCLYYLVGYFYM 1227

Query: 284  SASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQV 343
            +AS   K+  + SK        + +   E L G+ T++++   G+E SR+   + ++ ++
Sbjct: 1228 AASRELKRFESISK------SPIYQHFSETLVGVATIRAY---GDE-SRF--MLENLHKI 1275

Query: 344  GXXXXXXXXXXXXXXSL---LGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTE 395
                            L   +  +    +   G +++     + S ++   LT  + +TE
Sbjct: 1276 DENNKPFFYLWVFNRWLSFRIDMIGAFVIFGAGVFILTNIKNIDSGMAGISLTYAISFTE 1335

Query: 396  YTGNAVFGLSTFYSEIMQGAGAASRLFELTD--RKP--SISPTVGHKYQPERGVIEFKDV 451
                    L  FY+++     +  RL E  +  ++P      T+ H   P  G IE KD+
Sbjct: 1336 ----GALWLVRFYADVEMNMNSVERLKEYMEIEQEPYDEYKDTLLHDEWPSNGKIEVKDL 1391

Query: 452  SFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQ 510
            S  Y P  P  ++ K+++F + P + + IVG +G GKSTI   + R+ NP +G I ID+ 
Sbjct: 1392 SLRYAPNLP--KVIKNVSFVVEPKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDV 1449

Query: 511  DITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKEEIRS 557
            +I  +N   LRR I I+ Q+P L +GTI+ N+     +T              T+EE+++
Sbjct: 1450 NIASINLTKLRRSITIIPQDPTLFTGTIKLNLDPYNEFTDDAIFEALKRVNLVTEEELQN 1509

Query: 558  VAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
               Q        KF N  +  I   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D
Sbjct: 1510 NGTQTGTSENANKFLNL-ENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASID 1568

Query: 618  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
              S+  I  T  +  +    TI++IAHRL ++   + +IV+
Sbjct: 1569 YASDAKIQETIRK--EFSQSTILTIAHRLRSVIDYDKIIVM 1607

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 112/229 (48%), Gaps = 11/229 (4%)

Query: 446 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           I FK+V+ ++         + LN +  PG+   ++GP+G GK+++ L LL       G I
Sbjct: 711 IAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEI 770

Query: 506 MID----NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561
           ++      QD+  ++   L   I    Q   L++ T+R+NI +   Y   +E   +V   
Sbjct: 771 IVPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFNSPYN--EERYNAVIDA 827

Query: 562 CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
           C     +     +  T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  + 
Sbjct: 828 CGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTA 887

Query: 622 GAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
             I  N   G LM  ++  +VS  H ++   ++  ++V+  +G V + G
Sbjct: 888 LWIYDNCITGPLMSGRTCILVS--HNIALTLKNAELVVILENGRVKDQG 934

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  149 bits (375), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 131/501 (26%), Positives = 230/501 (45%), Gaps = 45/501 (8%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266
            +++K LH    FFD+  +G +++R   D   V + +T        +L+  +  V ++  +
Sbjct: 1182 LLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITFI 1241

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
            +PQ  I+ +       F    +    R   +    +   + +   E L G+ T+++F  E
Sbjct: 1242 TPQFLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTTIRAFGDE 1301

Query: 327  G----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-SQ 381
                   L + +   R  F +                L+G L    V   G +++L    
Sbjct: 1302 SRFIQENLHKIDENNRPFFYLWVANRWLAMRI----DLIGSL---VVFGAGVFILLNIDH 1354

Query: 382  LSIG----DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE--LTDRKPSISPTV 435
            +  G     LT  + +TE        L   YS +     +  RL E  + +++P   P +
Sbjct: 1355 IDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYNQPIM 1410

Query: 436  GH-KYQPERGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALL 493
                  P+ G +E  DVS  Y P  P  ++ K+++F + P S V +VG +G GKSTI   
Sbjct: 1411 TPPSDWPQHGRVEMSDVSLRYAPGLP--RVIKNVSFTVEPKSKVGVVGRTGAGKSTIITA 1468

Query: 494  LLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP--- 550
            L R+ +P TG I IDN DI+ ++ + LRR I I+ Q+P L +GTI+ N+     Y+    
Sbjct: 1469 LFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDEYSDEDI 1528

Query: 551  ----------TKEEI--RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIAR 598
                      ++EE+   ++         + KF +  ++ I   G  LS GQ+Q + +AR
Sbjct: 1529 FAALKRVNLVSQEELDRSNIDAASVGSENVNKFLDL-NSEINEGGGNLSQGQRQLVCLAR 1587

Query: 599  ALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
            +L++ P I++LDEAT+++D +S+  I  T  +  +    TI++IAHRL ++   + ++V+
Sbjct: 1588 SLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYDKILVM 1645

Query: 659  GHDGSVVEMGKFKELYANSTS 679
               G V E      L  N  S
Sbjct: 1646 DQ-GEVKEYDHPYSLLLNKNS 1665

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 122/523 (23%), Positives = 215/523 (41%), Gaps = 42/523 (8%)

Query: 177 ALLIGCAANFGRFILLR----ILSERVVARLRAHVIKKTLHQDAEFFD-------NHKVG 225
           A+  G A  FGR + ++    I+SE     LR  V   +  Q  +  D        H+ G
Sbjct: 458 AIFSGQALFFGRRVCIKMKAIIISEIYTKALRRQVAVNSNKQSTDEVDPQELNEEEHRDG 517

Query: 226 D-----------LISRLGSDAYVVSR--SMTQKVSDGVKALICGIVGVGMMCSLSPQLSI 272
           D           +I+ +  DA+ VS   +      + V      IV +  +  LS  +  
Sbjct: 518 DEESGTSANLGAIINLMAVDAFKVSEICAYLHAFVEAVAMSCVAIVLLYKLLGLSAIIGA 577

Query: 273 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332
           LL+    PV F    +  Q++  S      T +  +   E    I+ ++ F  E N   +
Sbjct: 578 LLIVVLMPVNFRLVTWLGQLQKKSLSY---TDKRIQNLNEAFQAIRIIKFFSWEDN-FEK 633

Query: 333 YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 392
              AIRD+ ++                     + +T  A+  Y+ +Q Q ++    AF  
Sbjct: 634 GIQAIRDV-ELKLLLQRSLIWALCSFVWYATPTIVTTSAFAFYIYVQKQ-TLTTPVAFTA 691

Query: 393 YTEYT--GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKD 450
            + ++     +  LS   S ++Q   +  R+ E  + +P           P    + F++
Sbjct: 692 LSLFSLLRTPLDQLSDMLSFVIQSKVSLDRIQEFLE-EPDTDKYNQLSVAPGGQKLGFEN 750

Query: 451 VSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI--- 507
            + S+ +       ++LN     G    ++GP+G GK++I + LL       G I++   
Sbjct: 751 ATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLLNGNIVVPSL 810

Query: 508 DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
           D + +  ++   +   I    Q   L++ T+R+NI +   Y+  +     V + C     
Sbjct: 811 DPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFNSPYSEAR--YNDVIEACGLKRD 868

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--N 625
                    T IG  G  LSGGQKQRI++AR+L      L+LD+  SA+D  +   I  N
Sbjct: 869 FEILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVDSHTASWIYDN 928

Query: 626 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
              G LM+ +  T + I+H ++   R+  ++VL  +G V E G
Sbjct: 929 CITGPLMQGR--TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  148 bits (373), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 148/548 (27%), Positives = 245/548 (44%), Gaps = 39/548 (7%)

Query: 168  YEFLSFFTVALLIGCAANFGR----FILLRILSERVVARLRAHVIKKTLHQDAEFFDNHK 223
            Y  L F  V   IG    F        +L   S R   +L   + K  +     FF+   
Sbjct: 989  YNLLWFLGVYAAIGLGGAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETTP 1048

Query: 224  VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLF 283
             G +I+R  SD   V  ++    S   ++++  I+ V ++    P   +L        L+
Sbjct: 1049 TGRIINRFSSDMDSVDTTLQNVFSLFFRSILDYIITVILVTFNMPLFFLLNAGLLVIYLY 1108

Query: 284  SASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQV 343
              S +    R   +    +   +  +  E LSG  T+ ++     ++ R++    +  Q 
Sbjct: 1109 YQSFYIVLSRELKRLTSISYSPIMSLMGESLSGHFTISAY----EQIRRFSHLNYERIQF 1164

Query: 344  GXXXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTG 398
                           S+ L  +  L VL+ G    S L    QLS G +   M Y     
Sbjct: 1165 SINCFFNYRSSNRWLSVRLQSIGALIVLSTGLLALSSLGTDHQLSSGLVGLLMSYALQVT 1224

Query: 399  NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQ-----PERGVIEFKDVSF 453
            +++  +      I     +  R+ E  D  P  +P V  +++     P +G IEFK+ S 
Sbjct: 1225 SSLIWIIRSSVLIETNIVSVERIVEYCDISPE-APEVKEEHRLDDNWPNQGQIEFKNYST 1283

Query: 454  SYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDI 512
            SY  R ++  + K +N  I+PG  + +VG +G GKST+++ L R   PT GTI IDN DI
Sbjct: 1284 SY--RENLDPVLKHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDI 1341

Query: 513  TKLNCKSLRRQIGIVQQEPVLMSGTIR-----------DNITYGLTYTPTKEEIRSVAKQ 561
            T +  + LR  I I+ Q+     GTIR           D++ + +  +  K  + ++AK+
Sbjct: 1342 TSIGLRDLRSHIAIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKE 1401

Query: 562  CFC---HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
                  ++  ++  +  D  +   G+ LS GQKQ + +ARAL+ K  IL+LDEAT+++DV
Sbjct: 1402 INDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILVLDEATASVDV 1461

Query: 619  ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANST 678
            E++  I  T  +    +  TI++IAHRL T+  S+ +IVL   G V E  K + L     
Sbjct: 1462 ETDKIIQETIRKEFADR--TILTIAHRLDTVFDSDRIIVLD-GGEVKEFDKPETLLEQKD 1518

Query: 679  SALSQLLN 686
            S   +L +
Sbjct: 1519 SIFYKLCD 1526

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 115/237 (48%), Gaps = 15/237 (6%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIV 527
           NF++   S +C+VG  G GKSTI   +L      +G     N D      +     +   
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISG-----NNDHLSPQFQINATTVAYC 693

Query: 528 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLS 587
            QE  +M+ +++DNI +G  Y   +   ++  K C     I   P+  +T++G  G +LS
Sbjct: 694 PQEAWIMNASVKDNILFGHKYD--EAFYKATIKACQLLPDIKVLPDGDETMVGEKGIVLS 751

Query: 588 GGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIA 643
           GGQK R+++ARA+  +  + +LD+  SA+D E  +  I     +   L+K KS  IV   
Sbjct: 752 GGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDKS--IVLAT 809

Query: 644 HRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN-STSALSQLLNERAAPGPSDQQLQ 699
           + +S ++ S  + +L  + S+ + G + ++  N   S L  +L+E     P    +Q
Sbjct: 810 NTISVLKHSTKIYLL-ENKSIAQEGNYDDIMNNQQDSKLKNILHEFDLEKPDTPAVQ 865

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 143/530 (26%), Positives = 240/530 (45%), Gaps = 48/530 (9%)

Query: 175  TVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
            TV L + C     R+             L   +    L     FF+   +G +++R  +D
Sbjct: 1013 TVILWVFCTIQGSRY-------------LHTLMTNAVLRAPMSFFETTPIGRILNRFSND 1059

Query: 235  AY----VVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGK 290
             Y    V+ R+ +Q   + VK        +G++C  + Q     +F   P+      + +
Sbjct: 1060 IYKVDSVLGRTFSQFFVNAVKVSFT----IGVICVTTWQF----IFVIVPLGVFYIYYQQ 1111

Query: 291  QIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGNELSRYN-VAIRDIFQVG 344
                TS++L+     +TR       +E L GI T++ +  +    S+ N   + +     
Sbjct: 1112 YYLRTSRELRRL-DSITRSPVYSHFQETLGGIVTIRGY-GQQKRFSQINQCRVDNNMSAF 1169

Query: 345  XXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGL 404
                           L+G +  L         + Q  L+ G +   + Y      ++  +
Sbjct: 1170 YPSVNANRWLAYRLELIGSIIILGAATLSVMRLKQGTLTAGMVGLSLSYALQITQSLNWI 1229

Query: 405  STFYSEIMQGAGAASRLFELTDRKPSISPTV--GHKYQ---PERGVIEFKDVSFSYPTRP 459
                 E+     +  R+ E  D K S +P +   H+ Q   PE G I+F+  S  Y  RP
Sbjct: 1230 VRMTVEVETNIVSVERIKEYADLK-SEAPEIIEDHRPQETWPEEGDIKFEHYSTRY--RP 1286

Query: 460  SVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCK 518
             +  + K +NF I P   + IVG +G GKS++ L L R    + G I+IDN DI+ +   
Sbjct: 1287 ELDLVLKDINFHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASEGNIIIDNVDISDIGLY 1346

Query: 519  SLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI-TKFPNTYDT 577
             LR ++ I+ Q+  +  GTIR+NI     Y  T E+I  V +     + I T   +  DT
Sbjct: 1347 DLRHKLSIIPQDSQVFEGTIRENIDPTNQY--TDEQIWRVLELSHLRDHIATMGGDGLDT 1404

Query: 578  VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637
             +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  +  T     K +  
Sbjct: 1405 KLNEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAVDVETDKVLQETIRTSFKDR-- 1462

Query: 638  TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
            TI++IAHR++TI  ++ ++VL  +GS+ E  + K+L  N +S    L  E
Sbjct: 1463 TILTIAHRINTIMDNDRIMVLD-NGSIKEFDEPKKLLENKSSLFYSLCEE 1511

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 121/243 (49%), Gaps = 24/243 (9%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           D +F +  +P  ++  K++NF+   G   CIVG  G GKS +   +L             
Sbjct: 630 DATFLWQRKPEYKVALKNVNFQAKKGELTCIVGRVGSGKSALIQSIL------------- 676

Query: 509 NQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++   +  V Q   +M+GT++DNI +G  Y    E      K C     
Sbjct: 677 -GDLFRVKGFATIHGNVAYVSQVAWIMNGTVKDNILFGHKYDA--EFYEKTIKACALTID 733

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           ++   +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +
Sbjct: 734 LSVLVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEH 793

Query: 627 TFGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
             G   L+ +K+  + +  +++S +  +++V +L  +G +V+ G + E+  +  S L++L
Sbjct: 794 VLGPNGLLHTKTKVLAT--NKVSVLSVADSVSLL-ENGEIVQQGSYDEIMKDGASQLNKL 850

Query: 685 LNE 687
           + E
Sbjct: 851 IME 853

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 143/532 (26%), Positives = 243/532 (45%), Gaps = 62/532 (11%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266
            V+KK L+    FFD+  +G +++R   D   V + +T  V     +L+  +  V ++  +
Sbjct: 1138 VLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1197

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQS 322
            +P   ++ +F    + F   + G      S++L+     +   + +   E L GI T+++
Sbjct: 1198 TPGFLVVAIF----IGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSETLVGITTIRA 1253

Query: 323  FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ--- 379
            F   G+E       ++ I +                  +  +    V A G +++L    
Sbjct: 1254 F---GDERRFMLENLQKIDENNKPFFYLWVANRWLAFRIDMIGACVVFAAGVFILLNIKK 1310

Query: 380  --SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE--LTDRKPS----I 431
              S L+   LT  + +TE        L   YS +     +  RL E  + +++PS     
Sbjct: 1311 LDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMVIEQEPSNDGAF 1366

Query: 432  SPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIA 491
            +P +     P++G IE  D+S  Y T    ++ K+++F + P   V IVG +G GKSTI 
Sbjct: 1367 NPPIE---WPDQGKIEVNDLSLRYATNLP-RVIKNVSFTVDPKCKVGIVGRTGAGKSTII 1422

Query: 492  LLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPT 551
              L R+ +P TG I IDN DIT +  K LR+ I I+ Q+P L SGT++ N+     Y  T
Sbjct: 1423 TALFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSNLDPYDEY--T 1480

Query: 552  KEEIRSVAKQCFCHNFIT-----KFPNTYDTV----------------IGPHGTLLSGGQ 590
             E+I    K+    N +T       P++ D                  I   G  LS GQ
Sbjct: 1481 DEQIFKALKRV---NLVTADELDHVPDSADNASVNSENVNKFLDLRNEITEGGANLSQGQ 1537

Query: 591  KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 650
            +Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  +    TI++IAHRL +I 
Sbjct: 1538 RQLVCLARSLLRSPKIILLDEATASIDYSSDAKIQQTIRE--EFGDSTILTIAHRLRSII 1595

Query: 651  RSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQLQIEK 702
              + ++V+   G V E      L  N +S    +  +    G  D  +Q+ K
Sbjct: 1596 DYDKILVMDA-GEVREYDHPYSLLLNKSSIFYSMCED---SGELDILVQLAK 1643

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 133/548 (24%), Positives = 239/548 (43%), Gaps = 70/548 (12%)

Query: 167 LYEFLSFFTVALLIGCAAN---FGRFILLR----ILSERVVARLRAHV-----------I 208
           LY F  FF   L+  C A    FGR + +R    I+SE     LR  +           I
Sbjct: 394 LYVFGMFFCRILVAICQAQALFFGRRVCIRMKAIIISEIYTKALRRKISPNSSKVSTDEI 453

Query: 209 KKTLHQDAEFFDNHK------VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGM 262
                 + E  D  +      +G +I+ +  DA+ VS  +   +   V+A I  IV + +
Sbjct: 454 DPQALNETEEIDGDEESTTANLGGIINLMAVDAFKVSE-ICAYLHAFVEATIMTIVALTL 512

Query: 263 MCSL---SPQLSILLLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIK 318
           +  L   +  +  +L+    P+ F  A++ GK      KD    T +  +   E    I+
Sbjct: 513 LYKLLGWAAVIGAILIVCMLPLNFKLANLIGK----LQKDNLGVTDKRIQKLNETFQSIR 568

Query: 319 TVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT-----VLAYG 373
            ++ F  E N         RDI  +               +L+  + F+T      +++ 
Sbjct: 569 IIKFFSWEEN-------FERDIKAIRTEELKILLKRSIVWALMSLVWFITPSIVTSVSFA 621

Query: 374 SYLVLQSQLSIGDL--TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSI 431
            Y+ +Q ++    +  TA  L+T    N +  LS   S ++Q   +  R+ E  D + + 
Sbjct: 622 FYIYVQGEVLTTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRVQEFLDEEET- 679

Query: 432 SPTVGHKYQP---ERGVIEFKDVSFSYPTR-PSVQIFKSLNFKIAPGSSVCIVGPSGRGK 487
                 KY      R  I F++ +F++  + PS ++ K+LN +   G    ++G +G GK
Sbjct: 680 -----EKYNQLTISRNKIAFENATFAWDKKNPSFKL-KNLNVEFKLGKLNVVIGSTGSGK 733

Query: 488 STIALLLLRYYNPTTGTIMI---DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITY 544
           +++ + LL   +   G + +   D ++   +    +   I    Q   L++ T+R+NI +
Sbjct: 734 TSLLMGLLGEMDLIEGKVYVPSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILF 793

Query: 545 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKP 604
              Y  T+   ++V + C              T IG  G  LSGGQKQR+++ARAL    
Sbjct: 794 NSPYNETR--YKAVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSS 851

Query: 605 TILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENVIVLGHD 661
             ++LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++ T++ +E V+VL  +
Sbjct: 852 RHVLLDDCLSAVDSHTALWIYENCITGPLMQGRTCILVS--HNVALTLKNAEWVVVL-DN 908

Query: 662 GSVVEMGK 669
           G + + G+
Sbjct: 909 GRIKDQGE 916

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  147 bits (371), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 146/546 (26%), Positives = 243/546 (44%), Gaps = 66/546 (12%)

Query: 146  TLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVAL--LIGCAANFGRFILLRILSERVVARL 203
            TL T++ + F+ L I I    L   +S   V L  + G  A+   F LL           
Sbjct: 1115 TLSTTTRNTFYYLSIYILLGTLRALISTVKVILSYISGLKASRKIFTLL----------- 1163

Query: 204  RAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMM 263
                +KK L+    FFD+   G +++R   D   +   +         +L+  I  + ++
Sbjct: 1164 ----LKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLI 1219

Query: 264  CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKT 319
              ++P    + LFF   +  S  + G      S++LQ         + +   E L G+ T
Sbjct: 1220 GYITP----VFLFFAIVICVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTT 1275

Query: 320  VQSFVAE----GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSY 375
            +++F  E     + LS+ +   R  F +                 +  +    +LA G +
Sbjct: 1276 IRAFGDERRFLADNLSKVDTHNRPFFYLWVTNRWLAFR-------IDFIGAFVILASGIF 1328

Query: 376  LVLQ-SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSIS 432
            ++L  + L  G     ++Y          L   YS +     +  RL E    +++PS  
Sbjct: 1329 ILLNVNSLDAGLAGISLIYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMKIEQEPSTG 1388

Query: 433  PTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIAL 492
                    P+RG IE  ++S  Y +    ++ K++ F + P S V IVG +G GKSTI  
Sbjct: 1389 LYEPPPEWPDRGKIEVNNLSLRYASNLP-KVIKNVTFTVEPQSKVGIVGRTGAGKSTIIT 1447

Query: 493  LLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTY---- 548
             L R+ +P TGTI +DN DIT +  K LR+ I I+ Q+PVL +GTI+ N+     Y    
Sbjct: 1448 ALFRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNLDPYSEYADDR 1507

Query: 549  ----------------TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQ 592
                            TPT  +I S +      N + KF +   + I   G+ LS GQ+Q
Sbjct: 1508 IFEALKRVNLIVQEELTPT--DIPSSSSSLSFEN-VNKFLD-LTSEITEGGSNLSQGQRQ 1563

Query: 593  RIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 652
             + +AR+L++ P  ++LDEAT+++D  S+  I  T  +  +    TI++IAHRL +I   
Sbjct: 1564 LVCLARSLLRNPKAILLDEATASIDYASDAKIQQTIRE--EFSGSTILTIAHRLRSIIDY 1621

Query: 653  ENVIVL 658
            + V+V+
Sbjct: 1622 DKVLVI 1627

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 105/216 (48%), Gaps = 9/216 (4%)

Query: 464 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI---DNQDITKLNCKSL 520
            K+LN     G    IVGP+G GK+++ + LL   N + G I +   + ++   ++   +
Sbjct: 730 LKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLSEGKIYVPALNPREDLVVDADGM 789

Query: 521 RRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 580
              IG   Q   L++ T+R+NI +   Y   +    +V   C     +        T +G
Sbjct: 790 TDSIGYCSQSAWLLNDTLRNNILFSAPYEANR--YNAVIHACGLTRDLEILNAGDQTEVG 847

Query: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMT 638
             G  LSGGQKQR+++ARA+  +   ++LD+  SA+D  +   I  +   G LM+ ++  
Sbjct: 848 EKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDSHTAQWIYKHCITGPLMEGRTCV 907

Query: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
           +VS  H  +   ++ + +V+  +  V   G+  EL+
Sbjct: 908 LVS--HNTALTLKNADWVVILENAKVTAQGEPLELF 941

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 148/563 (26%), Positives = 247/563 (43%), Gaps = 60/563 (10%)

Query: 156  FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQD 215
            F  + P F + LY   SFF  A  I      G++ +L ++       L    +K+ LH  
Sbjct: 926  FKNRPPSFYMGLY---SFFVFAAFIFMN---GQYTILCVMGIMASKWLNLKAVKRILHTP 979

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGIVGVGMMCSLS-PQLS 271
              + D   +G +++R   D    + S+  ++++ ++ L      IVGV +MC +  P  +
Sbjct: 980  MSYIDTTPLGRILNRFTKD----TDSLDNELTESLRLLTSQFANIVGVCVMCIVYLPWFA 1035

Query: 272  ILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELS 331
            I + F     +  A  +    R   +        +     E L G+ T++++ ++   L+
Sbjct: 1036 IAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLA 1095

Query: 332  RYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL-SFLTVLAYGSYLVLQSQLSIGDLTAF 390
            + +  I  + + G               ++  + + +  L   +     S  S+G L  +
Sbjct: 1096 KSDFLINKMNEAGYLVVVLQRWVGVFLDMVAIVFALIVTLLCVTRAFPISAASVGVLLTY 1155

Query: 391  MLYTEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTVGHKYQPERGV 445
            +L      N +    T     M  A      A+ L  E   RKP ++P    +  P +G 
Sbjct: 1156 VLQLPGLLNTILRAMTQTENDMNSAERLVSYATELPLEADYRKPEMTPP---ESWPSKGE 1212

Query: 446  IEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
            I  ++V FSY  RP + +  K+LN  I  G  + I G +G GKSTI   L R    + G 
Sbjct: 1213 IVLENVCFSY--RPGLPVVLKNLNLNIESGEKIGICGRTGAGKSTIMSALYRLNELSAGK 1270

Query: 505  IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP----TKEEIR---- 556
            I+ID+ DI+KL    LRR++ I+ Q+PVL  GTIR N+       P    T +E+     
Sbjct: 1271 ILIDDVDISKLGLFDLRRKLAIIPQDPVLFRGTIRKNL------DPFDERTDDELWDALV 1324

Query: 557  ---SVAKQCF------------CHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALI 601
               ++AK                H  + KF    D  +   G+  S G++Q +A+ RAL+
Sbjct: 1325 RGGAIAKNDLSEAKLQKPDKNGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALV 1382

Query: 602  KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
            ++  ILILDEATS++D E++G I     +  +    TI+ IAHRL TI   + ++VL   
Sbjct: 1383 RQSKILILDEATSSVDYETDGKIQARIVE--EFGDCTILCIAHRLQTIVNYDRILVL-EK 1439

Query: 662  GSVVEMGKFKELYANSTSALSQL 684
            G V E      L+    S    +
Sbjct: 1440 GEVAEFDTPWTLFTQENSIFRNM 1462

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/228 (31%), Positives = 112/228 (49%), Gaps = 20/228 (8%)

Query: 458 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNC 517
           + S + FK LNF+I  G  + I GP G GKS++   +      T G I + N D+  L C
Sbjct: 598 KTSFRGFKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEV-NGDL--LMC 654

Query: 518 KSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + +  +RDNI +G  +   KE+   V + C     +   P    T
Sbjct: 655 GY-----------PWIQNAPVRDNIIFGSPFI--KEKYNEVIRVCSLKADLDILPAGDMT 701

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKS 636
            IG  G  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     ++ +K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANKT 761

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
             + +  H+LS I R+  VIVLG DG  V++G   EL A + + +  L
Sbjct: 762 RILAT--HQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQTLIKLL 806

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 145/565 (25%), Positives = 252/565 (44%), Gaps = 74/565 (13%)

Query: 163  FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 222
            F + LY   SFF     +     F    ++ I++ +    L    +K+ LH    + D  
Sbjct: 934  FYMGLY---SFFVFGGYLFMNIQFTMLCMMGIMASK---WLNLKAVKRILHAPMSYLDTT 987

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLS-PQLSILLLFFTPPV 281
             +G +++R   D   +   +T+ +   + +    I+GV ++C +  P  +I + F     
Sbjct: 988  PLGRILNRFTKDTDSLDNELTENIR-LMMSQFANIIGVCVLCIVYLPWFAIAIPFLLLVF 1046

Query: 282  LFSASVF---GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
            +  A  +   G++I+     +Q +      +  E L G+ T++++ ++   +++ +  I 
Sbjct: 1047 VLIADHYQSAGREIKRLEA-IQRSFVYNNLI--EVLGGMDTIKAYKSQDRYMTKMDFLIN 1103

Query: 339  DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL-----SIGDLTAFMLY 393
             + +V                ++  ++F  ++   S L +  Q      ++G L  ++L 
Sbjct: 1104 KMNEVSYMVVSVQRWVAIFLDMIA-VAFALII---SLLCVTRQFHISPSAVGVLLTYVLQ 1159

Query: 394  --------------TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 439
                          TE   N+   L T+ +E+ Q A           RK   SP      
Sbjct: 1160 LPGLLNTVLRALTQTENDMNSAERLVTYATELPQEAAY---------RKSDYSPPDNW-- 1208

Query: 440  QPERGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
             P  G + F+DVSF+Y P  P+V   K++N  IA G  + I G +G GKSTI   L R  
Sbjct: 1209 -PTNGEVIFEDVSFAYRPGLPTV--LKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLN 1265

Query: 499  NPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPT------- 551
              T+G I ID  D  KL    LRR++ I+ Q+PVL  GTIR N+     ++         
Sbjct: 1266 ELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLI 1325

Query: 552  ------KEEIRSVAKQ----CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALI 601
                  K+++  +  Q       +N + KF    D ++   G   S G++Q +A+ RAL+
Sbjct: 1326 RGGAIEKDDLEDIKHQKPDKNGSYNNMHKF--HLDQIVEEDGANFSLGERQVLALTRALV 1383

Query: 602  KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
            ++  ILILDEATS++D E++G I        + +  TI+ IAHRL TI   + ++VL   
Sbjct: 1384 RQSKILILDEATSSVDYETDGKIQTRIAT--EFQDCTILCIAHRLKTILNYDRILVL-EK 1440

Query: 662  GSVVEMGKFKELYANSTSALSQLLN 686
            G V E  K + L+ N  S    + +
Sbjct: 1441 GEVAEFDKPEILFNNEKSIFRSMCD 1465

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 114/222 (51%), Gaps = 20/222 (9%)

Query: 464 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           F +LNF+I  G  + I GP G GKS++   +  +   TTG + I+      L C      
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDINGH---MLLCGY---- 669

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
                  P + + T+RDNI +G  Y   +E+ + V + C     I   P    T IG  G
Sbjct: 670 -------PWIQNATVRDNIIFGSPYD--REKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK RI +AR++ K   I + D+  SA+D    +  ++  F Q ++SK+  + + 
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKTRILAT- 779

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
            H+LS I +++ VIVL  +GS V++G  +EL   + + ++ L
Sbjct: 780 -HQLSLIEKADRVIVLSTNGS-VDIGTVEELKTRNQTLINLL 819

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 130/491 (26%), Positives = 223/491 (45%), Gaps = 48/491 (9%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266
            ++K +LH    FFD+  +G +++R   D   V + +   +      L+     + ++  +
Sbjct: 1174 LLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSIIVLITLI 1233

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
            +PQ   + +F      F  +V+    R   +        + +   E L+GI TV+++  E
Sbjct: 1234 TPQFLGVAIFIAVFYWFVGAVYISGSRELKRFDSITKSPIYQHFSETLAGITTVRAYGDE 1293

Query: 327  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386
               +      I +  +                 ++G  +F+ + A G  +   +++  G 
Sbjct: 1294 SRFMRENLEKIDENNKPFFYMWVSNRWLSFRTQIIG--AFVILGAGGFSIWNINKIDSGL 1351

Query: 387  LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISPTVGHKYQ-PER 443
                + Y     +A   L  FY +      +  R+ E    D++P    TV      PE 
Sbjct: 1352 AGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNIDQEPYNEGTVEPPADWPEN 1411

Query: 444  GVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 502
            G IE  DVS  Y P  P  ++ K+++F +   S V IVG +G GKSTI   L R+  P T
Sbjct: 1412 GKIEINDVSLRYAPNLP--RVIKNVSFTVDSKSKVGIVGRTGAGKSTIITALFRFLEPET 1469

Query: 503  GTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
            G I IDN DI  ++ + LRR I I+ Q+P L +GTIR N+     YT   +  + +    
Sbjct: 1470 GNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNLD---PYTQYSD--KEIFDSL 1524

Query: 563  FCHNFITK-------FPNTYDTV----------------IGPHGTLLSGGQKQRIAIARA 599
             C N +++        P++ DT                 +   G+ +S GQ+Q + +AR+
Sbjct: 1525 ICVNLVSREELAQVQSPSSNDTSSIVSENFNHFLDLEYNVSEGGSNISQGQRQLLCLARS 1584

Query: 600  LIKKPTILILDEATSALDVESEGAINYT----FGQLMKSKSMTIVSIAHRLSTIRRSENV 655
            L+ KP I++LDEAT+++D ES+  I  T    FG      + TI++IAHRL ++   + +
Sbjct: 1585 LLGKPKIILLDEATASIDYESDKKIQETIRNEFG------NSTILTIAHRLRSVIDYDKI 1638

Query: 656  IVLGHDGSVVE 666
            +V+  D   VE
Sbjct: 1639 LVM--DAGEVE 1647

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 129/550 (23%), Positives = 228/550 (41%), Gaps = 83/550 (15%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRAHVIKKT-----------LHQ 214
           F+S   VA+  G A   GR I +R    I+SE  +  LR  +I KT           L++
Sbjct: 464 FISKCIVAVCEGQALFIGRRICIRMRSIIISEIYIKALRRQIITKTKKSTDEVDPEQLNE 523

Query: 215 DAEFFDNHK------VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSP 268
           D++   + +      VG +I+ +  DA+ V+          + A +   +G  +M  +S 
Sbjct: 524 DSKIDGDEESTASANVGAIINLIAVDAFKVAE---------IGAYLHTFIGTIIMTFVS- 573

Query: 269 QLSILLLFFTPPVLFSASVFGK-----------QIRNTSKDLQE----ATGQLTRVAEEQ 313
              I LLF    +L SA+  G            +I N   +LQ+     T +  +   E 
Sbjct: 574 ---IYLLF---NLLGSAAFIGALTIIVLIPVNYKIANWLGNLQQKNLKTTDKRIQKLNET 627

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFL-----T 368
              I+ ++ F  E N          DI ++               S    + F+     T
Sbjct: 628 FQAIRIIKFFSWEKN-------FENDIHKIREEELYILLLRCLVWSFSTFIFFISPTIVT 680

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFG-----LSTFYSEIMQGAGAASRLFE 423
            L++  Y+ +Q Q    +LT+ + +T  +  A+       ++   S ++Q   +  R+  
Sbjct: 681 SLSFAYYIFIQKQ----ELTSPVAFTALSLFALLKIPLDQMANMLSYVVQSKVSLDRVQT 736

Query: 424 LTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPS 483
             D +P            E+  + FK+ + S+         ++L+     G    ++GP+
Sbjct: 737 FLD-EPDTKKYEQLTVPVEKNKLSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPT 795

Query: 484 GRGKSTIALLLLRYYNPTTGTIMIDNQDITK---LNCKSLRRQIGIVQQEPVLMSGTIRD 540
           G GK+++ + LL     T G I I + D      +        I    Q   L++ T+R+
Sbjct: 796 GSGKTSLLMALLGEMTLTEGQINIPSLDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRN 855

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600
           NI +   Y   + +   VA        I    +   T IG  G  LSGGQKQRI++ARAL
Sbjct: 856 NILFNSPYNKDRYDAAIVAAGLKRDFEILAAGDL--TEIGERGITLSGGQKQRISLARAL 913

Query: 601 IKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
                 ++LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   ++ +++V+
Sbjct: 914 YSNARHVLLDDCLSAVDAHTAAWIYDNCISGPLMEGRTCVLVS--HNIALTLKNASLVVM 971

Query: 659 GHDGSVVEMG 668
             +G V + G
Sbjct: 972 LKNGRVADQG 981

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  146 bits (369), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 147/556 (26%), Positives = 246/556 (44%), Gaps = 46/556 (8%)

Query: 156  FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQD 215
            F  + P F + LY   SFF  A  I     F     + I++ + +  LRA  +++ LH  
Sbjct: 926  FKNRPPSFYMGLY---SFFVFAAFIFMNGQFTILCAMGIMASKCL-NLRA--VRRILHTP 979

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLS-PQLSILL 274
              + D   +G +++R   D   +   +T+ +   + +    IVGV +MC +  P  +I +
Sbjct: 980  MSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAI 1038

Query: 275  LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
             F     +  A  +    R   +        +     E L G+ T++++ ++   L++ +
Sbjct: 1039 PFLLVVFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSD 1098

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSF---LTVLAYGSYLVLQSQLSIGDLTAFM 391
              I  + + G               ++  ++F   +T+L       + S  S+G L  ++
Sbjct: 1099 FLINKMNEAGYLVVVLQRWVGIFLDMVA-IAFALIITLLCVTRAFPI-SAASVGVLLTYV 1156

Query: 392  LYTEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTVGHKYQPERGVI 446
            L      N +    T     M  A      A++L  E   RKP ++P    +  P +G I
Sbjct: 1157 LQLPGLLNTILRAMTQTENDMNSAERLVSYATKLPLEADYRKPEMTPP---ESWPSKGKI 1213

Query: 447  EFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
             F++V F+Y  RP + I  K+ N  I  G  + I G +G GKSTI   L R    T G I
Sbjct: 1214 VFENVDFAY--RPGLPIVLKNFNLDIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGQI 1271

Query: 506  MIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDN----------------ITYGLTYT 549
             ID+ DI++L    LR+++ I+ Q+PVL  GTIR N                +  G    
Sbjct: 1272 FIDDVDISQLGLFDLRKKLAIIPQDPVLFRGTIRKNLDPFDERTDDELWDALVRGGAIAK 1331

Query: 550  PTKEEIR-SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI 608
                E+R     +   H  + KF    D  +   G+  S G++Q +A+ RAL+++  ILI
Sbjct: 1332 NDLPEVRLQKPDENGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILI 1389

Query: 609  LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            LDEATS++D E++G I     +  +    TI+ IAHRL TI   + ++VL   G V E  
Sbjct: 1390 LDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEYD 1446

Query: 669  KFKELYANSTSALSQL 684
                L++   S    +
Sbjct: 1447 TPWALFSQEDSIFKSM 1462

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 112/228 (49%), Gaps = 20/228 (8%)

Query: 458 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNC 517
           + S + FK LNF I  G  + I GP G GKS++   +        G I + N D+  L C
Sbjct: 598 KTSFRGFKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEV-NGDL--LMC 654

Query: 518 KSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + + T+RDNI +G  +   KE+   V   C     +   P    T
Sbjct: 655 GY-----------PWIQNATVRDNIIFGSPFN--KEKYDEVIHVCSLKADLDILPAGDMT 701

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKS 636
            IG  G  LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++     ++ +K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNKT 761

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
             + +  H+LS I R+  VIVLG DG  V++G  +EL A + + ++ L
Sbjct: 762 RILAT--HQLSLIERASRVIVLGTDGK-VDIGTVEELKARNKTLINLL 806

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  146 bits (368), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 139/557 (24%), Positives = 245/557 (43%), Gaps = 64/557 (11%)

Query: 168  YEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            Y  + +F + L      +   F L  I       ++ A ++ K +H    FFD   +G +
Sbjct: 1160 YYLIMYFMIGLTGATVGSLKTF-LTYIFGINASRKIFAMLLNKVIHSKLRFFDTTPIGRI 1218

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASV 287
            ++R   D   V + +T  ++    + +     + ++  ++PQ      FF   +L S   
Sbjct: 1219 MNRFSKDIESVDQELTPYLTGAFYSFVECFSTIILISWITPQ------FFVVAILISIMY 1272

Query: 288  F--GKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
            +  G      S++L+         + +   E L G+ T+++F   G+E+      +  I 
Sbjct: 1273 YLVGYFYMAGSRELKRLDSITKSPIYQHFSETLVGVTTIRAF---GDEMRFLKENLFKID 1329

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEY 396
            +                  +  +    V   G +++     + S ++   LT  + +TE 
Sbjct: 1330 ENNKPFFYLWVANRWLSFRIDMIGSFVVFGAGVFILADIKNIDSGMAGISLTYAISFTE- 1388

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRL----------FELTDRKPSISPTVGHKYQPERGVI 446
                   L  FYSE+     +  R+          +++ D      PTV     P+ G I
Sbjct: 1389 ---GALWLVRFYSEVEMNMNSVERIKEYMSVEQEPYDIKDEIVRTPPTV----WPDEGKI 1441

Query: 447  EFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 506
            E  D+S  Y      ++ K+++F + P S V +VG +G GKSTI   L R+ +P +G I 
Sbjct: 1442 EVNDLSLRYAANLP-RVIKNVSFTVEPNSKVGVVGRTGAGKSTIITALFRFLDPESGYIK 1500

Query: 507  IDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKE 553
            IDN DIT +    LRR I I+ Q+P L +GT++ N+     Y               + E
Sbjct: 1501 IDNMDITTIPLTRLRRAITIIPQDPTLFAGTLKFNLDPYDEYNDKDIFAALTRVNLVSGE 1560

Query: 554  EIR----SVAKQCFCH-NFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI 608
            E+     +V+ Q   H N   +F +  + +    G  LS GQ+Q I +AR+L++ P IL+
Sbjct: 1561 ELNGETTAVSDQGSMHSNNENRFLDLSNEITEGGGN-LSQGQRQLICLARSLLRNPKILL 1619

Query: 609  LDEATSALDVESEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            LDEAT+++D ES+  +  T  G+   S   TI++IAHRL ++   + ++V+   G V+E 
Sbjct: 1620 LDEATASIDYESDARLQATIRGEFGNS---TILTIAHRLRSVIDYDKILVMDA-GEVIEY 1675

Query: 668  GKFKELYANSTSALSQL 684
                 L  N  S   ++
Sbjct: 1676 DHPYSLLLNRNSEFYKM 1692

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 126/560 (22%), Positives = 232/560 (41%), Gaps = 79/560 (14%)

Query: 164 SLPLYEFLSFFT----VALLIGCAANFGRFILLRILSERVVARLRAHVIKK--------- 210
           +L  +  +S F     VAL  G A  FGR + +RI S  +++ + +  +KK         
Sbjct: 447 NLAWFYVISMFACKIIVALADGQALFFGRRVCIRIKS-IIISEIYSKALKKRVSMAPSKN 505

Query: 211 ---------------------TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDG 249
                                +++ D E   N K+G +I+ +  DAY +S  +   +   
Sbjct: 506 SADSPNAENEFEDPQERNEEESINADEESGSNAKLGTIINLMAIDAYKISE-ICAYLHFF 564

Query: 250 VKALICGIVGVGMMCSLSPQLSIL---LLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQ 305
            +A++  ++ + ++  L    +IL   ++    PV F  A++ G   + T   L E   +
Sbjct: 565 AEAIVMTVIALVLLYRLIGNAAILGTVIILVLLPVNFKLATLLGDYQKLT---LGETDKR 621

Query: 306 LTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS 365
           + ++  E L  I+ ++ F  E N         RDI ++                + G + 
Sbjct: 622 IHKL-NEALQSIRIIKFFSWENN-------FERDIMEIRERELQMLIKRTLAWVMGGFVW 673

Query: 366 FLT-----VLAYGSYLVLQSQL--SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 418
           F+T       ++  Y+ +Q ++  +    TA  L+T    + +  +S   S  +Q   + 
Sbjct: 674 FVTPSIVTTASFAWYIYVQGEVLTTPVAFTALSLFT-LLRDPLDRVSDMLSFAIQSKVSL 732

Query: 419 SRLFELTDRKPSISPTVGHKYQP-----ERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAP 473
            R+         +S     KY+      E   + F + + S+ T  S    ++LN     
Sbjct: 733 ERVGAF------LSEAETEKYEQLTVDNEGKKLAFDNSTTSWDTNGSGFKLRNLNIDFKV 786

Query: 474 GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI---DNQDITKLNCKSLRRQIGIVQQE 530
           G    ++G +G GK+++ + LL   +   G I++   + +     N       I    Q 
Sbjct: 787 GKLNVVIGATGSGKTSLLMALLGEMHICQGRIIVPSLEPRSSLTANSDGFTNSIAYCSQA 846

Query: 531 PVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQ 590
             L++ T+R+NI +  ++   +     V + C              T IG  G  LSGGQ
Sbjct: 847 AWLLNDTVRNNILFNSSFDENR--YHKVVEACGLKRDFDILKAGDLTEIGEKGITLSGGQ 904

Query: 591 KQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLST 648
           KQRI++ARAL      L+LD+  SA+D  +   I  N   G LM  ++  +VS  H ++ 
Sbjct: 905 KQRISLARALYSDSKHLLLDDCLSAVDSHTASWIYDNCITGPLMVGRTCILVS--HNIAL 962

Query: 649 IRRSENVIVLGHDGSVVEMG 668
             R+  ++V+  DG V + G
Sbjct: 963 TLRNAELVVILEDGRVKDQG 982

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  146 bits (368), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 144/533 (27%), Positives = 240/533 (45%), Gaps = 41/533 (7%)

Query: 180  IGCAA--NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYV 237
            +G AA  N    ++L   S R   +L   + K  +     FF+   VG +I+R  SD   
Sbjct: 1029 VGSAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPVGRIINRFSSDMDA 1088

Query: 238  VSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSK 297
            V  S+    S   K+++  +V V ++    P   +  +F     ++  + +    R   +
Sbjct: 1089 VDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLLGIYIYYQTFYIVLSRELKR 1148

Query: 298  DLQEATGQLTRVAEEQLSGIKTVQS------FVAEGNELSRYNVAIRDIFQVGXXXXXXX 351
             +  +   +  +  E L+G   + +      F+    E  +YN+     F+         
Sbjct: 1149 LISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNIDFVFNFRSTNRWLSVR 1208

Query: 352  XXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT-EYTGNAVFGLSTFYSE 410
                    +L   + LT+    +    + QLS G +   M Y+ E TG+  + + T    
Sbjct: 1209 LQTIGATIVLAT-AMLTLATMNT----KKQLSSGMVGLLMSYSLEVTGSLTWIVRTTVM- 1262

Query: 411  IMQGAGAASRLFE---LTDRKPSISPTVG-HKYQPERGVIEFKDVSFSYPTRPSVQ-IFK 465
            I     +  R+ E   L     SI+P     K  P RG IEFKD S  Y  R ++  + K
Sbjct: 1263 IETNIVSVERIVEYCELPSEAQSINPEKRPDKNWPSRGSIEFKDYSTKY--RENLDPVLK 1320

Query: 466  SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIG 525
             +N KI P   V IVG +G GKST++L L R   PT G I+ID  +I+ L    LR  + 
Sbjct: 1321 DINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGINISDLGLFDLRSHLA 1380

Query: 526  IVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF-------------- 571
            I+ Q+     GT++ N+     Y  +++E++   +       + K               
Sbjct: 1381 IIPQDAQAFEGTVKTNLDPFNRY--SEDELKKAVELAHLKPHLEKMLENEPSDSEESCDI 1438

Query: 572  PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQL 631
             +  D  I  +G+ LS GQ+Q + +ARAL+ +  IL+LDEAT+++D+E++  I  T  + 
Sbjct: 1439 KDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASIDMETDKIIQDTIRRE 1498

Query: 632  MKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
             K +  TI++IAHR+ T+  S+ +IVL  +GSV E     +L +N  S    L
Sbjct: 1499 FKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKEFDSPSKLLSNKASIFYSL 1548

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 88/328 (26%), Positives = 159/328 (48%), Gaps = 46/328 (14%)

Query: 398 GNAVFGLSTFYSEIMQGAGAASRL--FELTDRKPS-----ISPTVGHKYQPERGVIEFKD 450
            +A++ + +  + I++ + +  RL  F L+D         I P+V  +  P   VIE  +
Sbjct: 563 NSAIYSVPSMINTIIETSVSMKRLKSFLLSDEIDDSFIERIDPSVDERTLP---VIEMNN 619

Query: 451 VSFSYPTRPSV--------------------QI-FKSLN-FKIAPGSSVCIVGPSGRGKS 488
           ++F + ++ ++                    QI  K+++ F+   G+ VCIVG  G GKS
Sbjct: 620 ITFLWKSKEALASSQLENNSRADEESAMGSSQIALKNIDHFEAKRGNLVCIVGRVGAGKS 679

Query: 489 TIALLLLRYYNPTTGTIMIDNQDIT-KLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLT 547
           T    +L      +G+     + I  KL  +S    +    QE  +M+ ++++NI +G  
Sbjct: 680 TFLKAILGQLPCMSGS----KESIPPKLIIRS--SSLAYCSQESWIMNASVKENILFGHK 733

Query: 548 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTIL 607
           +     ++    K C     +   P+  +T++G  G  LSGGQK R+++ARA+  +  I 
Sbjct: 734 FDKAYYDL--TIKACQLLPDLRILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIY 791

Query: 608 ILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 665
           +LD+  SA+D E S+  I Y   G+    K+ TI+   + +S ++ S+ +  L  +G +V
Sbjct: 792 LLDDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTNTVSILKHSQMIYAL-ENGEIV 850

Query: 666 EMGKFKELY--ANSTSALSQLLNERAAP 691
           E G +  +    NSTS L +LL E  +P
Sbjct: 851 EQGNYDSVMNRENSTSKLKKLLEEFDSP 878

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  145 bits (367), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 136/497 (27%), Positives = 218/497 (43%), Gaps = 21/497 (4%)

Query: 201  ARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICG 256
            ARL   + K  L     FF+   VG +++R  +D Y    ++ RS +Q      K +   
Sbjct: 1015 ARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQFFIHVTKVVFTM 1074

Query: 257  IVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 316
            IV    +CS++ Q    +L  +   LF    + +  R   +        +    +E L+G
Sbjct: 1075 IV----ICSITWQFIFFILPLSVLYLFYQQYYLRTSRELRRLASVTKSPVYAHFQETLTG 1130

Query: 317  IKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYL 376
            + TV+SF  +   +      I                       +G +  L       + 
Sbjct: 1131 VTTVRSFKKQDRFIHINQSRINTYMCAYYLSINANRWLAFRLEFMGSIVILAAAVLSVFR 1190

Query: 377  VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS---ISP 433
            + Q +L+ G L   + Y      ++  +     E+     +  R+ E TD KP    I P
Sbjct: 1191 LKQGKLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTDLKPEAPMIIP 1250

Query: 434  TVGH-KYQPERGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIA 491
            T    K  P  G I+F+  S  Y  RP +  I + +N  I P   V IVG +G GKS++ 
Sbjct: 1251 TSRPPKNWPANGDIKFEHFSTRY--RPELDLILEDINLHIHPREKVGIVGRTGAGKSSLT 1308

Query: 492  LLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPT 551
            + L R      G I+ID+  I  +    LR  + I+ Q+  +  GT R+NI     +  T
Sbjct: 1309 VSLFRLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTFRENIDPCNKF--T 1366

Query: 552  KEEIRSVAKQCFC-HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
             +EI +  +      + +T      +T +   G+ LS GQ+Q + +ARAL+    IL+LD
Sbjct: 1367 DDEIWNALELAHLKQHVMTLGTEGLNTSLKEGGSNLSVGQRQLMCLARALLVPSKILVLD 1426

Query: 611  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
            EAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL   G + E    
Sbjct: 1427 EATAAIDVETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVVLDK-GRIAEFDTP 1483

Query: 671  KELYANSTSALSQLLNE 687
              L  + TS    L NE
Sbjct: 1484 CNLLKDETSIFYSLCNE 1500

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 122/262 (46%), Gaps = 25/262 (9%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           D ++ +  +P  ++  K++NF+   G   CIVG  G GKS +   +L       G+    
Sbjct: 619 DATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQAMLGDLFRVKGS---- 674

Query: 509 NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                     +L   +  V Q   +M+GTI+DNI +G  Y    E      K C     +
Sbjct: 675 ---------ATLHGSVAYVSQVSWIMNGTIKDNILFGYKYDA--EFYEKTIKACALSLDL 723

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
              P+   T +G  G  LSGGQK R+A+ARA+  K  +  LD+  +A+D   S+  + Y 
Sbjct: 724 NTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVKYV 783

Query: 628 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
            G     K+ T +   +++  +  ++++ +L  +G +V+ G + ++ +N  S L +L+  
Sbjct: 784 IGPTGLLKTKTRILTTNKIHVLSVADSITLLD-NGVIVQQGSYDQVNSNKDSPLFKLI-- 840

Query: 688 RAAPGPSDQQLQIEKVEEKEDT 709
            A  G    Q     +E  EDT
Sbjct: 841 -ANFGKQKSQ----AIENNEDT 857

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  145 bits (366), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 134/503 (26%), Positives = 225/503 (44%), Gaps = 46/503 (9%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266
            ++KK L+    FFD+  +G +++R   D   V + +T  V     +L+  +  V ++  +
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 979

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
            +P   ++ +F           +    R   +    +   + +   E L GI T+++F   
Sbjct: 980  TPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTIRAF--- 1036

Query: 327  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQ 381
            G+E       +  I +                  +  +    + A G +++L      S 
Sbjct: 1037 GDERRFMQENLEKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSLDSG 1096

Query: 382  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--TDRKPSISPTVGHKY 439
            L+   LT  + +TE        L   YS +     +  RL E    +++P    T  H  
Sbjct: 1097 LAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQST--HTP 1150

Query: 440  QPE---RGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
             PE   +G IE  D+S  Y P+ P  ++ K+++F + P   V IVG +G GKSTI   L 
Sbjct: 1151 PPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVSFTVDPNCKVGIVGRTGAGKSTIITALF 1208

Query: 496  RYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP----- 550
            R+ +P +G I IDN DIT +  K LR+ I I+ Q+P L +GT++ N+     Y+      
Sbjct: 1209 RFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDGQIFE 1268

Query: 551  --------TKEEIRSV-----AKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIA 597
                    T+EE+ S               + KF    D  I   G  LS GQ+Q + +A
Sbjct: 1269 ALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLRL-DNEITEGGANLSQGQRQLVCLA 1327

Query: 598  RALIKKPTILILDEATSALDVESEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVI 656
            R+L++ P +++LDEAT+++D  S+  I  T  G+   S   TI++IAHRL +I   + ++
Sbjct: 1328 RSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLRSIIDYDKIL 1384

Query: 657  VLGHDGSVVEMGKFKELYANSTS 679
            V+   G V E      L  N  S
Sbjct: 1385 VMDA-GEVKEYDHPYSLLLNKNS 1406

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 123/549 (22%), Positives = 235/549 (42%), Gaps = 63/549 (11%)

Query: 171 LSFFTVALLIGC----------AANFGRFILLR----ILSERVVARLRA----------- 205
           L++F V  +  C          A  FGR + +R    I+SE     LR            
Sbjct: 174 LAWFYVCSMFACRVLVAICQSQALFFGRRVCIRMKAIIISEIYTKALRRKTSPNKSKSPT 233

Query: 206 -HVIKKTLHQDAEFFDNHK-----VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVG 259
             V  +TL++  +   + +     +G +I+ +  DA+ VS  +   +   V+AL+  IV 
Sbjct: 234 DEVDPQTLNEQKDIDADEESSTANLGAIINLMAVDAFKVSE-ICAYLHSFVEALVMTIVA 292

Query: 260 VGMMCSL---SPQLSILLLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLS 315
           + ++  L   S  + +LL+    P+ F  A++ G    N  K+    T +  +   E   
Sbjct: 293 LTLLYKLLGWSAIVGVLLIIVILPLNFKLANLLG----NLQKETLSFTDKRIQKLNETFQ 348

Query: 316 GIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSY 375
            I+ ++ F  E N   +    IRD  ++                     S +T +++ +Y
Sbjct: 349 AIRIIKFFSWEEN-FEKDIQNIRDQ-ELKMLVKRSIVWALTAFVWFVTPSIVTTVSFATY 406

Query: 376 LVLQSQL--SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP 433
           + +Q ++  +    TA  L+T    N +  LS   S ++Q   +  R+    +   +   
Sbjct: 407 IYIQGEVLTTPVAFTALSLFT-LLRNPLDMLSDMLSYVIQSKVSLDRVQVFLEEDET--- 462

Query: 434 TVGHKYQP---ERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI 490
               KY      R  I F++ +FS+  +      K+++ +   G    ++GP+G GK+++
Sbjct: 463 ---EKYDQITVSRKRIGFENATFSWDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSL 519

Query: 491 ALLLLRYYNPTTGTIM---IDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLT 547
            + LL   +   G +    +D ++   +    +   I    Q   L++ T+++NI +   
Sbjct: 520 LMGLLGEMDLLEGKVYAPCLDPREDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFSSP 579

Query: 548 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTIL 607
           +   + +  +V + C              T IG  G  LSGGQKQR+++ARAL      L
Sbjct: 580 FNEARYD--AVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHL 637

Query: 608 ILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 665
           +LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   ++ + +V   +G V 
Sbjct: 638 LLDDCLSAVDSHTALWIYENCITGPLMEGRTCILVS--HNVALTLKNADWVVFMENGKVK 695

Query: 666 EMGKFKELY 674
           + G+  EL+
Sbjct: 696 DQGEPLELF 704

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  145 bits (365), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 145/560 (25%), Positives = 246/560 (43%), Gaps = 54/560 (9%)

Query: 156  FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQD 215
            F  K P F + LY   SFF  A  I     +     + I++ +    L    +K+ LH  
Sbjct: 927  FKNKSPSFYMGLY---SFFVFAAFIFMNGQYTILCAMGIMASK---WLNLKAVKRILHTP 980

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLS-PQLSILL 274
              + D   +G +++R   D   +   +T+ +   + +    IVGV +MC +  P  +I +
Sbjct: 981  MSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAI 1039

Query: 275  LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
             F     +  A  +    R   +        +     E L G+ T++++ ++   L++ +
Sbjct: 1040 PFLLIIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSD 1099

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDL-SFLTVLAYGSYLVLQSQLSIGDLTAFMLY 393
              I  + + G               ++  + + +  L   +     S  S+G +  ++L 
Sbjct: 1100 FLINKMNEAGYLVVVLQRWVGIFLDMVAIVFALIITLLCVTRAFPISAASVGVMLTYVLQ 1159

Query: 394  TEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTVGHKYQPERGVIEF 448
                 N +    T     M  A      A+ L  E   RKP ++P    +  P +G I F
Sbjct: 1160 LPGLLNTLLRALTQTENDMNSAERLVSYATELPLEADYRKPEMAPP---ESWPSKGEIAF 1216

Query: 449  KDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI 507
            K+V FSY  RP + +  K+LN  I  G  + I G +G GKSTI   L R    + G I+I
Sbjct: 1217 KNVDFSY--RPGLPVVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELSGGEILI 1274

Query: 508  DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP----TKEEIR------- 556
            D+ +I+++    LRR++ I+ Q+PVL  GTIR N+       P    T++E+        
Sbjct: 1275 DDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNL------DPFNERTEDELWDALVRGG 1328

Query: 557  SVAKQCF------------CHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKP 604
            ++AK                H  + KF    D  +   G+  S G++Q +A+ RAL+++ 
Sbjct: 1329 AIAKNDLPEVKLQKPEENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQS 1386

Query: 605  TILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 664
             ILILDEATS++D E++G I     +  +    TI+ IAHRL TI   + ++VL   G V
Sbjct: 1387 KILILDEATSSVDYETDGKIQVRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-EKGEV 1443

Query: 665  VEMGKFKELYANSTSALSQL 684
             E      L++   S    +
Sbjct: 1444 AEFDTPWALFSQEDSIFKNM 1463

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 114/228 (50%), Gaps = 20/228 (8%)

Query: 458 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNC 517
           + S + FK L+F+I  G  + I GP G GKS++   +      T G I + N D+  L C
Sbjct: 598 KTSFKGFKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEV-NGDL--LMC 654

Query: 518 KSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + + T++DNI +G  +   KE+   V   C     +   P    T
Sbjct: 655 GY-----------PWIQNATVKDNIIFGSPFN--KEKYDEVIHVCSLKADLDILPAGDMT 701

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKS 636
            IG  G  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     L+++K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENKT 761

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
             + +  H+LS I ++  VIVLG DG  V++G   EL A + + ++ L
Sbjct: 762 RVLAT--HQLSLIEKASRVIVLGTDGD-VDIGTVDELKARNQTLINLL 806

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 144/575 (25%), Positives = 257/575 (44%), Gaps = 52/575 (9%)

Query: 171  LSFFTVALLIGCAANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            + +  + L+IG A +    G+ IL  +       ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLVLYLIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKLRFFDATPTGRI 1161

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASV 287
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ   + +  +    F    
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSIMYYFIGYF 1221

Query: 288  FGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXX 347
            +    R   +    +   + +   E L G+ T+++F  EG  +      I +  +     
Sbjct: 1222 YMAGSRELKRYESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYL 1281

Query: 348  XXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEYTGNAVF 402
                        ++G L    +   G +++     L S ++   LT  + +TE       
Sbjct: 1282 WVANRWLAFRIDMIGSL---VIFGAGLFILSNIDHLDSGMAGISLTYAISFTE----GAL 1334

Query: 403  GLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YQPERGVIEFKDVSFSY-P 456
             L   YSE+     +  R+ E  + +    P   HK       P+ G IE  D+S  Y P
Sbjct: 1335 WLVRLYSEVEMNMNSVERVKEYMEIEQE--PYNQHKEVPPPQWPQDGKIEVNDLSLRYAP 1392

Query: 457  TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLN 516
              P  ++ K+++F +   S V IVG +G GKSTI   L R+  P TG I IDN DI+ ++
Sbjct: 1393 NLP--RVIKNVSFSVDAQSKVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNIDISNVD 1450

Query: 517  CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTK------------EE------IRSV 558
             + LRR I I+ Q+P L SGTI+ N+     ++  K            EE      +R V
Sbjct: 1451 LQRLRRSITIIPQDPTLFSGTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQQGTVREV 1510

Query: 559  AKQCFCHNF--ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
            A      +   + KF +  ++ +   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++
Sbjct: 1511 ATDTSSADSENVNKFLDL-ESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASI 1569

Query: 617  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
            D  S+  I  T  +  + +  TI++IAHRL ++   + ++V+   G V E      L  N
Sbjct: 1570 DYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVMDA-GEVKEYDHPYSLLLN 1626

Query: 677  STS---ALSQLLNERAAPGPSDQQLQIEKVEEKED 708
              S   ++ +   E      S ++  +EK+  K+D
Sbjct: 1627 KQSIFYSMCEHSGELEILVESAKKAFVEKLNSKKD 1661

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 116/533 (21%), Positives = 219/533 (41%), Gaps = 50/533 (9%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRAHVI----------------K 209
           F+    VA+    A  FGR + +R    I+SE     LR  +                 +
Sbjct: 401 FVGRILVAVCQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPAAEDPQAINDQ 460

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ 269
           K+++ D E   +  +G +I+ +  DA+ VS  +   +   ++A +  +V + ++  L   
Sbjct: 461 KSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALVLLYRLLGL 519

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
            +IL +     +L       K I +  K     T    +   E    I+ ++ F  E N 
Sbjct: 520 AAILGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEEN- 578

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQL--SIG 385
              +   I+ I +                S +  ++   +T  ++  Y+ +Q ++  +  
Sbjct: 579 ---FENDIKAIRESELALLLMRSIIWSISSFVWFVTPTIVTAASFAYYIYVQGEVLTTPV 635

Query: 386 DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQ----- 440
             TA  L+T    + +  LS   S ++Q   +  R+ +  + K +       KY      
Sbjct: 636 AFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDT------EKYDQLTID 688

Query: 441 PERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
           P      F++ + S+         K LN +   G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 501 TTGTIMI---DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRS 557
             G +++   D +    +        I    Q   L++ T+++NI +   +  T+   ++
Sbjct: 749 LNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNETR--YKA 806

Query: 558 VAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
           V + C              T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 618 VESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
             +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 144/531 (27%), Positives = 249/531 (46%), Gaps = 64/531 (12%)

Query: 188  RFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVS 247
            +F LL  L  R    L    +++ LH    + D   +G +++R   D    + S+  +++
Sbjct: 918  QFTLLCTLGLRASKWLNLKAVERILHTPMSYLDTTPLGRILNRFTKD----TDSLDNELT 973

Query: 248  DGVKALIC---GIVGVGMMCSLS-PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ--E 301
            + ++ ++     ++GV +MC +  P  +I +    P +L    +     ++T ++++  E
Sbjct: 974  ESIRLMLSQVGNLIGVIVMCIVYLPWFAIAV----PFLLIIFVLICDHYQSTGREIKRLE 1029

Query: 302  ATGQ--LTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 359
            A  +  +     E L G+ T++++ ++   L++ +  I  + + G               
Sbjct: 1030 AVQRSFVYNNFNEVLGGMDTIKAYGSQERFLAKTDYLINKMNEAGYLIVAVQRWVAI--- 1086

Query: 360  LLGDLSFLTVLAYGSYLVLQ----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA 415
            LL  ++ +  L      V +    S  S+G L  ++L      N +    T     M  A
Sbjct: 1087 LLDSVAVVFALIITLLCVTRAFPISAGSVGVLLTYVLQLPGLLNTILRALTQTENDMNSA 1146

Query: 416  G-----AASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQI-FKSLNF 469
                  A     E   RKP +SP    +  PE+G I+F DV+F+Y  RP + +  K++N 
Sbjct: 1147 ERLVTYATELPLEAAYRKPEVSPP---ESWPEKGDIDFIDVNFAY--RPGLPVVLKNMNL 1201

Query: 470  KIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQ 529
            KI  G  + I G +G GKSTI   L R    + G I+ID  DI K+    LR+++ I+ Q
Sbjct: 1202 KINNGEKIGICGRTGAGKSTIMSALYRLNELSDGKIVIDGVDIRKIGLYDLRKKLTIIPQ 1261

Query: 530  EPVLMSGTIRDNITYGLTYTPTKE---------EIRS-VAKQCFCHNFITKFP---NTY- 575
            +PVL  GTIR N+       P KE          IR+ V ++   ++   + P   N+Y 
Sbjct: 1262 DPVLFRGTIRKNL------DPFKECSDDLLWDALIRTGVVERENLNDIKLEKPDENNSYS 1315

Query: 576  -------DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
                   D ++   G+  S G++Q +A+ RAL++   ILILDEATS++D E++G I    
Sbjct: 1316 NMHKFHLDELVEEEGSNFSLGERQMLALTRALVRNSKILILDEATSSVDYETDGKIQSRI 1375

Query: 629  GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
              + +    TI+ IAHRL TI   + ++VL   G + E  K  EL+ +  S
Sbjct: 1376 --VSEFGDCTILCIAHRLKTILSYDKILVL-EKGVIAEYEKPWELFNDKNS 1423

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 109/224 (48%), Gaps = 24/224 (10%)

Query: 464 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           F  LN +I  G  + + GP G GK+++   +  +   T+G + ++ +    L C      
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE---LLLCGY---- 633

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITKFPNTYDTVIGP 581
                  P +++ T+RDNI +G  Y    EE R   + + C     +   P    T IG 
Sbjct: 634 -------PWILNATVRDNILFGSPY----EEARYNEIVEVCSLDADLKILPAGDRTEIGE 682

Query: 582 HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIV 640
            G  LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     ++K K+  + 
Sbjct: 683 RGITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGKTRILA 742

Query: 641 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
           +  H+LS I R++ +IV+G +GS  + G   EL   + + +S L
Sbjct: 743 T--HQLSVIERADRIIVVGPNGS-FDFGTLDELKGRNQTLVSLL 783

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 125/482 (25%), Positives = 221/482 (45%), Gaps = 47/482 (9%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266
            ++ K +H    FFD+  +G +++R   D     + +T  +     +L+  +  V ++  +
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 267  SPQ------LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 320
            +PQ      L  +L +F      + S   K++ + S+        + +   E L G+ T+
Sbjct: 1188 TPQFLFVAILVAVLYYFVGYFYLTGSRELKRLESISR------SPIYQHFSETLVGVTTI 1241

Query: 321  QSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ- 379
            ++F   G+E       ++ I +                  +  +  L +   G +++L  
Sbjct: 1242 RAF---GDESRFMRENLQKIDENNRPFFYLWVANRWLSFRIDMIGALVIFGAGIFVLLNI 1298

Query: 380  SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD--RKPS----ISP 433
              +  G     + Y          L   YS +     +  RL E  D  ++P     ++P
Sbjct: 1299 DHIDSGKAGISLTYAITFTEGALWLVRLYSNVEMNMNSVERLKEYMDVEQEPYDQSILTP 1358

Query: 434  TVGHKYQPERGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIAL 492
             V     P++G IE  D+S  Y P  P  ++ K+++F + P S V IVG +G GKSTI  
Sbjct: 1359 PVE---WPQQGRIEVNDLSLRYAPNLP--KVIKNVSFTVDPRSKVGIVGRTGAGKSTIIT 1413

Query: 493  LLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP-- 550
             L R+ +P TG I IDN DIT ++ + LRR I I+ Q+P L +GTI+ N+     YT   
Sbjct: 1414 ALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLDPYDEYTDQQ 1473

Query: 551  -----------TKEEIR---SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAI 596
                       T+EE+    +          I KF +   + I   G  +S GQ+Q + +
Sbjct: 1474 IFEALKRVNLVTQEELDRRPTSESSSVSSENINKFLDL-SSEISEGGGNISQGQRQLVCL 1532

Query: 597  ARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 656
            AR+L++ P I++LDEAT+++D  S+  I  T  +       TI++IAHRL ++   + ++
Sbjct: 1533 ARSLLRSPKIILLDEATASIDYASDAKIQETIRKEFGGN--TILTIAHRLRSVIDYDKIL 1590

Query: 657  VL 658
            V+
Sbjct: 1591 VM 1592

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 105/479 (21%), Positives = 212/479 (44%), Gaps = 38/479 (7%)

Query: 209 KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSP 268
           ++ ++ D E   +  +G +I+ +  DA+ VS  +   +   V+A++  +V   ++  L  
Sbjct: 462 QEQINGDEESTTSANLGAIINLMAVDAFKVSE-ICAYLHAFVEAVVMALVAFVLLYHLLG 520

Query: 269 QLSIL---LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 325
             +I+   L+    P+ F  + +   ++   K+    T +  +   E    I+ ++ F  
Sbjct: 521 FAAIVGAALIVAMMPLNFKLATWLGHLQ---KETLSVTDKRIQKLNEAFQAIRIIKFFSW 577

Query: 326 EGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQLS 383
           E N    +   IRD+ +                S +  ++   +T  A+  Y+ +Q ++ 
Sbjct: 578 ENN----FEKDIRDVRETELKFLMKRSLVWAGSSFVWYITPTIVTSCAFWFYIYIQGEVL 633

Query: 384 IGDL--TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQ- 440
              +  TA  L++      +  LS   S ++Q   +  R+ E  + K +       KY  
Sbjct: 634 TTPIAFTALSLFS-LLRTPLDQLSDMLSFVIQSKVSLDRVQEFLEEKDT------EKYNQ 686

Query: 441 ----PERGVIEFKDVSFSYPT-RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
                ++  I F++ + ++   RP  ++ K+LN     G    I+GP+G GK+++ + LL
Sbjct: 687 LSTAKDKKKIGFENATITWDAERPDFKL-KNLNIDFKVGKLNVIIGPTGSGKTSLLMALL 745

Query: 496 RYYNPTTGTIMIDNQDITK---LNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTK 552
              +  +G I++ + D  +   +    +   +    Q   L++ T+++NI +   Y   +
Sbjct: 746 GEMHLVSGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFNSPYNEGR 805

Query: 553 EEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEA 612
            E  +V + C      +       T IG  G  LSGGQKQRI++AR+L      ++LD+ 
Sbjct: 806 YE--AVVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDC 863

Query: 613 TSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            SA+D  +   I  N   G LM+ ++  +VS  H  +   R+  ++V   +G V   G+
Sbjct: 864 LSAVDSHTASWIYDNCITGPLMEGRTCILVS--HNTALTLRNAELVVTMENGQVKNQGE 920

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 135/495 (27%), Positives = 231/495 (46%), Gaps = 53/495 (10%)

Query: 200  VARLRAH------VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 253
            VA +RA       ++K  L+    FFD+  +G +++R   D   + + +T  +     +L
Sbjct: 1123 VAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSL 1182

Query: 254  ICGIVGVGMMCSLSPQLSI-----LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
            I  +  + ++  ++PQ  I     +LLF+     F A  +    R   +    +   + +
Sbjct: 1183 IQCVSTIIVIAYITPQFLIVAAIVMLLFY-----FVAYFYMSGARELKRLESMSRSPIHQ 1237

Query: 309  VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
               E L GI T+++F  E   L      I D  +                 L+G L    
Sbjct: 1238 HFSETLVGITTIRAFSDERRFLVDNMKKIDDNNRPFFYLWVCNRWLSYRIELIGAL---I 1294

Query: 369  VLAYGSYLVLQSQLSIGDLTAFML--YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT- 425
            VLA GS+++L  +     L    L    ++T  A++ +   YS +     +  RL E T 
Sbjct: 1295 VLAAGSFILLNIKSIDSGLAGISLGFAIQFTDGALW-VVRLYSNVEMNMNSVERLKEYTT 1353

Query: 426  -DRKPS-ISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPS 483
             +++PS +   V     P+ G IE KD+S  Y      ++ K++ F +     V IVG +
Sbjct: 1354 IEQEPSNVGALVPPCEWPQNGKIEVKDLSLRYAAGLP-KVIKNVTFTVDSKCKVGIVGRT 1412

Query: 484  GRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNIT 543
            G GKSTI   L R+ +P TG I ID+ DIT +  K LR+ I I+ Q+P L +GT++ N+ 
Sbjct: 1413 GAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLKTNLD 1472

Query: 544  YGLTYTPTKEEIRSVAKQCFCHNFITK----FPNTYDTV----------------IGPHG 583
                Y  ++ EI    K+    N ++      P+T D+                 +   G
Sbjct: 1473 PYNEY--SEAEIFEALKRV---NLVSSEELGNPSTSDSTSVHSANMNKFLDLENEVSEGG 1527

Query: 584  TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 643
            + LS GQ+Q I +AR+L++ P +++LDEAT+++D  S+  I  T  +   +   TI++IA
Sbjct: 1528 SNLSQGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSNS--TILTIA 1585

Query: 644  HRLSTIRRSENVIVL 658
            HRL +I   + ++V+
Sbjct: 1586 HRLRSIIDYDKILVM 1600

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 124/555 (22%), Positives = 226/555 (40%), Gaps = 75/555 (13%)

Query: 167 LYEFLSFFTVALLIGCAAN---FGRFILLR----ILSERVVARLRAHVI----------- 208
           +Y FL F    L   CAA     GR + +R    I+SE     LR  +            
Sbjct: 400 MYIFLMFLARILTAICAAQALFLGRRVCIRMKAIIISEIYSKALRRKISPNSTKEPTDVV 459

Query: 209 -------KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVG 261
                  K+ +  D E      +G +I+ +  DA+ VS  +   +   ++A+I  IV + 
Sbjct: 460 DPQELNDKQHVDGDEESATTANLGAIINLMAVDAFKVSE-ICAYLHSFIEAIIMTIVALF 518

Query: 262 MMCSLSPQLSI----LLLFFTPPVLFSASVFG----KQIRNTSKDLQEATGQLTRVAEEQ 313
           ++  L    ++    +++ F P     AS+ G    K +  T K +Q+          E 
Sbjct: 519 LLYRLIGWSALVGSAMIICFLPLNFKLASLLGTLQKKSLAITDKRIQKLN--------EA 570

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL--SFLTVLA 371
              I+ ++ F  E N    +   I++                   SL+  +  S +T  +
Sbjct: 571 FQAIRIIKFFSWEEN----FEKDIQNTRDEELNMLLKRSIVWALSSLVWFITPSIVTSAS 626

Query: 372 YGSYLVLQSQ-----LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD 426
           +  Y+ +Q Q     ++   L+ F L      N +  LS   S ++Q   +  R+ E  +
Sbjct: 627 FAVYIYVQGQTLTTPVAFTALSLFALLR----NPLDMLSDMLSFVIQSKVSLDRVQEFLN 682

Query: 427 RKPSISPTVGHKYQP---ERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPS 483
            + +       KY+     R  +  ++ +F++         K+L      G    IVGP+
Sbjct: 683 EEET------KKYEQLTVSRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPT 736

Query: 484 GRGKSTIALLLLRYYNPTTGTIMI---DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRD 540
           G GK+++ + LL       G + +   + ++   +    +   I    Q   L++ T+R+
Sbjct: 737 GSGKTSLLMGLLGEMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRN 796

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600
           NI +   Y   +    +V   C              T IG  G  LSGGQKQR+++AR+L
Sbjct: 797 NILFNAPYNENR--YNAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSL 854

Query: 601 IKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
                 L+LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   ++ + +++
Sbjct: 855 YSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGRTCVLVS--HNVALTLKNADWVII 912

Query: 659 GHDGSVVEMGKFKEL 673
             +G V E G+  EL
Sbjct: 913 MENGRVKEQGEPVEL 927

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 145/521 (27%), Positives = 230/521 (44%), Gaps = 80/521 (15%)

Query: 211  TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQL 270
             LH    FFD   VG +++R   D             +G+   +   + V + C +    
Sbjct: 1082 VLHAKIRFFDVTPVGRIMNRFSKDI------------EGIDQELIPYLEVTVFCLIQCSS 1129

Query: 271  SILLLFFTPPVLFSASVF--------GKQIRNTSKDLQE----ATGQLTRVAEEQLSGIK 318
             +LL+    P  FS +V         GK     S+DL+         + +   E L G+ 
Sbjct: 1130 ILLLIVVITPRFFSVAVIVFILYYFVGKWYLKASRDLKRIDSITKSPIFQHFSETLVGVC 1189

Query: 319  TVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV- 377
            T+++F   G+E       +  I Q                  +  +    VL  GS+++ 
Sbjct: 1190 TIRAF---GDEKRFILENMEKIDQNNKAFFYLSVAVKWFAFRVDMIGAFIVLGSGSFILF 1246

Query: 378  ----LQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP 433
                + S L+   LT  +L+T+    +   L   YS       +  RL E        S 
Sbjct: 1247 NIDNIDSGLAGISLTYAILFTD----SALWLVQLYSRFEMNMNSVERLKEY-------SS 1295

Query: 434  TVGHKY---------------QPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVC 478
             V  KY                P+ G IE +++S  Y +   + + K++ FK+ P S V 
Sbjct: 1296 IVQEKYLGYDEDHIQALNDSSWPKHGKIEVENLSLRYASNLPL-VLKNVCFKVDPQSKVG 1354

Query: 479  IVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTI 538
            IVG +G GKSTI   L R   P TG I ID+QDI+K++  +LRR I I+ Q+PVL +GTI
Sbjct: 1355 IVGRTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTI 1414

Query: 539  RDNITYGLTYTPTK--------EEIRSVA-KQCF----CHNFITKFPNTYDTVIGPHGTL 585
            + NI     Y   +          I S+  KQ F      N   KF N    ++   G  
Sbjct: 1415 KSNIDPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSEIV-EGGLN 1473

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIA 643
            LS G++Q + IAR+L+++  I++LDEATS++D +S+  I      +++SK    TI++IA
Sbjct: 1474 LSQGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQ----SIIRSKFNKSTILTIA 1529

Query: 644  HRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
            HRL ++   + ++V+   G + E G   EL  N  S   ++
Sbjct: 1530 HRLRSVIYYDKILVMDA-GEIKEYGHPYELLKNERSTFYRM 1569

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 115/242 (47%), Gaps = 14/242 (5%)

Query: 441 PERGVIEFKDVSFSYPTRPS-VQIFK--SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 497
           P+R  IEFK  +  +    + +  FK   LN   + G    ++G +G GKS + + LL  
Sbjct: 659 PDRNKIEFKKANLVWNENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLGE 718

Query: 498 YNPTTGTIMID----NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKE 553
            +  +G I+I       D+   +   L        Q   L+S TI++NI +  +Y   K 
Sbjct: 719 LDLVSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYD--KS 775

Query: 554 EIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEAT 613
             + V   C  +  +   P    T IG  G  LSGGQKQRI++ARA+      ++LD+  
Sbjct: 776 RYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDCL 835

Query: 614 SALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 671
           SA+D  +   I  N   GQLMK+++  +V+  H +    R+ +  ++  DG V   G  K
Sbjct: 836 SAVDSHTAVWIYENCITGQLMKNRTCILVT--HNVPLAIRNAHFAIILEDGKVKNQGTIK 893

Query: 672 EL 673
           EL
Sbjct: 894 EL 895

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 150/543 (27%), Positives = 248/543 (45%), Gaps = 66/543 (12%)

Query: 173  FFTVALLIGC-AANFGRF-ILLRILS-ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLIS 229
            + TV  LIG   A  G F  ++  LS  R   ++  +++   LH    FFD   VG +++
Sbjct: 1041 YLTVYFLIGIIQAMLGGFKTMMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMN 1100

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVF- 288
            R   D   V + +   +   +  LI     + ++  ++P+      F T  V+     F 
Sbjct: 1101 RFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPR------FLTVAVIVFVLYFF 1154

Query: 289  -GKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQV 343
             GK     S++L+         + +   E L G+ T+++F   G+E       +  I Q 
Sbjct: 1155 VGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAF---GDERRFILENMNKIDQN 1211

Query: 344  GXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQLSIGDLTAFMLYTEYTG 398
                             +  +    VLA GS+++L      S L+   LT  +L+T+   
Sbjct: 1212 NRAFFYLSVTVKWFSFRVDMIGAFIVLASGSFILLNIANIDSGLAGISLTYAILFTD--- 1268

Query: 399  NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK----------YQPERGVIEF 448
                 L   YS       +  RL E +  +      +GH             P+ G IE 
Sbjct: 1269 -GALWLVRLYSTFEMNMNSVERLKEYSSIEQE--NYLGHDEGRILLLNEPSWPKDGEIEI 1325

Query: 449  KDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI 507
            +++S  Y P  P V   ++++FK+ P S + IVG +G GKSTI   L R   P TG I I
Sbjct: 1326 ENLSLRYAPNLPPV--IRNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKI 1383

Query: 508  DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTK-----EEIRSVAKQC 562
            D QDI+K++  +LRR I I+ Q+P+L +GTI+ N+     Y   K      ++  ++   
Sbjct: 1384 DGQDISKIDLVTLRRSITIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHE 1443

Query: 563  F--CHNFITKFPNTYDTVIGPH------GTLLSGGQKQRIAIARALIKKPTILILDEATS 614
            F    N   +F +T++  +  H      G  LS G++Q + IAR+L+++P I++LDEATS
Sbjct: 1444 FEEVLNSEERFNSTHNKFLNLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATS 1503

Query: 615  ALDVESE----GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
            ++D +S+    G I   F +       TI++IAHRL ++   + +IV+   G V E  + 
Sbjct: 1504 SIDYDSDHLIQGIIRSEFNK------STILTIAHRLRSVIDYDRIIVMDA-GEVKEYDRP 1556

Query: 671  KEL 673
             EL
Sbjct: 1557 SEL 1559

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 142/521 (27%), Positives = 229/521 (43%), Gaps = 62/521 (11%)

Query: 223 KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMM-----CSLSPQLSILLLFF 277
            +G +I+ +  D++ VS  +   +   V+A+I  IV VG++      S    +SI+L+ F
Sbjct: 444 NLGTIINLISIDSFKVSE-LANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMF 502

Query: 278 TPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAI 337
            P     A++ GK  + T K     T Q      E L  I+ V+ F  E N        I
Sbjct: 503 -PLNFLLANLLGKFQKQTLK----CTDQRISKLNECLQNIRIVKYFAWERN-------II 550

Query: 338 RDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT-VLAYGSYLVLQSQLSIGDLTAFMLYTEY 396
            +I  +               S+   L F+T  L  G    + + +   DL A + +T  
Sbjct: 551 NEIKSIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFAICTFVQHEDLNAPLAFTTL 610

Query: 397 TGNAVFG-----LSTFYSEIMQGAGAASRL---FELTDRKPSISPTVGHKYQPERGVIEF 448
           +   +       LS   S I Q   +  R+     + D +     T+     P++  IEF
Sbjct: 611 SLFTLLKTPLDQLSNMLSFINQSKVSLKRISDFLRMDDTEKYNQLTIS----PDKNKIEF 666

Query: 449 KDVSFSYPTRPS-VQIFK--SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           K+ + ++    S +  FK   LN K   G    I+G +G GKS + L LL   N  +G+I
Sbjct: 667 KNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSI 726

Query: 506 MIDN----QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561
           ++ +     D+   +C+ L        Q   L++ T+++NI +   Y   ++    V   
Sbjct: 727 IVPSLEPKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYN--EDRYNKVIDA 783

Query: 562 CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
           C     +   P    T IG  G  LSGGQKQRI++ARA+      ++LD+  SA+D  + 
Sbjct: 784 CGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTA 843

Query: 622 GAI--NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENVIVL-----GHDGSVVEM---GKF 670
             I  N   G LMK++  T + + H +S T+R +   IVL      + G++ E+   G F
Sbjct: 844 VWIYENCITGPLMKNR--TCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITELQSKGLF 901

Query: 671 KELYANSTSALSQLLNER-----AAPGPSDQQLQIEKVEEK 706
           KE Y   +S  S  +NE+      AP  +D Q +IE V E 
Sbjct: 902 KEKYVQLSSRDS--INEKNANRLKAPRKNDSQ-KIEPVTEN 939

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 136/506 (26%), Positives = 231/506 (45%), Gaps = 55/506 (10%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266
            ++ K LH +  FFD+  +G +++R   D   V + +   +   +  +I     + ++  +
Sbjct: 1144 LLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTILLITYI 1203

Query: 267  SPQLSILL-----LFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGI 317
            +P+  I+      L++   VL+ A          S++L+         + +   E L G+
Sbjct: 1204 TPEFLIIAILVAGLYYAIGVLYLAG---------SRELKRFDSITKSPIYQHFSETLVGV 1254

Query: 318  KTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV 377
             TV+++  E     R N+ + D  +                  +  +  L +   G +++
Sbjct: 1255 TTVRAYGDEA-RFMRENLKMID--ENNKPFFYLWVSNRWLAFRIDVVGALVIFGSGVFVL 1311

Query: 378  LQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--TDRKPS 430
            L      S L+   L+  + +TE    +   L   YS +     +  RL E    +++P 
Sbjct: 1312 LNIDKIDSGLAGISLSFAISFTE----SALWLVRHYSNLEMNMNSVERLMEYMEVEQEPY 1367

Query: 431  ISPTVG-HKYQPERGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKS 488
             S ++      PE G IE  DVS  Y P  P  ++ K+  F + P   V IVG +G GKS
Sbjct: 1368 KSSSLDVPSSWPEEGKIEVNDVSLRYAPNLP--RVIKNATFTVDPKMKVGIVGRTGAGKS 1425

Query: 489  TIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTY 548
            TI   L R+ +P TG+I IDN DI+ +  K LRR I I+ Q+P L SGTI+ N+     Y
Sbjct: 1426 TIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIKSNLDPYDEY 1485

Query: 549  TP-------------TKEEIRS--VAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQR 593
            +              T++E+ S    +Q        KF N  +  I   G+ LS GQ+Q 
Sbjct: 1486 SEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLNV-NNEISEGGSNLSQGQRQL 1544

Query: 594  IAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 653
            + +AR+L++ P +++LDEAT+++D  S+  I  T     +    TI++IAHRL T+   +
Sbjct: 1545 VCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIAHRLRTVIDYD 1602

Query: 654  NVIVLGHDGSVVEMGKFKELYANSTS 679
             ++V+   G V E      L  N  S
Sbjct: 1603 KILVMDA-GEVKEFDHPYSLLLNKNS 1627

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 130/559 (23%), Positives = 238/559 (42%), Gaps = 85/559 (15%)

Query: 167 LYEFLSFFTVALLIGCAAN---FGRFILLRILSERVVARLRAHVIKKTL----------- 212
           LY FL FF   ++  C+     FGR + +R+ S  +V+ + +  +K+ +           
Sbjct: 398 LYVFLMFFCRVIVAACSGQALFFGRRVCVRMRS-ILVSEIYSKALKRKISNDKSASLKDL 456

Query: 213 ----------HQDAEFFDNHK------VGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256
                       D E  D  +      +G +I+ +  D + V+  +   +   V+A++  
Sbjct: 457 NEQEEVDPQIENDLENIDGDEESKSSNLGSIINLMAVDTFKVA-DICAYLHHFVEAVVMT 515

Query: 257 IVGVGMMCSLSPQLSIL---LLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEE 312
           IV + ++  L    +I+   L+    P+ F  AS+ GK      K   E T +  +   E
Sbjct: 516 IVALILLFKLLGVAAIVGASLIIALLPLNFKLASLLGKY----QKKSLEVTDKRIQKLNE 571

Query: 313 QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTV--- 369
               I+ ++ F  E N         +DI +V               ++   + F+T    
Sbjct: 572 AFQAIRIIKFFSWEDN-------FEKDILEVRERELRMILIRSIVWAISSFVWFVTPTIV 624

Query: 370 --LAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGL--------STFYSEIMQGAGAAS 419
              ++  Y+ +Q ++         +   +T  ++F L        S   S ++Q   +  
Sbjct: 625 TGASFTYYVYVQGEV-------LTIPVAFTALSLFALLKIPLDTFSDMLSFVIQSKVSLD 677

Query: 420 RL---FELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSS 476
           R+    E  D K     TV  KYQ +   I FK+ + ++         ++++     G  
Sbjct: 678 RIQEFLEEEDTKKYEQLTV-DKYQNK---IAFKNATTTWNKEKQDFKLRNIDIDFKIGKL 733

Query: 477 VCIVGPSGRGKSTIALLLLRYYNPTTGTIMI---DNQDITKLNCKSLRRQIGIVQQEPVL 533
             I+GP+G GK+++ + LL   +   G I++   D ++  KL+   L   I    Q   L
Sbjct: 734 NVIIGPTGSGKTSLLMALLGEMDLIDGEIIVPCLDPREDLKLDANGLTNSIAYCSQAAWL 793

Query: 534 MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD-TVIGPHGTLLSGGQKQ 592
           ++ T+R+NI +    +P  EE  +   +        +  N  D T IG  G  LSGGQKQ
Sbjct: 794 LNDTVRNNILFN---SPYCEERYNAVVEASGLKRDFEILNAGDMTEIGERGITLSGGQKQ 850

Query: 593 RIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIR 650
           R+++ARAL      L+LD+  SA+D  +   I  N   G LM++++  +VS  H ++   
Sbjct: 851 RVSLARALYSNSKHLLLDDCLSAVDSHTATWIYDNCISGPLMENRTCILVS--HNIALTL 908

Query: 651 RSENVIVLGHDGSVVEMGK 669
           R+ + +V   +G +VE G+
Sbjct: 909 RNADYVVKLENGKIVEHGE 927

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  142 bits (359), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 142/553 (25%), Positives = 254/553 (45%), Gaps = 63/553 (11%)

Query: 141  GIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVAL---LIGCAANFGRFILLRILSE 197
             I+L++  + S S++   K+   +   Y  + +F + L   ++G       F  + I + 
Sbjct: 1072 NILLNSCDSKSASEYVTQKVNNHTTKYY-LIIYFAIGLAHSILGSIKTMLSF-YVGINAS 1129

Query: 198  RVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGI 257
            R + +L   ++ K LH    FFD+  +G +++R   D   + + +T  V   V   +  I
Sbjct: 1130 RKIFKL---LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYVESVVYNSVQLI 1186

Query: 258  VGVGMMCSLS------PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 311
              V ++  ++        L ILL +F      S S   K+  +T+K        + +   
Sbjct: 1187 ATVLLITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTK------SPIYQHFS 1240

Query: 312  EQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLA 371
            E L G+ T++++   G+E+      +  I +                  +  +  L +  
Sbjct: 1241 ETLVGVTTIRAY---GDEIRFMKENLTKIDENNKPFFYLWVANRWLCFRIDIIGSLVIFG 1297

Query: 372  YGSYLVLQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD 426
             G  +++      S L+   LT  + +TE    +   L   YS +     +  R+ E  D
Sbjct: 1298 AGVLVLMNINKIDSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMD 1353

Query: 427  --RKPSISPTVG-HKYQPERGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGP 482
              ++P  +  V   K  P  G IE  D+S  Y P+ P  ++ K+++F + P   V +VG 
Sbjct: 1354 IEQEPYSAGIVNVDKSWPSEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGR 1411

Query: 483  SGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNI 542
            +G GKSTI   L R+ +P TG I IDN DIT ++ K LR+ I I+ Q+P L +GTI+ N+
Sbjct: 1412 TGAGKSTIITALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNL 1471

Query: 543  TYGLTYTPTK-----------------EEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL 585
                 Y   +                  ++ SV+ +      + KF N   + I   G+ 
Sbjct: 1472 DPYNEYNDDQIFKALRRVNLIVDGNLNSDVTSVSSEN-----VNKFLNL-QSEISEGGSN 1525

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T     + K  TI++IAHR
Sbjct: 1526 LSQGQRQLMCLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHR 1583

Query: 646  LSTIRRSENVIVL 658
            L ++   + ++V+
Sbjct: 1584 LRSVIDYDKILVM 1596

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 126/542 (23%), Positives = 228/542 (42%), Gaps = 67/542 (12%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRAHVI----------------- 208
           FL+  TVA+  G A  FGR I +R    I+SE     LR  V                  
Sbjct: 404 FLARATVAVSDGLALFFGRRICIRMRSIIISEIYSKALRRQVSNSSDAEKSKDDFEIDPQ 463

Query: 209 ----KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR--SMTQKVSDGVKALICGIVGVGM 262
               KK ++ D E      +G +I+ +  D + ++   +     +      I  +V +  
Sbjct: 464 EENDKKNVNGD-EKSKTANLGAIINLMAVDTFKIADIGAYMHFFAGSFIMTIIALVLLYK 522

Query: 263 MCSLSPQLSILLLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ 321
           +  ++  +  +LL    PV F  A++ G+  + T       T Q  +   E L  I+ ++
Sbjct: 523 LLGVAAIVGTILLLCMIPVSFKLATLLGEYQKKT----LAVTDQRIQKLNEVLQAIRIIK 578

Query: 322 SFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFL--TVLAYGS---YL 376
            F  EGN          +I  +               +L G + +L  T++  GS   Y+
Sbjct: 579 FFSWEGN-------FEEEILTIREKELKILLIRSAVWALGGFVWYLTPTIVTAGSFAYYI 631

Query: 377 VLQ-SQLSIG-DLTAFMLYTEYTG--NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSIS 432
            +Q  QL+     TA  L++   G  + +  +++F  +         +  +  D K    
Sbjct: 632 FIQGEQLTTPVAFTALSLFSLLRGPLDQISDMASFVIQSKVSLDRIQKFLDEDDTKKYEQ 691

Query: 433 PTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIAL 492
            ++G+K       I  ++V+ S+  +      ++LN     G    ++GP+G GK+++ +
Sbjct: 692 LSLGNK-------ISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLM 744

Query: 493 LLLRYYNPTTGTIMIDNQD---ITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYT 549
            LL   +   G I + + D       +   L   +    Q   L++ T+++NI +   Y 
Sbjct: 745 ALLGEMHLLEGKITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFNAEY- 803

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
             +E   +V   C              T IG  G  LSGGQKQRI++ARAL      ++L
Sbjct: 804 -NEERYLAVISACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILL 862

Query: 610 DEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENVIVLGHDGSVVE 666
           D+  SA+D  +   I  N   G LM++++  +VS  H ++ T++ +E VI++  +G +  
Sbjct: 863 DDCLSAVDSHTAAWIYDNCIIGPLMENRTCILVS--HNVALTLKNAEQVIMID-NGKISH 919

Query: 667 MG 668
           +G
Sbjct: 920 IG 921

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  142 bits (359), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 136/545 (24%), Positives = 242/545 (44%), Gaps = 53/545 (9%)

Query: 173  FFTVALLIGCAA----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 228
            F  +  LIG A+    N    ILL   + R   +L  ++    ++   +FF+   +G ++
Sbjct: 1006 FVGIYALIGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTPIGRIL 1065

Query: 229  SRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVF 288
            +R  +D   V  ++        K++   ++ V ++    P   +  LF     ++   +F
Sbjct: 1066 NRFSADIDTVDSTLQMVFMVFFKSIFSYLITVILITISMPLFLVFCLFLMVIYIYYQKLF 1125

Query: 289  GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS------FVAEGNELSRYNVAIRDIFQ 342
              Q R   +    +   +  +  E L G+  +++      F    NE  ++N  I  +F 
Sbjct: 1126 IVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAYKHFSMFKYLNNERVQFN--INCVFD 1183

Query: 343  VGXXXXXXXXXXXXXXSLL----GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
                            +L+    G LS  T+ +          L+ G +   M Y     
Sbjct: 1184 YRSTNRWLSIRLQTIGALMVLITGMLSLSTISS-------SKPLTAGMVGLLMSYVLQVT 1236

Query: 399  NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQP-----ERGVIEFKDVSF 453
             ++  +      I  G  +  R+ E  +  PS +  +   Y+P      +G I+FK+ S 
Sbjct: 1237 TSLMWIVRSSVMIETGIVSVERIMEYCEL-PSEAEQIVDDYRPASNWPSKGAIQFKNYST 1295

Query: 454  SYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDI 512
             Y  R ++  + K+++  I PG  V IVG +G GKST+ L L R   P  GTI+ID  DI
Sbjct: 1296 RY--RANLDPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMDI 1353

Query: 513  TKLNCKSLRRQIGIVQQEPVLMSGTIRDN-----------ITYGLTYTPTKEEIRSVAKQ 561
            +K+    LR  + I+ Q+     GT+R N           +   +T +  K  ++ + ++
Sbjct: 1354 SKIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLMEE 1413

Query: 562  CFCHNFITKFP-NTY-DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
                   ++ P N Y +  I   G+ LS GQ+Q + +ARAL+ +  IL+LDEAT+++DVE
Sbjct: 1414 SG-----SELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEATASVDVE 1468

Query: 620  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
            ++  I  T  +    +  TI++IAHR+ T+  S+ ++VL   G V E      L A+ ++
Sbjct: 1469 TDKIIQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-EQGEVKEFNSPASLLADKST 1525

Query: 680  ALSQL 684
               QL
Sbjct: 1526 LFYQL 1530

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 135/311 (43%), Gaps = 50/311 (16%)

Query: 377 VLQSQLSIGDLTAFMLYTEYTGNAV-----------FGLSTFYSEIMQGAGAASRLFELT 425
           ++++ +SIG +  F+L  E   + +           F +    +  +  + A+ +  + T
Sbjct: 576 IIETNVSIGRVKKFLLGEELDRSFIEEIADKHDESPFAVEILNATFLWKSKASLQAGDGT 635

Query: 426 DRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGR 485
           D + SI  TV          +  KD+ F               F+       C+VG  G 
Sbjct: 636 DEETSIGSTV----------VALKDIDF---------------FRAKKNVLTCVVGRVGS 670

Query: 486 GKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYG 545
           GK+T+   +L     T+G+         KL  +     +    QE  +M+ +I++NI +G
Sbjct: 671 GKTTLLKSILGQLPCTSGS---QKAIPPKLIIRG--ESVAYCPQEAWIMNDSIKENILFG 725

Query: 546 LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPT 605
             Y  T   +    K C         P+  +T++G  G  LSGGQK R+++ARA+  +  
Sbjct: 726 HRYDETFYNL--TVKACELRPDFKILPDGDNTLVGEKGITLSGGQKARLSLARAVYSRSD 783

Query: 606 ILILDEATSALDVESEGAINYTF----GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
           I +LD+  SA+D     +I +        L+K+K+  I+   + +S +  S+ + VL  D
Sbjct: 784 IYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNKA--IILTTNDISVLEHSDRIYVL-QD 840

Query: 662 GSVVEMGKFKE 672
           G ++E   + E
Sbjct: 841 GRIIEESTYAE 851

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 132/503 (26%), Positives = 224/503 (44%), Gaps = 46/503 (9%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266
            ++KK L+    FFD+  +G +++R   D   V + +T  V     +L+  +  V ++  +
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1192

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
            +P    + +F           +    R   +    +   + +   E L GI T+++F   
Sbjct: 1193 TPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTIRAF--- 1249

Query: 327  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQ 381
            G+E       +  I +                  +  +    + A G +++L      S 
Sbjct: 1250 GDERRFMQENLTKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSLDSG 1309

Query: 382  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--TDRKPSISPTVGHKY 439
            L+   LT  + +TE        L   YS +     +  RL E    +++P    T  H  
Sbjct: 1310 LAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQST--HNP 1363

Query: 440  QPE---RGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
             PE   +G IE  D+S  Y P+ P  ++ K++ F + P   V IVG +G GKSTI   L 
Sbjct: 1364 PPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNCKVGIVGRTGAGKSTIITALF 1421

Query: 496  RYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP----- 550
            R+ +P +G I IDN DIT +  K LR+ I I+ Q+P L +GT++ N+     Y+      
Sbjct: 1422 RFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDKQIFE 1481

Query: 551  --------TKEEIRSVAK------QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAI 596
                    T+EE+   A            N + KF    +  I   G+ LS GQ+Q + +
Sbjct: 1482 ALKRVNLVTQEELDHAANPSPDNASAVSEN-VNKFL-FLENEISEGGSNLSQGQRQLVCL 1539

Query: 597  ARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 656
            AR+L++ P +++LDEAT+++D +S+  I  T     +    TI++IAHRL +I   + ++
Sbjct: 1540 ARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDSTILTIAHRLRSIIDYDKIL 1597

Query: 657  VLGHDGSVVEMGKFKELYANSTS 679
            V+   G V E      L  N  S
Sbjct: 1598 VMDA-GEVKEYDHPYSLLLNKNS 1619

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 108/468 (23%), Positives = 201/468 (42%), Gaps = 38/468 (8%)

Query: 224 VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL---SPQLSILLLFFTPP 280
           +G +I+ +  DA+ VS  +   +   V+AL+  IV + ++  L   S  +  LL+    P
Sbjct: 472 LGAIINLMAVDAFKVSE-ICAYLHSFVEALVMTIVALTLLYKLLGWSAIIGALLIVAILP 530

Query: 281 VLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 339
           + F  A++ GK      K+    T +  +   E    I+ ++ F  E N         +D
Sbjct: 531 LNFRLATLIGK----LQKETLSFTDKRIQKLNETFQAIRIIKFFSWEEN-------FEKD 579

Query: 340 IFQVGXXXXXXXXXXXXXXSLLGDLSFLT-----VLAYGSYLVLQSQL--SIGDLTAFML 392
           I  +               +L   + F+T      +++  Y+ +Q ++  +    TA  L
Sbjct: 580 IQSIRDQELKMLVKRSVAWALTAFVWFITPTIVTSVSFAFYIYVQGEVLTTPVAFTALSL 639

Query: 393 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVS 452
           +T    N +  LS   S ++Q   +  R+    +           +    R  I F++ +
Sbjct: 640 FT-LLRNPLDMLSDMLSYVIQSKVSLDRV---QEFLEEEETEKYEQITVHRNKIGFENAT 695

Query: 453 FSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM---IDN 509
           FS+  +      K++N     G    ++GP+G GK+++ + LL   +   G +    +D 
Sbjct: 696 FSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDP 755

Query: 510 QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKE-EIRSVAKQCFCHNFI 568
           ++   +    +   I    Q   L++ T+++NI +    +P  E    +V + C      
Sbjct: 756 REDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFS---SPFNEGRYNAVIEACGLKRDF 812

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NY 626
                   T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +   I  N 
Sbjct: 813 EILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENC 872

Query: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
             G LM+ ++  +VS  H ++   ++   +V   +G V + G+  ELY
Sbjct: 873 ISGPLMEGRTCILVS--HNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 141/563 (25%), Positives = 235/563 (41%), Gaps = 74/563 (13%)

Query: 163  FSLPLYEFLSF---------FTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLH 213
            F + LY F  F         FT+   IG  A+                 L    +K+ +H
Sbjct: 934  FYMGLYSFFVFGAYIFMTSQFTILCYIGIGAS---------------KNLNIQALKRIIH 978

Query: 214  QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLS-PQLSI 272
                F D   +G +++R   D   +   + + V   V      IVGV +MC +  P  +I
Sbjct: 979  TPMSFMDTTPIGRILNRFTKDTDSLDNELIENVRLTVSQF-ANIVGVCVMCIVYLPWFAI 1037

Query: 273  LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332
             + F     +F  + +    R   +        +     E L G+ T++ + +E   +++
Sbjct: 1038 AVPFLVFIFVFIQNHYQSAGREIKRLEAIQRSFVYNNFNEILGGMDTIKFYKSEERYIAK 1097

Query: 333  YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL-----SIGDL 387
             +  I  + + G               ++  ++F  ++   + L +  Q      S+G L
Sbjct: 1098 SDYLIDKMNEAGYLTVCVQRWVAILVDMIA-VAFALII---TLLCVTRQFHISASSVGVL 1153

Query: 388  TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL--------FELTDRKPSISPTVGHKY 439
              ++L      N    L    S++     +  RL         E    KP  +P    + 
Sbjct: 1154 LTYVLQLPGLFNT---LLRAVSQVENDMNSTERLVSYATDLPLEAQYHKPETAPP---ES 1207

Query: 440  QPERGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
             PE G I+F++V F+Y  RP + I  K++N +I     + I G +G GKSTI   L R  
Sbjct: 1208 WPEEGTIKFENVDFAY--RPGLPIVLKNINLQINGTEKIGICGRTGAGKSTIMTALYRLN 1265

Query: 499  NPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDN---------------IT 543
              T+G+I+ID+ DI KL    LR+++ I+ Q+PVL  G IR N               + 
Sbjct: 1266 ELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPFHERTDEELWDVLV 1325

Query: 544  YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY--DTVIGPHGTLLSGGQKQRIAIARALI 601
             G    P  E++     Q    +  +   + +  D V+   G   S G++Q +A+ RAL+
Sbjct: 1326 RGGAIAP--EDLAETKAQHITEDGTSADLHKFHLDKVVEEDGANFSLGERQILALTRALV 1383

Query: 602  KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
            +   ILILDEATS++D E++  I             TI+ IAHRL TI   + ++VL H 
Sbjct: 1384 RNTKILILDEATSSVDYETDRKIQERIATAF--SHCTILCIAHRLKTILNYDRILVLEH- 1440

Query: 662  GSVVEMGKFKELYANSTSALSQL 684
            G V E      L+ + T+    +
Sbjct: 1441 GEVAEFDTPMNLFKDETTIFHNM 1463

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 110/206 (53%), Gaps = 20/206 (9%)

Query: 464 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           F +LNF+I  G  V I GP G GK+++      +   T+GTI I N D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQI-NGDL----------- 659

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
             ++   P + + T+RDNI +G  Y   +++ + V + C   + +   P    T IG  G
Sbjct: 660 --LMGGYPWIQNATVRDNIIFGSPYE--EDKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK RI +AR + K+  I +LD+  SA+D    +  ++    +L+ +K+  + + 
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNKTRLLAT- 774

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMG 668
            H+LS I ++  +IVLG+DGS VE+G
Sbjct: 775 -HQLSLIDKASRIIVLGNDGS-VEIG 798

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 141/551 (25%), Positives = 249/551 (45%), Gaps = 61/551 (11%)

Query: 171  LSFFTVALLIGCAANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            + +  + L+IG A      G+ IL  +       ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLVLYLIIGFAQALLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRI 1161

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ-LSI-----LLLFFTPPV 281
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ LS+     +L +F    
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYF 1221

Query: 282  LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
              + S   K+  + S+        + +   E L G+ T+++F  EG  +      I +  
Sbjct: 1222 YMAGSRELKRFESISR------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENN 1275

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEY 396
            +                 ++G L    +   G +++     L S ++   LT  + +TE 
Sbjct: 1276 KPFFYLWVANRWLAFRIDMIGSL---VIFGAGLFILFNINNLDSGMAGISLTYAISFTE- 1331

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YQPERGVIEFKDV 451
                   L   YSE+     +  R+ E  + +    P   HK       P+ G IE  D+
Sbjct: 1332 ---GALWLVRLYSEVEMNMNSVERVKEYMEIEQE--PYNEHKEIPPPQWPQDGKIEVNDL 1386

Query: 452  SFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQ 510
            S  Y P  P  ++ K+++F +   S + IVG +G GKSTI   L R+  P TG I IDN 
Sbjct: 1387 SLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNI 1444

Query: 511  DITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKEEI-- 555
            DI+ ++ + LRR I I+ Q+P L SGTI+ N+     ++              ++E++  
Sbjct: 1445 DISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQ 1504

Query: 556  ---RSVAKQCFCHNF--ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
               R  + +    N   + KF +   + I   G+ LS GQ+Q + +AR+L++ P I++LD
Sbjct: 1505 GATRETSNEASSTNSENVNKFLDL-SSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLD 1563

Query: 611  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
            EAT+++D  S+  I  T  +  + +  TI++IAHRL ++   + ++V+   G V E    
Sbjct: 1564 EATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVMDA-GEVKEYDHP 1620

Query: 671  KELYANSTSAL 681
              L  N  SA 
Sbjct: 1621 YSLLLNKQSAF 1631

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 116/535 (21%), Positives = 218/535 (40%), Gaps = 54/535 (10%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRAHVI----------------K 209
           F+    VA+    A  FGR + +R    I+SE     LR  +                 +
Sbjct: 401 FVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPSNEDPQEINDQ 460

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ 269
           K+++ D E   +  +G +I+ +  DA+ VS  +   +   ++A +  +V + ++  L   
Sbjct: 461 KSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYRLLGF 519

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
            +I+ +     +L       K I +  K     T    +   E    I+ ++ F  E N 
Sbjct: 520 AAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEEN- 578

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT-----VLAYGSYLVLQSQL-- 382
                   +DI  +               S+   L F+T       ++  Y+ +Q ++  
Sbjct: 579 ------FEKDINTIRENELSLLLMRSIVWSISSFLWFVTPTIVTAASFAYYIYVQGEVLT 632

Query: 383 SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL---TDRKPSISPTVGHKY 439
           +    TA  L+T    + +  LS   S ++Q   +  R+ +     D K     T+    
Sbjct: 633 TPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNENDTKKYDQLTI---- 687

Query: 440 QPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
            P      F++ + S+         K LN +   G    ++GP+G GK+++ + LL    
Sbjct: 688 DPNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMY 747

Query: 500 PTTGTIMID----NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 555
              G +++      Q++  ++       I    Q   L++ T+++NI +   +   +   
Sbjct: 748 LLNGKVVVPALEPRQELI-VDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEAR--Y 804

Query: 556 RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
           ++V + C              T IG  G  LSGGQKQR+++ARAL      ++LD+  SA
Sbjct: 805 KAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSA 864

Query: 616 LDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
           +D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 865 VDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 137/540 (25%), Positives = 232/540 (42%), Gaps = 31/540 (5%)

Query: 167  LYEFLSFFTVALLIGCAANFGR-FILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVG 225
            +++F+  +    +   A N  R  +LL   + R  A+L   + K  L     FF+   VG
Sbjct: 993  VWKFVGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVG 1052

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +I+R  SD   V  ++    +   ++++   V V ++    P   I+        ++  
Sbjct: 1053 RIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTVILISYNMPWFLIVNAVLLIIYIYYQ 1112

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 345
            + +    R   +    +T  +  +  E L G   + +F        R++    +  Q   
Sbjct: 1113 AFYITLSRELKRLTSVSTSPIMSLFSETLGGHAVINAF----KHFDRFDFINFNNVQFNI 1168

Query: 346  XXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTGNA 400
                         S+ L  +    VLA      S +  + +LS G +   M Y     ++
Sbjct: 1169 NCSFNFRSTNRWLSVRLQTIGAFIVLATALLALSTINSERRLSPGMVGLLMSYALQVTSS 1228

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPS----ISPTVGHKYQPERGVIEFKDVSFSYP 456
            +  +     +I     +  R++E  +  P     I      K  P  G I FK+ S  Y 
Sbjct: 1229 LMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEGEIIFKNYSTKYK 1288

Query: 457  TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLN 516
            T+  + + K +N  I P   + +VG +G GKST++L L R    T GTI ID  DI+K+ 
Sbjct: 1289 TKGDLAL-KGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDISKMG 1347

Query: 517  CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF----- 571
             K LR  +GI+ Q+     GT+R N+     Y+ T+E   S+       + +  F     
Sbjct: 1348 LKDLRSHLGIIPQDAQAFEGTVRSNLDPFEQYS-TEELWASIELSHLKPHIVEMFRKEDN 1406

Query: 572  -------PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
                       D  I  +G  LS GQ+Q + ++RAL+    +L+LDEAT+A+D+E++  I
Sbjct: 1407 SELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDKII 1466

Query: 625  NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
              T    +K K  TI++IAHR+ T+  S+ +IVL   G V E    + L +N  S    L
Sbjct: 1467 QETIRSELKEK--TILTIAHRIDTVLDSDKIIVLDA-GQVKEFDTPENLLSNKQSIFYAL 1523

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 123/253 (48%), Gaps = 20/253 (7%)

Query: 469 FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQ--IGI 526
           F+   G   CIVG  G GKST+   +L       G +   N  +  L  K L R   +  
Sbjct: 644 FQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRASTVAY 696

Query: 527 VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
             QEP +M+ +I+DNIT+G  Y  T     +  K C     +   P   +T++G  G  L
Sbjct: 697 CPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVGEKGISL 754

Query: 587 SGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMK-SKSMTIVSIAH 644
           SGGQK RI++ARA+  +  + +LD+  SA+D E S+  +     + M   ++ T+V   +
Sbjct: 755 SGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNKTVVLTTN 814

Query: 645 RLSTIRRSENVIVLGHDGSVVEMGKFKELYAN-STSALSQLLNERAA-----PGPSDQQL 698
            +S + RS+ + +L   GS+VE G F E+ ++   S L ++++E        P  S    
Sbjct: 815 AISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDEFGGNMNYPPSESADNH 873

Query: 699 QIEKVEEKEDTNE 711
            IE    K  ++E
Sbjct: 874 SIESTNSKVPSSE 886

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 148/572 (25%), Positives = 240/572 (41%), Gaps = 83/572 (14%)

Query: 168  YEFLSF-FTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGD 226
            Y F+S  FT+   IG AA+                 L    +K+ LH    F D   +G 
Sbjct: 907  YFFMSLQFTILCYIGLAAS---------------KWLNLKAVKRLLHTPMSFMDTTPLGR 951

Query: 227  LISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLS-PQLSILLLFFTPPVLFSA 285
            +++R   D   +   +T+ V   V      I GV +MC +  P  +I + F     +  A
Sbjct: 952  VLNRFTKDTDTLDNELTESVRLFVYQ-TANIAGVIIMCIIYLPWFAIAVPFLGLIFIIVA 1010

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 345
              +    R   +        +     E LSG+ T++++ +E   L + +  I  + + G 
Sbjct: 1011 DHYQSSGREIKRLEAVQRSFVYNNFNEVLSGMDTIKAYKSENRFLMKSDFLINRMSEAGY 1070

Query: 346  XXXXXXXXXXXXXSLLG----------------DLSFLTVLAYGSYLVLQSQLSIGDLTA 389
                          ++                 D+S  +V    +Y VLQ    +  L  
Sbjct: 1071 LVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDISAASVGVLLTY-VLQLPGLLNGLLR 1129

Query: 390  FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFK 449
             M   E   N+V  +  + +E+ Q A           RKP ++P    +  P  G + F 
Sbjct: 1130 AMTQAENDMNSVERIVNYATELPQEAAY---------RKPEMTP---QEPWPSNGEVVFD 1177

Query: 450  DVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
            +VS SY  RP +  + K ++  I  G  + I G +G GKSTI   L R      G ++ID
Sbjct: 1178 NVSLSY--RPGLPLVLKGVSLNIKGGEKIGICGRTGAGKSTIMSALYRLCELNEGRVLID 1235

Query: 509  NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNIT-YG------------LTYTPTKEEI 555
              D +KL    LRR++ I+ Q+PVL  G+IR N+  +G             + T   EE+
Sbjct: 1236 GVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGEREDEELWSALVRSGTIEAEEV 1295

Query: 556  RSVAKQ--------CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTIL 607
              V  Q           H F        D  +   GT  S G++Q +A+ RAL+++  IL
Sbjct: 1296 EKVKNQHRDESGSSTGLHKF------HLDQEVEDDGTNFSLGERQLLALTRALVRQSKIL 1349

Query: 608  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            ILDEATS++D E++  I     Q  +    TI+ IAHRL TI   + ++VL  +G+V E 
Sbjct: 1350 ILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTILNYDRLVVL-DNGTVKEF 1406

Query: 668  GKFKELYANSTSALSQLLNE---RAAPGPSDQ 696
               + L+    +   ++ ++   +A   P +Q
Sbjct: 1407 DTPRSLFRIKDTIFREMCDKSGIKAEDFPGEQ 1438

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 124/263 (47%), Gaps = 24/263 (9%)

Query: 452 SFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQD 511
           +F+   + S   FK+LNF+I  G  V I G  G GKS++   L  +   T G I    ++
Sbjct: 559 AFASSEKASFSGFKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIF---KN 615

Query: 512 ITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF 571
            + L C             P + + T+RDNI +G ++   +   + V + C     +   
Sbjct: 616 GSLLLCGY-----------PWIQNTTVRDNILFGSSFDDVR--YKEVIRVCALQADLDIL 662

Query: 572 PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ 630
           P    T IG  G  LSGGQK RI +AR++ K   I + D+  SA+D    +  ++     
Sbjct: 663 PAGDFTEIGERGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMG 722

Query: 631 LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAA 690
           ++  K+  + +  H+LS I R+  VI LG  GS  ++G  +EL     S   +L+     
Sbjct: 723 MLDGKTRILAT--HQLSLIERASRVIFLGAGGS-FDIGTVEEL-KERNSGFVKLMEFSTQ 778

Query: 691 PGPSDQQLQIEKVEEKEDTNEGE 713
              ++Q+   E+V++  + N G+
Sbjct: 779 TKSANQR---EEVDDHAEENLGQ 798

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  139 bits (349), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 133/527 (25%), Positives = 240/527 (45%), Gaps = 58/527 (11%)

Query: 171  LSFFTVALLIGCAANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            + +  + L+IG A +    G+ IL  +       ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLILYLIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRI 1161

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ-LSI-----LLLFFTPPV 281
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ LS+     +L +F    
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYF 1221

Query: 282  LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
              + S   K+  + S+        + +   E L G+ T+++F  EG  +      I +  
Sbjct: 1222 YMAGSRELKRFESISR------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENN 1275

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEY 396
            +                 ++G L    +   G +++     L S ++   LT  + +TE 
Sbjct: 1276 KPFFYLWVANRWLAFRIDMIGSL---VIFGAGLFILFNINHLDSGMAGISLTYAISFTE- 1331

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YQPERGVIEFKDV 451
                   L   Y+E+     +  R+ E  + +    P   HK       P+ G IE  D+
Sbjct: 1332 ---GALWLVRLYAEVEMNMNSVERVKEYMEIEQE--PYNQHKEVPPPQWPQDGKIEVNDL 1386

Query: 452  SFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQ 510
            S  Y P  P  ++ K+++F +   S + IVG +G GKSTI   L R+  P TG I IDN 
Sbjct: 1387 SLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNI 1444

Query: 511  DITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSV---------- 558
            DI+ ++ + LRR I I+ Q+P L SGTI+ N+     ++  K  E ++ V          
Sbjct: 1445 DISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRKIFEALKRVNLISEEQSQQ 1504

Query: 559  --AKQCFCHNFITKFPNT-----YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
               ++    N  T   N        + +   G+ LS GQ+Q + +AR+L++ P I++LDE
Sbjct: 1505 GTTREADNDNSSTNSENVNKFLDLSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDE 1564

Query: 612  ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
            AT+++D  S+  I  T  +  + +  TI++IAHRL ++   + ++V+
Sbjct: 1565 ATASIDYGSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM 1609

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 115/532 (21%), Positives = 220/532 (41%), Gaps = 48/532 (9%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRAHVI----------------K 209
           F+    VA+    A  FGR + +R    I+SE     LR  +                 +
Sbjct: 401 FVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPINEDPQEINDQ 460

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ 269
           K+++ D E   +  +G +I+ +  DA+ VS  +   +   ++A +  +V + ++  L   
Sbjct: 461 KSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALVLLYRLLGF 519

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
            +I+ +     +L       K I +  K     T    +   E    I+ ++ F  E N 
Sbjct: 520 AAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENF 579

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL--SIGDL 387
               N AIR+  ++                     + +T  ++  Y+ +Q ++  +    
Sbjct: 580 EKDIN-AIRE-NELSLLLMRSIVWSISSFVWFVTPTIVTAASFAYYIYVQGEVLTTPVAF 637

Query: 388 TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQ-----PE 442
           TA  L+T    + +  LS   S ++Q   +  R+ +  + K +       KY      P 
Sbjct: 638 TALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDT------KKYDQLTIDPN 690

Query: 443 RGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 502
                F++ + S+         K LN +   G    ++GP+G GK+++ + LL      +
Sbjct: 691 GKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLS 750

Query: 503 GTIMID----NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSV 558
           G +++      Q++  ++       I    Q   L++ T+++NI +   +   +   ++V
Sbjct: 751 GKVVVPALEPRQELV-VDANGTTNAIAYCSQGAWLLNDTVKNNILFNSPFNEAR--YKAV 807

Query: 559 AKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            + C              T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D 
Sbjct: 808 VEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDS 867

Query: 619 ESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 868 HTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  138 bits (348), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 137/510 (26%), Positives = 223/510 (43%), Gaps = 58/510 (11%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266
            ++   LH    FFD   +G +++R   D   V + +T  +      L+  +  + ++  +
Sbjct: 1164 LLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTMLLIAFI 1223

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQS 322
            +PQ  IL +F    + F   + G      S++L+         + +   E L GI T+++
Sbjct: 1224 TPQFLILAIF----IGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLVGIVTIRA 1279

Query: 323  FVAEG----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVL 378
            +  E       L + +   +  F +               SL+       V   G +++L
Sbjct: 1280 YGDEKRFMLENLHKIDENNKPFFYLWAFNRWLSFRIDMIGSLV-------VFGAGVFIIL 1332

Query: 379  Q-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKP-- 429
                  S L+   LT  + +TE    A   L  FY+++     +  RL E    D++P  
Sbjct: 1333 NIDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEIDQEPYE 1388

Query: 430  ---SISPTVGHKYQPERGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGR 485
                 S  +     P  G IE  ++S  Y P  P  ++ K++ F + P   V +VG +G 
Sbjct: 1389 EHLERSEVLAVDNWPRNGKIEVNNLSLRYAPNLP--KVIKNVTFVVEPNCKVGVVGRTGA 1446

Query: 486  GKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDN---- 541
            GKSTI   L R+ +  TG I ID+ DIT +N   LRR I I+ Q+P L SGTIR N    
Sbjct: 1447 GKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIRSNLDPY 1506

Query: 542  -------ITYGLTYTPTKEEIRSVAKQCFCHNF-----ITKFPNTYDTVIGPHGTLLSGG 589
                   I   L       E  S        +      + KF N  +  I   G  LS G
Sbjct: 1507 NEFSDDAIFKALRRVNLINENESTGPASSETSPSSTENVNKFLNLKNE-ITEGGNNLSHG 1565

Query: 590  QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 649
            Q+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + K  TI++IAHRL ++
Sbjct: 1566 QRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKESTILTIAHRLRSV 1623

Query: 650  RRSENVIVLGHDGSVVEMGKFKELYANSTS 679
               + ++V+   G V E      L  N  S
Sbjct: 1624 CDYDKILVMDA-GEVKEYDHPYSLLLNKNS 1652

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 115/229 (50%), Gaps = 11/229 (4%)

Query: 446 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           I F++ + ++  + S    + LN    PG    ++GP+G GKS++ L LL   +   G I
Sbjct: 731 IAFQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNI 790

Query: 506 MI---DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
           ++   D +D   ++   +   I    Q   L++ T+R+NI +   Y   +     V   C
Sbjct: 791 IVPSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFNSPYNEARYN-AVVEACC 849

Query: 563 FCHNF-ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
              +F I K  +   T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  + 
Sbjct: 850 LKRDFEILKAGDM--TEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHTA 907

Query: 622 GAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
             I  N   G LM++++  +VS  H ++   R+  ++V+  DG V + G
Sbjct: 908 LWIYDNCITGPLMENRTCILVS--HNIALTLRNAELVVILEDGRVKDQG 954

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  138 bits (347), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 155/588 (26%), Positives = 247/588 (42%), Gaps = 89/588 (15%)

Query: 156 FDLKIPIFSLPLYEFLSF---------FTVALLIGCAANFGRFILLRILSERVVARLRAH 206
           F  + P F + LY F  F         FTV   +G  A+  +F+ L+             
Sbjct: 441 FKNRSPSFYMGLYSFFVFGQYMFMNIQFTVLCFLGVTAS--KFLNLK------------- 485

Query: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGIVGVGMM 263
            +K  LH    F D   +G +++R   D    + SM  ++++ ++ +   +  I+GV +M
Sbjct: 486 AVKGILHTPLSFMDTTPLGRILNRFTKD----TDSMDNELTEDIRLMMFQLGNIIGVIVM 541

Query: 264 CSLS-PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS 322
           C +  P  +I + F     +  A  +    R   +        +     E L G+ T+++
Sbjct: 542 CIVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEVLGGLDTIRA 601

Query: 323 FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL 382
           + ++   L + +  I  + + G               +L  +  L +    + L +  Q 
Sbjct: 602 YRSQDRFLVKSDFLINKMNEAGYMVAALQRWVAIFLDMLAVIFALII----TLLCVTRQF 657

Query: 383 SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ---GAGAASRLF--------ELTDRKPSI 431
            I   +  +L T Y       L+T    + Q   G  +A RL         E   R+P +
Sbjct: 658 KISPSSTGVLLT-YVLQLPGLLNTVLRALTQAENGMNSAERLVTYALDLPQEAEYRRPEM 716

Query: 432 SPTVGHKYQPERGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTI 490
           SP    +  P+RG I+F+ VSF+Y  RPS+  + K+ +  I  G  + I G +G GKSTI
Sbjct: 717 SPP---ENWPDRGEIKFEGVSFAY--RPSLPPVLKNFSLNIGSGEKIGICGRTGAGKSTI 771

Query: 491 ALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNI-------- 542
              L R      G I IDN +I  L    LR ++ I+ Q+PVL  GTI+ N+        
Sbjct: 772 MSALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFGEKTD 831

Query: 543 -------TYGLTYTPTKEEIRSVAKQ----CFCHNFITKFPNTYDTVIGPHGTLLSGGQK 591
                    G    P  E+I     Q       H+ + KF    +  +   G   S G+K
Sbjct: 832 QELWESLVRGGAIAP--EDIEETKAQQPDASGSHSKMHKF--HLEQKVEEEGGNFSLGEK 887

Query: 592 QRIAIARALIKKPTILILDEATSALDVESEGAIN----YTFGQLMKSKSMTIVSIAHRLS 647
           Q +A+ RAL++   ILILDEATS++D E++  I       FG        TI+ IAHRL+
Sbjct: 888 QLLALTRALVRNSRILILDEATSSVDYETDDKIQSRIVEAFGDC------TILCIAHRLN 941

Query: 648 TIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSD 695
           TI   + ++VL   G V E      L+         +  ERA    SD
Sbjct: 942 TILNYDRILVL-EQGEVAEFDTPWNLFTKEDGIFKSMC-ERANIKKSD 987

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 122/251 (48%), Gaps = 21/251 (8%)

Query: 458 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNC 517
           + S + F++LNF I  G  + + GP G GK+++   +  +   + G++ ++ +    L+C
Sbjct: 100 KTSFKGFQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGR---LLSC 156

Query: 518 KSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + + T+RDNI +G  Y   K   R V K C   + +   P    T
Sbjct: 157 GY-----------PWIQNATVRDNIIFGSPYEKAK--YRKVIKACSLDSDLEILPAGDMT 203

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKS 636
            IG  G  LSGGQK RI +AR + K   I + D+  SA+D    +  ++     L+  K+
Sbjct: 204 EIGERGINLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQKT 263

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQ 696
             + +  H+L+ I ++  +IVLG+DGS   +G ++EL   S S L +LL   +     D 
Sbjct: 264 RILAT--HQLALIEKATRLIVLGNDGSFT-IGTYEEL-QKSNSQLKKLLQFTSDKSEEDD 319

Query: 697 QLQIEKVEEKE 707
             Q +   +KE
Sbjct: 320 NDQKQNENDKE 330

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 131/486 (26%), Positives = 221/486 (45%), Gaps = 33/486 (6%)

Query: 218  FFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y V     R+ +Q   + VK     I  + ++C+ + Q    
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKV----IFTITVICATTWQF--- 1093

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ TV+ + ++  
Sbjct: 1094 -IFIIIPLGVCYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQK 1150

Query: 329  ELSRYN-VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
              S  N   I +                    L+G +  L       + + Q  L+ G  
Sbjct: 1151 RFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMA 1210

Query: 388  TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTV-GH---KYQPER 443
               + Y       +  +     E+     +  R+ E  D K     T+ GH   K  P +
Sbjct: 1211 GISLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLTIEGHMPPKEWPSQ 1270

Query: 444  GVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 502
            G I+F + S  Y  RP +  + K +N  I P   + IVG +G GKS++ L L R    + 
Sbjct: 1271 GDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEASA 1328

Query: 503  GTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAKQ 561
            G I+ID   I ++    LR ++ I+ Q+  +  G++R+NI     Y  T E I R++   
Sbjct: 1329 GNIVIDGIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENIDPTNQY--TDEAIWRALELS 1386

Query: 562  CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
                + ++   +  D  +   G  LS GQ+Q + +ARA++    ILILDEAT+A+DVE++
Sbjct: 1387 HLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILILDEATAAVDVETD 1446

Query: 622  GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSAL 681
              +  T     K +  TI++IAHRL+TI  S+ +IVL  +G+V E     +L +NS S  
Sbjct: 1447 KVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGTVAEFDSPSQLLSNSESLF 1503

Query: 682  SQLLNE 687
              L  E
Sbjct: 1504 HSLCAE 1509

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 121/243 (49%), Gaps = 24/243 (9%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           D +F +  +P  ++  K++NF+   G   C+VG  G GK+ +   +L             
Sbjct: 632 DATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKTALLSCML------------- 678

Query: 509 NQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++   +  V Q P +M+GT+ +NI +G  Y    E      K C     
Sbjct: 679 -GDLFRVKGFATVHGSVAYVSQVPWIMNGTVMENILFGHKYDV--EFYEKTIKACALTID 735

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +    +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +
Sbjct: 736 LAILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEH 795

Query: 627 TFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
             G   L+ +K+  + +  +++S +  +++V +L  +G +++ G + E+  ++ S L +L
Sbjct: 796 VLGPNGLLHTKTRLLAT--NKVSALSIADSVALLD-NGEIIQKGTYDEITKDADSPLWKL 852

Query: 685 LNE 687
           LN+
Sbjct: 853 LND 855

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 141/550 (25%), Positives = 235/550 (42%), Gaps = 58/550 (10%)

Query: 173  FFTVALLIGCAANFGR----FILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 228
            F  + +LI   A F       +LL + S R   +L   +    L     FF+   VG +I
Sbjct: 1016 FVGIYVLISLGAAFFNSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRII 1075

Query: 229  SRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPV--LFSAS 286
            +R  SD           V D V+     ++   ++  L   + ++++ +  P+  L +A+
Sbjct: 1076 NRFSSD--------MNSVDDNVQY----VISFFLISILDYVVVVVIIGYQVPLFLLVNAA 1123

Query: 287  VFGKQI----------RNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336
            + G  +          R   + +  +   +  +  E L+G   + +F    N  SR++  
Sbjct: 1124 LLGIYLYYQVFYVTLSRELKRLMSTSFSPIMSMLSETLAGHMVINAF----NHFSRFDYL 1179

Query: 337  IRDIFQVGXXXXXXXXXXXXXXSL----LGDLSFLT-VLAYGSYLVLQSQLSIGDLTAFM 391
              +  Q                S+    +G L  LT  L   +       LS G +   M
Sbjct: 1180 NIEAVQFNINCVFNFRSTNRWLSIRLESIGALMILTTALLSLATTTGDKALSTGMVGLLM 1239

Query: 392  LYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG----HKYQPERGVIE 447
             Y     N +  +     ++     +  R+ E  D  P   P +      K  P +G + 
Sbjct: 1240 SYALQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVV 1299

Query: 448  FKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 506
            FKD S  Y  R ++  + K LN +I P   + IVG +G GKST++L L R   P  GTI+
Sbjct: 1300 FKDYSARY--RENLDPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIV 1357

Query: 507  IDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
            ID  DITK+    LR  + I+ Q+     G++R N+     Y  + +EI    +      
Sbjct: 1358 IDGVDITKIGLADLRSHLSIIPQDAQAFEGSVRSNLDPFEQY--SDDEIWRALELSHLKP 1415

Query: 567  FITKFPNT---------YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
             I K  N           +T I  +G+ LS GQ+Q + ++RAL+ +  IL+LDEAT+A+D
Sbjct: 1416 HILKMANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVD 1475

Query: 618  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANS 677
             E++  I  T     K +  TI++IAHR+ T+  S+ ++VL   G V E      L A+ 
Sbjct: 1476 SETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVLDQ-GEVKEFDSPSNLLADK 1532

Query: 678  TSALSQLLNE 687
             +    L ++
Sbjct: 1533 NTIFYNLCSQ 1542

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 117/226 (51%), Gaps = 19/226 (8%)

Query: 469 FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLN--CKSLRRQIGI 526
           F+   G  VC+VG  G GKST    LL      + +    +Q   K++  C S    + +
Sbjct: 658 FQALKGQLVCVVGRVGAGKSTFLHALLGQLPCISSS---HDQATPKMHFRCDS----VAL 710

Query: 527 VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
             Q+  +++ +++ N+ +G  Y   +   ++  + C     +    +  +T++G  G  L
Sbjct: 711 CSQQAWILNASVKYNVLFGHKYD--EASYKATIEACQLLPDLGILADGDETLVGEKGISL 768

Query: 587 SGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSI 642
           SGGQK RI++ARA+  +  + +LD+  SA+D E  +  I++   +   L+K+K  T++  
Sbjct: 769 SGGQKARISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK--TVILT 826

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYA-NSTSALSQLLNE 687
            + +S ++ S+++  L  +G +VE G F E+ + ++ S L  L+ E
Sbjct: 827 TNSISVLKHSQSIYAL-ENGEIVERGSFDEIMSKDAESKLKTLIAE 871

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 144/550 (26%), Positives = 245/550 (44%), Gaps = 64/550 (11%)

Query: 164  SLPLYEFL-SFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 222
            S   YE L S F V   I     F     + + S +   +L    + K LH    F ++ 
Sbjct: 519  SASFYEGLYSLFIVLFFIFLVCQFCVCFFVGLNSSK---KLNLRAVHKVLHTPMSFIEST 575

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGIVGVGMMCSLS-PQLSILLLFFT 278
             +G +++R   D    + ++  ++ D V+     +  + G+ +MC +  P  +I++ F  
Sbjct: 576  PIGRIMNRFTKD----TDNLDGQILDNVRLTFYHMSTMFGICIMCIVYLPWFAIVIPFLI 631

Query: 279  PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
              ++F  + +    R   +        +     + L G+  ++++  +   + + +  I 
Sbjct: 632  FTIVFIFNFYQGSSREIRRLEAVRRSFIFNNINDVLGGLDIIKAYQVQNRFIFKSDYLIN 691

Query: 339  DIFQVGXXXXXXXXXXXXXXSLLGDL-----SFLTVL------AYGSYLVLQSQLSIGDL 387
               +                S++G L     S L V          + ++L   L I ++
Sbjct: 692  KTNEASYLYTGVQLWNNILVSIIGVLFALIISLLCVTKQFKISGSSTGVLLTYVLQIPNI 751

Query: 388  TAFMLYT----EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPER 443
              ++L T    E   N+V  L T+ + + Q         E T  KP  SP  GH + PE 
Sbjct: 752  LNYLLDTLKKAENDMNSVERLVTYATNLPQ---------ERTSSKPETSP--GHIW-PEN 799

Query: 444  GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
            G I+FKD +F Y     + I K+ N  +  G  + I G +G GKSTI   L R    T G
Sbjct: 800  GKIQFKDANFRYKEGLPL-ILKNFNMLVQSGEKIGICGRTGAGKSTIMNCLFRLDELTDG 858

Query: 504  TIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNI---TYGLTYTPTKEEIRS--V 558
             I ID+ DI+ L    LR+ + I+ Q+P+L  GTIR N+   +Y    T  +  I S  +
Sbjct: 859  AIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFDDATLWEAMILSGFI 918

Query: 559  AKQCFCH--------NFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
             +  F H          +TKF  T    +   GT  S G+KQ +A  RA+I    +++LD
Sbjct: 919  DRDTFGHFSEKPVNNKELTKFHLT--AHVEEDGTNYSLGEKQLLAFTRAIIHHSKVVVLD 976

Query: 611  EATSALDVESEGAINYTFGQLMKSKSM---TIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            EA+S++D E++  I     Q + SK     TI+ IAHRL+TI + + ++VL H G+++  
Sbjct: 977  EASSSVDYETDAKI-----QTLISKQFSHNTILCIAHRLNTILKYDRILVLDH-GNIIGF 1030

Query: 668  GKFKELYANS 677
               + L+ N+
Sbjct: 1031 ENPRVLFENN 1040

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 120/246 (48%), Gaps = 34/246 (13%)

Query: 464 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           F +LNF I  G  + I GP G GK+++   +        GTI ID               
Sbjct: 205 FNNLNFSIX-GEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEID--------------- 248

Query: 524 IGIVQ--QEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP 581
            G +Q    P + + T+RDNI +G  Y   KE+   V + C     +  F     T IG 
Sbjct: 249 -GNLQLCGYPWVQNTTVRDNIIFGSKYE--KEKFDHVIRICALTEDLENFSGKDLTEIGE 305

Query: 582 HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMTI 639
            G  LSGGQK RI +ARA+ K   I + D+  SA+D      I  N   G L   K+  I
Sbjct: 306 LGITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGAL-SGKTXXI 364

Query: 640 VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQLQ 699
           ++  H+LS I++++ ++VLG+D S  E+G +KEL  ++ + ++ +            Q++
Sbjct: 365 LA-THQLSLIKKADRIVVLGNDNS-FEIGPYKELIQSNKTFINLI--------EYSSQME 414

Query: 700 IEKVEE 705
           +EK+++
Sbjct: 415 LEKIKK 420

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 121/483 (25%), Positives = 225/483 (46%), Gaps = 49/483 (10%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266
            ++ + ++    FFDN  +G +++R   D  V+   +   +       I  +  + ++  +
Sbjct: 1139 LLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVTALMLIVFI 1198

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQS 322
            +P+  I+ +F    ++ S+   G      S++L+  E++ +  + +   E LSG+ T+++
Sbjct: 1199 TPKFLIIAIF----IICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIRA 1254

Query: 323  FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQ- 381
            F   GNE+      +  I +                  +  L  +TV   G++++L +  
Sbjct: 1255 F---GNEIKFLKENLDFIDENNKFFFYMWSVNSWLSFRIDLLGAITVFGSGAFILLNADK 1311

Query: 382  ----LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP-------S 430
                L+   LT  + +TE+       +  FYS +     +  RL E  + +        +
Sbjct: 1312 IDAGLAGISLTYAVTFTEFC----LWMVKFYSTVEMSMNSVERLKEYMEIEEEALADPGA 1367

Query: 431  ISPTVGHKYQPERGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKST 489
            I+P+   +  P +G I F + S  Y P  P V   K LN KI  GS + +VG +G GKST
Sbjct: 1368 ITPS---ENWPVQGAITFANYSLRYAPKLPDV--LKQLNLKIDGGSKIGVVGRTGAGKST 1422

Query: 490  IALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYT 549
            I   L R+ + ++G I+ID+ DI+++N + LR  + I+ Q+P L  GTIR N+     Y 
Sbjct: 1423 IISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNLDPNEEYE 1482

Query: 550  PTKEEIRSVAKQCFCHNFITKF-----------PNTY---DTVIGPHGTLLSGGQKQRIA 595
                    V       +++               N +   D+ I   G  LS GQ+Q I 
Sbjct: 1483 NKDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQGQRQLIC 1542

Query: 596  IARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 655
            +AR+++    I++LDEAT+++D +S+  +  T       K  TI++IAHR+ ++   + +
Sbjct: 1543 LARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVIDYDKI 1600

Query: 656  IVL 658
            +VL
Sbjct: 1601 LVL 1603

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 118/474 (24%), Positives = 212/474 (44%), Gaps = 60/474 (12%)

Query: 225 GDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL----LLFFTPP 280
           G +I+ + +DA  V   +   +   ++ALI  +V V ++  +    + +    ++FF P 
Sbjct: 496 GGIINLMATDAIKVGE-LCNYLHSSIEALIMAVVAVILLYRILGTAAFIGTAVIIFFIPF 554

Query: 281 VLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDI 340
            +F   +  +  R T       T Q  +   E    I+ ++SF  E N + +    I  +
Sbjct: 555 NVFLTKLIARFQRET----LTFTDQRIQNLNETFQSIRIIKSFGWENNIIQK----ILGL 606

Query: 341 FQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
                             +L+  LS   +T L++  Y+++  Q    DLT       +T 
Sbjct: 607 RNKEISVLKRNSITWSINALVWYLSPTIITTLSFSYYILVDKQ----DLTT---PVAFTA 659

Query: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVS------ 452
            A+F L    + + Q +   + L   T  K S+      K+   +   +F+++S      
Sbjct: 660 LALFNL--LKAPLDQLSNTINFL---TQSKVSLDRI--EKFLSVKETTKFENLSVDSSQN 712

Query: 453 ---FSYPT------RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
              FS  T      + S Q+ +++N +   G    ++GP+G GK+++ + LL   +  +G
Sbjct: 713 RLAFSGATLGWCGNKKSFQL-RNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSG 771

Query: 504 TIMIDNQDITKLN----CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
            + + N + +K N      +L   I    Q P + + TIR+NI + + Y   K+   +V 
Sbjct: 772 KVFVPNLE-SKFNLIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGYD--KDRYENVV 828

Query: 560 KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
             C              T++G  G+ LSGGQKQRI++ARAL  K   LILD+  SA+D  
Sbjct: 829 IACGLERDFQILNLGDKTIVGDKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSH 888

Query: 620 SEGAINYTF---GQLMKSKSMTIVSIAHRLS-TIRRSENVIVLGHDGSVVEMGK 669
           S   I Y     G LM+ ++  +VS  H +S TI+++  V ++  +G +V  G+
Sbjct: 889 SAKWI-YNVCITGPLMQGRTCILVS--HNVSLTIKKASKVFMI-ENGYIVASGR 938

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  135 bits (341), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 141/538 (26%), Positives = 241/538 (44%), Gaps = 47/538 (8%)

Query: 180  IGCAA--NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYV 237
            +G AA  N    ++L   S R   +L  ++ K  +     FF+   VG +I+R  SD   
Sbjct: 1029 VGSAAFNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDA 1088

Query: 238  VSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSK 297
            V  S+    S   K+++  +V V ++    P   +  +F     ++  + +    R   +
Sbjct: 1089 VDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFFVFNMFLLVIYIYYQTFYIVLSRELKR 1148

Query: 298  DLQEATGQLTRVAEEQLSGIKTVQS------FVAEGNELSRYNVAIRDIFQVGXXXXXXX 351
             +  +   +  +  E L+G   + +      F+    E  +YN+     F+         
Sbjct: 1149 LISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNIDFVFNFRSTNRWLSVR 1208

Query: 352  XXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT-EYTGNAVFGLSTFYSE 410
                    +L      T +   + +  + QLS G +   M Y+ E TG+  + + T    
Sbjct: 1209 LQTIGATIVLA-----TAMLALTTMNTKKQLSSGMVGLLMSYSLEVTGSLTWIVRTTVM- 1262

Query: 411  IMQGAGAASRLFE---LTDRKPSISP-TVGHKYQPERGVIEFKDVSFSYPTRPSVQ-IFK 465
            I     +  R+ E   L     SI+P     +  P +G IEFK+ S  Y  R ++  + K
Sbjct: 1263 IETNIVSVERIVEYCELPSEARSINPENRPDESWPSKGSIEFKNYSTKY--RENLDPVLK 1320

Query: 466  SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIG 525
             +N +I P   + IVG +G GKST++L L R   PT G+I+ID+ +I+ L    LR  + 
Sbjct: 1321 DINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDDINISDLGLFDLRSHLA 1380

Query: 526  IVQQEPVLMSGTIRDNITYGLTYT--------------PTKE-----EIRSVAKQCFCHN 566
            I+ Q+     GT+R N+     Y+              P  E     EIR        + 
Sbjct: 1381 IIPQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLEKMLDNEIRGADGAAEENG 1440

Query: 567  FITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
             ++   N     I  +GT LS GQ+Q + +ARAL+ +  IL+LDEAT+++D+E++  I  
Sbjct: 1441 NVSDVLNVK---INENGTNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQD 1497

Query: 627  TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
            T  +  K +  TI++IAHR+ T+  S+ +IVL  +G+V E     +L ++  S    L
Sbjct: 1498 TIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKEFDSPSKLLSDKASIFYSL 1552

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 90/368 (24%), Positives = 168/368 (45%), Gaps = 63/368 (17%)

Query: 398 GNAVFGLSTFYSEIMQGAGAASRL--FELTDRKPS-----ISPTVGHKYQPERGVIEFKD 450
            +A++ + +  + I++ + +  RL  F L+D         I P++  +  P   VIE  +
Sbjct: 563 NSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSMSERTLP---VIEMNN 619

Query: 451 VSFSYPTRPSV--------------------QI-FKSLN-FKIAPGSSVCIVGPSGRGKS 488
           ++F + ++ ++                    QI  K+++ F+   G  VC+VG  G GKS
Sbjct: 620 ITFLWKSKEALASGQFEGNSNADEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKS 679

Query: 489 TIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTY 548
           T    +L      +G+         KL  ++    +    QE  +M+ ++R+NI +G  +
Sbjct: 680 TFLKGILGQLPCMSGS---KGSIPPKLIIRA--SSLAYCSQESWIMNSSVRENILFGHKF 734

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI 608
                ++    K C     +   P+  +T++G  G  LSGGQK R+++ARA+  +  I +
Sbjct: 735 DKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYL 792

Query: 609 LDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 666
           LD+  SA+D E S+  + Y   G+    K+ TI+   + +  ++ S+ +  L  +G ++E
Sbjct: 793 LDDVLSAVDAEVSKNIVEYVLIGKAALLKNKTIILATNTVPILKHSQMIYAL-ENGEIIE 851

Query: 667 MGKFKELY--ANSTSALSQLLNERAAP----------------GPSDQQLQIEKVE---E 705
            G ++ +    N+ S L +LL E  +P                   D+ LQ++ VE   E
Sbjct: 852 QGNYEGVMNRENTNSKLKKLLEEFDSPIDNGSKSDIQTEHRSESDMDEPLQLKVVESETE 911

Query: 706 KEDTNEGE 713
            E   EGE
Sbjct: 912 DEIATEGE 919

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  135 bits (341), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 145/562 (25%), Positives = 248/562 (44%), Gaps = 92/562 (16%)

Query: 163  FSLPLYEFLSF---------FTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLH 213
            F + LY F  F         FT+   IG  A+                +L    +++ LH
Sbjct: 918  FYMGLYSFFVFGGYIFMTSQFTIVCFIGVNAS---------------KKLNLSAVRRILH 962

Query: 214  QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLS-PQLSI 272
                F D   +G +++R   D   +   +T+ V   + A    I+GV +MC +  P  +I
Sbjct: 963  TPMAFLDTTPLGRILNRFTKDTDSLDNELTENVR-LMLAQFANIIGVCVMCIIYLPWFAI 1021

Query: 273  LLLFFTPPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSFVAEGN 328
             +    P +L    +     ++  ++++  EA  +  +     E L G+ T++ + +E  
Sbjct: 1022 AI----PFILLIFVLVSNHYQSAGREIKRLEAIQRSFVYNNLNEVLGGMDTIRFYNSEER 1077

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL-----S 383
             +++ +  I  + + G               ++  + F  ++A    L +  Q      S
Sbjct: 1078 FMAKSDYLIDKMNEAGYLVVCVQRWVAVLLDMIA-VCFALIIAL---LCVTRQFHISASS 1133

Query: 384  IGDLTAFMLY--------------TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP 429
            +G L  ++L               TE   N+V  L ++ +E+   A           RKP
Sbjct: 1134 VGVLLTYVLQLPGLLNTVLRALTQTENDMNSVERLVSYATELPTEAAY---------RKP 1184

Query: 430  SISPTVGHKYQPERGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKS 488
              SP       P+ G I+F++VSF+Y P  P+V   K+L+  I  G  + I G +G GKS
Sbjct: 1185 ESSPDPS---WPQEGKIDFEEVSFAYRPGLPAV--LKNLSMSINGGEKIGICGRTGAGKS 1239

Query: 489  TIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNIT-YGLT 547
            TI   L R     +G I+ID  +I+ +    LRR + I+ Q+PVL  GTIR N+  +G  
Sbjct: 1240 TIMSALYRLNELESGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRKNLDPFGER 1299

Query: 548  Y------------TPTKEEIRSVAKQCFCHNFITKFPNTY--DTVIGPHGTLLSGGQKQR 593
                         +  KE +  V  Q    N   +  + +  D  +   G+  S G++Q 
Sbjct: 1300 SDDELWDALSRGGSIDKESLEEVKTQKSTGNSKVQELHKFHLDQEVEEEGSNFSLGERQL 1359

Query: 594  IAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKS-MTIVSIAHRLSTIRRS 652
            +A+ARAL++   +LILDEATS++D E++  I     +++++ S  TI+ IAHRL TI   
Sbjct: 1360 LALARALVRNSKVLILDEATSSVDYETDNKIQ---NRIIEAFSECTILCIAHRLKTILNY 1416

Query: 653  ENVIVLGHDGSVVEMGKFKELY 674
            + ++VL   G + E      LY
Sbjct: 1417 DRILVL-EKGEIAEFDSPYNLY 1437

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 102/211 (48%), Gaps = 20/211 (9%)

Query: 464 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           FK +N +I  G  + I GP G GK+++   +      T G++ I+ +             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
             ++   P + + T+RDNI +G  +  +K  +  V K C     +   P    T IG  G
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFGSPFDKSKYNM--VVKACCLDADLDILPAGDMTEIGERG 707

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI-NYTFGQLMKSKSMTIVSI 642
             LSGGQK RI +AR + K   I + D+  SA+D      I +     L+  K+  + + 
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGKTRVLAT- 766

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            H+LS +  +  VIVLG+DGS V++G  +EL
Sbjct: 767 -HQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  135 bits (341), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 136/528 (25%), Positives = 238/528 (45%), Gaps = 60/528 (11%)

Query: 171  LSFFTVALLIGCAANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            + +  + L+IG A +    G+ IL          ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLILYLIIGLAQSLLGAGKTILNFAAGINASRKIFNMILNKVLHSKIRFFDATPTGRI 1161

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ-LSI-----LLLFFTPPV 281
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ LSI     +L +F    
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSIAIVVSILYYFVGYF 1221

Query: 282  LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
              + S   K+  + S+        + +   E L G+ T+++F  EG  +      I +  
Sbjct: 1222 YMAGSRELKRFESISR------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENN 1275

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEY 396
            +                 ++G L    +   G +++     + S ++   LT  + +TE 
Sbjct: 1276 KPFFYLWVANRWLAFRIDMIGSL---VIFGAGLFILFNIDHIDSGMAGISLTYAISFTE- 1331

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YQPERGVIEFKDV 451
                   L   YSE+     +  R+ E    K    P   HK       P+ G IE  D+
Sbjct: 1332 ---GALWLVRLYSEVEMNMNSVERVKEYM--KIEQEPYNQHKEVPPSQWPQDGKIEVNDL 1386

Query: 452  SFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQ 510
            S  Y P  P  ++  +++F +   S + IVG +G GKSTI   L R+  P TG I IDN 
Sbjct: 1387 SLRYAPNLP--RVINNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNI 1444

Query: 511  DITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSV---------- 558
            DI+ ++ + LRR I I+ Q+P L SGTI+ N+     ++  K  E ++ V          
Sbjct: 1445 DISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDKKIFEALKRVNLISEEQSHQ 1504

Query: 559  -----AKQCFCHNF---ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
                 A      N    I KF +   + +   G+ LS GQ+Q + +AR+L++ P I++LD
Sbjct: 1505 GAVREADNDTSSNSSENINKFLDL-SSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLD 1563

Query: 611  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
            EAT+++D  S+  I  T  +  + +  TI++IAHRL ++   + ++V+
Sbjct: 1564 EATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM 1609

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 115/540 (21%), Positives = 219/540 (40%), Gaps = 61/540 (11%)

Query: 173 FFTVALLIG------CAAN---FGRFILLR----ILSERVVARLRAHVI----------- 208
           F+   + +G      C A    FGR + +R    I+SE     LR  +            
Sbjct: 395 FYVTTMFVGRILVAVCQAQALFFGRRVCIRMKSIIISEIYTKALRRMISTNKAKPTNEDP 454

Query: 209 -----KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMM 263
                +K+++ D E   +  +G +I+ +  DA+ VS  +   +   ++A +  +V + ++
Sbjct: 455 QEINDQKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALL 513

Query: 264 CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSF 323
             L    +I+ +     +L       K I +  K     T    +   E    I+ ++ F
Sbjct: 514 YHLLGFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYF 573

Query: 324 VAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL- 382
             E N     N  IR+  ++                     + +T  ++  Y+ +Q ++ 
Sbjct: 574 SWEENFEKEIN-TIRE-NELSLLLMRSIIWSISSFVWFVTPTIVTAASFAYYIYVQGEVL 631

Query: 383 -SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS-------ISPT 434
            +    TA  L+T    + +  LS   S ++Q   +  R+ +  + K +       I P 
Sbjct: 632 TTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDTKKYDQLTIDPN 690

Query: 435 VGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL 494
            G ++  E   I +   +  +         K LN +   G    ++GP+G GK+++ + L
Sbjct: 691 -GKRFALENSTISWDKDNQDFK-------LKDLNIEFKTGKLNVVIGPTGSGKTSLLMAL 742

Query: 495 LRYYNPTTGTIMID----NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           L       G I++      Q++  ++       I    Q   L++ TI+ NI +   +  
Sbjct: 743 LGEMYLLNGKIVVPALEPRQELV-VDANGTTNSIAYCSQGAWLLNDTIKHNILFNSPFNE 801

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
            +   ++V + C              T IG  G  LSGGQKQR+++ARAL      ++LD
Sbjct: 802 AR--YKAVVEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLLD 859

Query: 611 EATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
           +  SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG + + G
Sbjct: 860 DCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRIKDQG 917

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  135 bits (340), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 141/546 (25%), Positives = 240/546 (43%), Gaps = 62/546 (11%)

Query: 175  TVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
            TV L + C  +  ++             L + ++   L     FF+   +G +++R  +D
Sbjct: 1018 TVVLWVFCTIHGSKY-------------LHSSMVSSILRAPMTFFETTPIGRILNRFSND 1064

Query: 235  AY----VVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGK 290
             Y    V+ RS +Q   + VK     +V    +C  + Q  +L++    P+      + +
Sbjct: 1065 VYKIDEVLGRSFSQFFVNAVKVSFTILV----ICWNTWQFILLVI----PMGVLYLYYQQ 1116

Query: 291  QIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 346
                TS++L+         +    +E L G+ T++     G E  +  + I    +V   
Sbjct: 1117 YYLRTSRELRRLDSITKSPIYAHFQESLGGLATIR-----GYEQQKRFIHINQA-RVDNN 1170

Query: 347  XXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDLTAFML-----YTEYTGNA 400
                         L   L FL +++ +G+  +   +L  G LTA M+     Y      +
Sbjct: 1171 MSAYYPSINSNRWLAYRLEFLGSLIIFGAASLSILKLRDGTLTAGMIGLSLSYALQVTQS 1230

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY----QPERGVIEFKDVSFSYP 456
            +  +     E+     +  R+ E  + K      +  K      PERG I+F++ S  Y 
Sbjct: 1231 LNWIVRMTVEVETNIVSVERIKEYAELKSEAPLIIEEKRPSENWPERGAIKFENYSTRY- 1289

Query: 457  TRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKL 515
             RP +  + K+++  I P   V IVG +G GKS++ L L R      G+I++D  +I+++
Sbjct: 1290 -RPDLDLVLKNISLDIKPQEKVGIVGRTGAGKSSLTLALFRIIEAAEGSIIVDGLNISEI 1348

Query: 516  NCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF---- 571
                LR ++ I+ Q+  +  GTIR+NI     Y  T E+I +  +       I +     
Sbjct: 1349 GLYDLRHKLSIIPQDSQVFEGTIRENIDPTNIY--TDEQIWNALELSHLKQHILRMNEES 1406

Query: 572  -----PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
                  N   T +   G  LS GQ+Q + +ARAL+    ILILDEAT+A+DVE++  I  
Sbjct: 1407 VNGSENNALYTRVTEGGNNLSVGQRQLMCLARALLVPSKILILDEATAAVDVETDSLIQE 1466

Query: 627  TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
            T     K +  TI++IAHRL+TI  S+ ++VL   G V E    + L  N+ S    L  
Sbjct: 1467 TIRTAFKDR--TILTIAHRLNTIMDSDKIVVLD-KGEVAEFDTPQNLLKNTESLFYSLCE 1523

Query: 687  ERAAPG 692
            +    G
Sbjct: 1524 QSGLNG 1529

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 97/396 (24%), Positives = 175/396 (44%), Gaps = 40/396 (10%)

Query: 307 TRVAEEQLSGIKTVQSFVAEGN-----ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLL 361
           TRV  E L+ IK+++ +  E       E  R    ++++ ++G               L+
Sbjct: 485 TRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQFNLVPFLV 544

Query: 362 GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL 421
              +F  V  Y     L + L    LT F L T      +  L    +  ++ + + SRL
Sbjct: 545 SCSTF-AVFVYIEDKPLTTDLVFPALTLFNLLTF----PLAALPIVITAFIEASVSMSRL 599

Query: 422 FEL-------TDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAP 473
           F         TD    + P    K Q +  V    + +F +  +P  ++  K++ F+   
Sbjct: 600 FSFMTNEELQTDAIQRLPPV---KKQGDIAVNIGDNATFLWKRKPEYKVALKNIEFQAKK 656

Query: 474 GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLN-CKSLRRQIGIVQQEPV 532
           G   CIVG  G GKS     +L               D+ ++    ++   +  V Q P 
Sbjct: 657 GELACIVGKVGSGKSAFIQSIL--------------GDLFRVKGFATIHGNVAYVSQLPW 702

Query: 533 LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQ 592
           +M+GT++DNI +G  Y   +E      + C     ++  P+   T++G  G  LSGGQK 
Sbjct: 703 IMNGTVKDNILFGHKYN--QEFYEKTLRACALTIDLSILPDGDQTLVGEKGISLSGGQKA 760

Query: 593 RIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR 651
           R+++ARA+  +  + +LD+  +A+D   S+  I +  G      + T V   +++S +  
Sbjct: 761 RLSLARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTKTRVLATNKISVLSI 820

Query: 652 SENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
           ++N+ +L  DG +V+ G + E+  N  S L +L++E
Sbjct: 821 ADNITLLD-DGEIVQQGTYNEVTDNINSPLCKLISE 855

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 128/485 (26%), Positives = 219/485 (45%), Gaps = 31/485 (6%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    V+ R+ +Q   + VK     IV    +C  + Q    
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFFVNAVKVSFTIIV----ICFTTWQF--- 1090

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
             +F   P+      + +    TS++L+         +    +E L GI T++ +  +   
Sbjct: 1091 -IFIIIPLGVFYIYYQQYFLRTSRELRRLDSITKSPIFSHFQETLGGITTIRGYQQQHRF 1149

Query: 330  LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389
                   + +                     +G L  L       + + Q  L+ G +  
Sbjct: 1150 THINQCRVDNNMSAFYPSVNANRWLAYRLETIGSLIILGAATLSVFRLRQGTLTAGMVGL 1209

Query: 390  FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQP-----ERG 444
             + Y      ++  +     E+     +  R+ E +D K S +P V   ++P     + G
Sbjct: 1210 SLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLK-SEAPAVIEDHRPAETWPDEG 1268

Query: 445  VIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
             I+F+  S  Y  RP +  I K +N  I P   V IVG +G GKS++ L L R    ++G
Sbjct: 1269 DIKFEHYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEASSG 1326

Query: 504  TIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
             I+IDN  I ++    LR ++ I+ Q+  +  GT+R+NI     Y  T E+I +V     
Sbjct: 1327 RIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPTNEY--TDEQIWNVLALSH 1384

Query: 564  CHNFITKFPNT-YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
              + I    +   +  +   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++ 
Sbjct: 1385 LKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVETDK 1444

Query: 623  AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALS 682
             I  T     K +  TI++IAHR++TI  S+ +IVL  +G++ E    ++L  N +S   
Sbjct: 1445 VIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVLD-NGTIKEFDSPEKLLENPSSLFY 1501

Query: 683  QLLNE 687
             L  E
Sbjct: 1502 SLCQE 1506

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 119/241 (49%), Gaps = 20/241 (8%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           D +F +  +P  ++  K++NF+   G   CIVG  G GKS +   +L             
Sbjct: 628 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSAMIQSIL------------- 674

Query: 509 NQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++   +  V Q   +M+GT+++NI +G  Y   ++  +   K C     
Sbjct: 675 -GDLFRVKGFATIHGNVAYVSQVAWIMNGTVKENILFGHKYD--EDFYQKTIKACALTID 731

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +    +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   + +
Sbjct: 732 LAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEH 791

Query: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
             G      + T V   +++S +  +++V +L  +G +V+ G + E+  + +S LS+L+ 
Sbjct: 792 VLGPNGLLHTKTKVLATNKVSVLSIADSVSLL-ENGEIVQQGTYDEIMKDDSSPLSKLIT 850

Query: 687 E 687
           E
Sbjct: 851 E 851

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 130/487 (26%), Positives = 224/487 (45%), Gaps = 35/487 (7%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    ++ R+ +Q   + VK        + ++C+ + Q    
Sbjct: 1040 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFT----ITVICATTWQF--- 1092

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ TV+ + ++  
Sbjct: 1093 -IFIIIPLSVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQK 1149

Query: 329  ELSRYN-VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
              S  N   I +                    L+G +  L       + + Q  L+ G +
Sbjct: 1150 RFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMV 1209

Query: 388  TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTV--GH---KYQPE 442
               + Y       +  +     E+     +  R+ E  D K S +P +  GH   K  P 
Sbjct: 1210 GLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLK-SEAPLIVEGHRPPKEWPS 1268

Query: 443  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 501
            +G I+F + S  Y  RP +  + K +N  I P   V IVG +G GKS++ L L R    +
Sbjct: 1269 QGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEAS 1326

Query: 502  TGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAK 560
             G I+IDN  I ++    LR ++ I+ Q+  +  GT+R+NI     Y  T E I R++  
Sbjct: 1327 EGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQY--TDEAIWRALEL 1384

Query: 561  QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
                 + ++   +  D  +   G  LS GQ+Q + +ARA++    IL+LDEAT+A+DVE+
Sbjct: 1385 SHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVET 1444

Query: 621  EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSA 680
            +  +  T     K +  TI++IAHRL+TI  S+ +IVL  +G V E     +L +++ S 
Sbjct: 1445 DKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGKVAEFDSPGQLLSDNKSL 1501

Query: 681  LSQLLNE 687
               L  E
Sbjct: 1502 FYSLCME 1508

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 117/241 (48%), Gaps = 20/241 (8%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           D +F +  +P  ++  K++NF+   G+  CIVG  G GK+ +   +L             
Sbjct: 631 DATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCML------------- 677

Query: 509 NQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++   +  V Q P +M+GT+++NI +G  Y    E      K C     
Sbjct: 678 -GDLFRVKGFATVHGSVAYVSQVPWIMNGTVKENILFGHRYDA--EFYEKTIKACALTID 734

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +    +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +
Sbjct: 735 LAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEH 794

Query: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
             G      + T V   +++S +  ++++ +L  +G + + G + E+  ++ S L +LLN
Sbjct: 795 VLGPNGLLHTKTKVLATNKVSALSIADSIALLD-NGEITQQGTYDEITKDADSPLWKLLN 853

Query: 687 E 687
            
Sbjct: 854 N 854

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 146/556 (26%), Positives = 235/556 (42%), Gaps = 64/556 (11%)

Query: 156  FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQD 215
            F  K   F + +Y F  FF   +         +F L+  +      RL    +++ LH  
Sbjct: 935  FKHKKTPFYMGMYTFFVFFNYFVTTS------QFSLICYIGLSAAKRLNLKAVQRLLHTP 988

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLL 275
              F D   +G +++R   D   V   +T+ V   V  L   IVGV +MC       I L 
Sbjct: 989  MSFLDTTPIGRVLNRFTKDTDTVDTELTESVRLFVFQL-SNIVGVIVMCI------IYLP 1041

Query: 276  FFTPPVLFSASVF---GKQIRNTSKDLQEATG-QLTRVAE---EQLSGIKTVQSFVAEGN 328
            +F   V F   VF       +++S++++     Q + V     E L G+ T++++  E  
Sbjct: 1042 WFAIAVPFLMLVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTIRAYRGERR 1101

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT 388
             L++ +     + + G               ++  ++F  ++   + L +  Q  I   +
Sbjct: 1102 FLTKSDFLTNKMNEAGYLVVAIQRWVAIALDMIA-MAFALIV---TLLCVTRQFHISAAS 1157

Query: 389  AFMLYTEYTGNAVFGLSTFYSEIMQGAG---AASRL--------FELTDRKPSISPTVGH 437
              +L T Y       L+     + QG     +  RL         E   R+P +SP    
Sbjct: 1158 VGVLLT-YVLQLPGLLNMLLRAMTQGENDMNSTERLISYATELPLEAAYRRPEMSPPAE- 1215

Query: 438  KYQPERGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
               P  G IEF  VS +Y  RP +  + K +   +A G  + I G +G GKSTI   L R
Sbjct: 1216 --WPTDGRIEFDHVSLAY--RPGLPLVLKDVTLHVAAGEKIGICGRTGAGKSTIMSALYR 1271

Query: 497  YYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTK---- 552
                  G+I ID  DI+ L    LR ++ I+ Q+PV+  G +R N+      T  +    
Sbjct: 1272 MCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPFHERTDDELWHA 1331

Query: 553  ---------EEIRSVAKQCFCHNFITKFPNTY----DTVIGPHGTLLSGGQKQRIAIARA 599
                     E + +V  Q   H       N +       +   GT  S G++Q +A+ RA
Sbjct: 1332 LVRGGAIPAESLATVRAQ--THENAGSLSNMHKFHLQQEVEEDGTNFSLGERQLLALTRA 1389

Query: 600  LIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 659
            L+++  ILILDEATS++D E++  I     +     + TI+ IAHRL+TI   + ++VL 
Sbjct: 1390 LVRQSKILILDEATSSVDYETDAKIQTRIVEAF--SNCTILCIAHRLNTILDYDRILVLD 1447

Query: 660  HDGSVVEMGKFKELYA 675
              G V E      LYA
Sbjct: 1448 Q-GRVCEFDTPAALYA 1462

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 98/212 (46%), Gaps = 22/212 (10%)

Query: 464 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           F +LN +I  G  V + G  G GKS++   L  +   T G I    +D T L C      
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIY---KDGTMLLCGY---- 655

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
                  P + + T+RDNI +G  Y   +     + + C     +   P    T IG  G
Sbjct: 656 -------PWIQNATVRDNILFGSPYNEAR--YNEIIRVCSLQADLELLPAGDRTEIGERG 706

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVS 641
             LSGGQK RI +ARA+ KK  I + D+  SA+D      I      G+L  S   T V 
Sbjct: 707 ITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TRVL 763

Query: 642 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
             H+LS I R+  VI +  DGS V++G  +EL
Sbjct: 764 ATHQLSLIARASKVIYIDLDGS-VDVGSVEEL 794

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  133 bits (335), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 99/321 (30%), Positives = 154/321 (47%), Gaps = 22/321 (6%)

Query: 382  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGH---- 437
            LS G +   M Y     N +  +     ++     +  R+ E  D  P   P +      
Sbjct: 1221 LSTGMVGLLMSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPP 1280

Query: 438  KYQPERGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
            K  P +G+I FK+ S  Y  R ++  + + L+ +I P   + IVG +G GKST++L L R
Sbjct: 1281 KNWPSQGLIRFKNYSTRY--RANLDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFR 1338

Query: 497  YYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556
               P+ GTI ID  DI+K+  K LR  + I+ Q+     GT+R N+     Y  + EEI 
Sbjct: 1339 ILEPSEGTIDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPFEQY--SDEEIW 1396

Query: 557  SVAKQCFCHNFITKFP----------NTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTI 606
               +       I K            +   T I  +G+ LS GQ+Q + ++RAL+ +  I
Sbjct: 1397 KALELSHLKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRI 1456

Query: 607  LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 666
            L+LDEAT+A+D E++  I  T     K +  TI++IAHR+ T+  S+ ++VL   G V E
Sbjct: 1457 LVLDEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVLDK-GEVKE 1513

Query: 667  MGKFKELYANSTSALSQLLNE 687
                  L A   S    L ++
Sbjct: 1514 FDSPSNLLAQKDSIFYNLCDQ 1534

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 125/259 (48%), Gaps = 41/259 (15%)

Query: 469 FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI-MIDNQDITKLNCKSLR-RQIGI 526
           F++  G  VC+VG  G GKST    LL       G +  I N           R   + +
Sbjct: 649 FQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLPCISNSPSHASPTVHFRANSVAL 701

Query: 527 VQQEPVLMSGTIRDNITYG-----LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP 581
             Q+  +M+ +++DN+ +G      TY  T E  + V         +    +  +T++G 
Sbjct: 702 CSQQSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPD-------LEILADGDETLVGE 754

Query: 582 HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES-----EGAINYTFGQLMKSKS 636
            G  LSGGQK R+++ARA+  +  + +LD+  SA+D E      E  ++   G L+K+K 
Sbjct: 755 KGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTG-LLKNK- 812

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY-ANSTSALSQLL------NERA 689
            T++   + +S ++ S+++  L  DG +VE G F ++   + +S L +L+      N +A
Sbjct: 813 -TVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRLIVECESENTKA 870

Query: 690 APGPSDQQLQ----IEKVE 704
              P D +++    +E VE
Sbjct: 871 KIEPVDSEIKAPVNLEDVE 889

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 128/479 (26%), Positives = 221/479 (46%), Gaps = 35/479 (7%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    ++ R+ +Q   + VK        + ++C+ + Q    
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFT----ITVICATTWQF--- 1093

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ TV+ + ++  
Sbjct: 1094 -IFIIIPLGVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQK 1150

Query: 329  ELSRYN-VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
              S  N   I +                    L+G +  L       + + Q  L+ G +
Sbjct: 1151 RFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTSGMV 1210

Query: 388  TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTV--GH---KYQPE 442
               + Y       +  +     E+     +  R+ E  D K S +P +  GH   K  P 
Sbjct: 1211 GLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLK-SEAPLIIEGHRPPKQWPA 1269

Query: 443  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 501
            +G I F + S  Y  RP +  + K +N  I P   V IVG +G GKS++ L L R    +
Sbjct: 1270 QGDIRFNNYSTRY--RPELDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEAS 1327

Query: 502  TGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAK 560
             G I+ID   I ++    LR ++ I+ Q+  +  GT+R+NI     Y  + E I R++  
Sbjct: 1328 EGNIVIDGVSINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQY--SDEAIWRALEL 1385

Query: 561  QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
                 + ++   +  D  +   G+ LS GQ+Q + +ARA++    IL+LDEAT+A+DVE+
Sbjct: 1386 SHLKEHVLSMSNDGLDAQLSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVET 1445

Query: 621  EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
            +  +  T     K +  TI++IAHRL+TI  S+ +IVL  +G V E     +L +NS S
Sbjct: 1446 DKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DNGKVAEFDTPGQLLSNSKS 1501

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 130/272 (47%), Gaps = 26/272 (9%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           D +F +  +P  ++  K+++F+   G+  CIVG  G GK+ +   +L       G +   
Sbjct: 632 DATFLWQRKPEYKVALKNIDFQATKGNLTCIVGKVGSGKTALLSCML-------GDLFRV 684

Query: 509 NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
               T   C      I  V Q P +M+GT+++NI +G  Y    E      K C     +
Sbjct: 685 KGFATVHGC------IAYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKACALTIDL 736

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
               +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I + 
Sbjct: 737 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHV 796

Query: 628 FGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLL 685
            G   L+ +K+  + +  +++S +  ++++ +L  +G +++ G + ++  ++ S L +LL
Sbjct: 797 LGPNGLLHTKTRILAT--NKVSALSIADSIALL-DNGEIIQQGAYSDITKDADSPLWKLL 853

Query: 686 NERAAPGPSDQQLQIE----KVEEKEDTNEGE 713
           N+      + Q  + +     V E     EGE
Sbjct: 854 NDYGKKNNNKQSEECDSSKNSVRESSIPVEGE 885

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 130/482 (26%), Positives = 219/482 (45%), Gaps = 48/482 (9%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266
            V+ K LH    FFD    G +++RL  D   V + +         A++  I  + ++  +
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLVLIAYV 1173

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQ 321
            +PQ  I+ +F    + F  ++ G     TS++L+     +TR        E L GI +++
Sbjct: 1174 TPQFLIMAIF----IGFLYALIGYFYVTTSRELKRFE-SITRSPIYQHFSETLVGITSIR 1228

Query: 322  SFVAEG----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSY 375
            ++  E       LSR +   R  F +                LLG L   F  +  Y + 
Sbjct: 1229 AYGDERRFMLENLSRIDDNNRPFFYL----WIANRWLAFRVDLLGALVTFFSGLFIYLNI 1284

Query: 376  LVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL---FELTDRKPSIS 432
              L + L+   LT  + +TE            YS +     +  RL    E+     + +
Sbjct: 1285 GKLDAGLAGISLTYAIFFTE----GALWFVRHYSNVEMTMNSFERLKEYMEIEQEPYNEN 1340

Query: 433  PTVGHKYQPERGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIA 491
              +     P+ G I+  D+S  Y P  P  ++ K++NF + P   V IVG +G GKSTI 
Sbjct: 1341 AQLPPDNWPQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEPKLKVGIVGRTGAGKSTII 1398

Query: 492  LLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPT 551
              + R+ +P TG + IDN DIT +    LR+ I I+ Q+P L +GT++  +     Y+  
Sbjct: 1399 TAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSILDPYSQYSDK 1458

Query: 552  K--EEIRSV-------------AKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAI 596
            +  E ++ V                      I KF +  + V    G  LS GQ+Q + +
Sbjct: 1459 QIYEALQRVNLLSDTDINSLSSPSTQSSGENINKFLDLNNEVT-EGGANLSQGQRQLVCL 1517

Query: 597  ARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 656
            AR+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL +I   + V+
Sbjct: 1518 ARSLLRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAHRLKSIIDYDKVL 1575

Query: 657  VL 658
            V+
Sbjct: 1576 VM 1577

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 105/229 (45%), Gaps = 9/229 (3%)

Query: 446 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           + F++ + ++   PS    ++++ +   G      GP+G GKS++ L LL       G I
Sbjct: 672 LAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKI 731

Query: 506 MI---DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
            +   D ++   +    L   I    Q   L++ T R NI +   Y   ++    V + C
Sbjct: 732 YVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNILFNSPYN--EQRYNDVLEAC 789

Query: 563 FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                         T IG  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +  
Sbjct: 790 GLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTAL 849

Query: 623 AI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            I  N   G LM+ ++  +VS  H ++   R+ + +V+  +G V   G+
Sbjct: 850 LIYENCIIGPLMEGRTCVLVS--HNVALTMRNADWVVILENGRVKAQGE 896

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  132 bits (332), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 141/552 (25%), Positives = 242/552 (43%), Gaps = 64/552 (11%)

Query: 168  YEFLSFFTVALL---IGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKV 224
            Y    +F + LL   +G A     +      S ++  +L    + K LH    FFD+  +
Sbjct: 1096 YYLTIYFCIGLLQSIVGAAKTLISYYFGINASRKIFRKL----LDKVLHAKLRFFDSTPI 1151

Query: 225  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ-LSI-----LLLFFT 278
            G +++R   D   + + +         + I  I  + ++  ++PQ LS+     +L +  
Sbjct: 1152 GRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTIILITFITPQFLSVAIIVGMLYYMI 1211

Query: 279  PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
                 + S   K++ + +K        + +   E L G+ T+++F  E   L    + I 
Sbjct: 1212 GYFYLTGSRELKRLDSITK------SPIYQHFSETLVGVTTIRAFGDESRFLRENLLKID 1265

Query: 339  DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD-------LTAFM 391
            +  +                 ++G L     + +GS + + + ++  D       LT  +
Sbjct: 1266 ENNRPFFYLWVANRWLSFRIDVIGAL-----VVFGSGIFILTNINTIDSGMAGISLTYAI 1320

Query: 392  LYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKP----SISPTVGHKYQPERGV 445
             +TE        L  FYSE+     +  R+ E    +++P     +S +      PE G 
Sbjct: 1321 SFTE----GALWLVRFYSEVEMNMNSVERVHEYMTIEQEPYDEVQVSDSKVPADWPEEGR 1376

Query: 446  IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
            IE  D+S  Y      ++ K++ F + P + V +VG +G GKSTI   L R+    TG I
Sbjct: 1377 IEVSDLSLRYAAHLP-KVIKNVTFNVDPRAKVGVVGRTGAGKSTIITALFRFLEAETGYI 1435

Query: 506  MIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TK 552
             ID  DIT +N   LRR I I+ Q+P L SGTI+ N+     Y               T+
Sbjct: 1436 KIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNLDPYDEYKDEEVFEALRRVNLVTE 1495

Query: 553  EEIRSVAKQ-----CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTIL 607
            EE+ S  +            I +F +  ++ I   GT  S GQ+Q I +AR+L++ P IL
Sbjct: 1496 EELSSRTENNNDEASVSSKNINRFLDL-ESEIAEGGTNFSQGQRQLICLARSLLRSPKIL 1554

Query: 608  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            +LDEAT+++D +S+  +  T     +    TI++IAHRL ++   + ++V+G  G V E 
Sbjct: 1555 LLDEATASIDYDSDAKVQETIRT--EFSESTILTIAHRLRSVIDYDKILVMGA-GEVKEY 1611

Query: 668  GKFKELYANSTS 679
                 L  N  S
Sbjct: 1612 DHPYSLLLNKNS 1623

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 113/230 (49%), Gaps = 13/230 (5%)

Query: 446 IEFKDVSFSYP-TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           I FK+ + ++  +R S ++ ++LN     G    I+GP+G GK+++ + LL   N   G 
Sbjct: 701 IAFKNTTVAWDNSRDSFKL-RNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLLEGQ 759

Query: 505 IMI----DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
           I++       D+  +        I    Q   L++ T+R+NI +   Y  T+    +V +
Sbjct: 760 IVVPALNARHDLI-VESDGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNETR--YHNVVE 816

Query: 561 QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
            C              T IG  G  LSGGQKQRI++ARAL      ++LD+  SA+D  +
Sbjct: 817 ACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVDAHT 876

Query: 621 EGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
              +  N   G LM+ ++  +VS  H ++   R+ +++V+  DG V + G
Sbjct: 877 ALWVYDNCITGPLMEGRTCILVS--HNIALTLRNADLVVMLEDGQVKDQG 924

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 146/569 (25%), Positives = 242/569 (42%), Gaps = 86/569 (15%)

Query: 154  DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLH 213
            D F  + P F + LY F  F +   +       G++ LL  +       L    + K LH
Sbjct: 933  DKFHNRSPSFYMGLYSFFVFGSYIFM------NGQYTLLCYMGVVASKTLNLQALHKILH 986

Query: 214  QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLS-PQLSI 272
                F D + +G +++R   D   +   +T+ +   +   I  I+GVG MC +  P  +I
Sbjct: 987  TPMSFMDTNPLGRILNRFTKDTDALDNELTENLRLAMSQ-IANIIGVGAMCIIYLPWFAI 1045

Query: 273  LLLFFTPPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSFVAEGN 328
             +    P +L    +     ++T ++++  EA  +  +     E L+G+ T++++ A+  
Sbjct: 1046 AI----PFLLLIFLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMDTIKAYNAQDR 1101

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVL-------QSQ 381
              ++    I  + +                       FL ++A    L++       Q  
Sbjct: 1102 FATKSEFLIDKMNEAAYISIAVQRWAGI---------FLDLVAVAFALIITLLCVTRQFH 1152

Query: 382  LSIGDLTAFMLY-----------------TEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            +S  D    + Y                 TE   N+   L ++ +++ Q         E 
Sbjct: 1153 ISGADTGVLLTYVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQ---------EA 1203

Query: 425  TDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPS 483
              RKP  SP +     P+ G I F++++F+Y  RP + I  K+ N  I P   + I G +
Sbjct: 1204 QYRKPECSPPID---WPQNGHIVFENINFAY--RPGLPIILKNFNLIIKPNEKIGICGRT 1258

Query: 484  GRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDN-- 541
            G GKSTI   L R    TTG I+ID+ DI+ L    LR ++ I+ Q+PVL  G IR N  
Sbjct: 1259 GAGKSTIMNALYRLTELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLD 1318

Query: 542  --------------ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLS 587
                          +  G   +   E ++S  K     N + KF    +  +   G   S
Sbjct: 1319 PFDEYQDDLLWESLVKAGAIDSQELETVKSQDKNSDAKN-LHKF--HLNQSVDEDGNNFS 1375

Query: 588  GGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 647
             G++Q +A+ RAL+++  ILILDEATS++D E++  I             TI+ IAHRL 
Sbjct: 1376 LGERQVLALTRALVRQSKILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLK 1433

Query: 648  TIRRSENVIVLGHDGSVVEMGKFKELYAN 676
            TI   + ++VL   G V E      L+ N
Sbjct: 1434 TILNYDRILVL-EKGEVAEFDTPWNLFNN 1461

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 104/220 (47%), Gaps = 22/220 (10%)

Query: 463 IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRR 522
           +  ++NF I  G  V + GP G GK+++   L       +G +   N     L C     
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEM---NHSGDLLLC----- 675

Query: 523 QIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPH 582
             GI    P + + TIRDNI +G  Y PT    + V   C   + +   P    T +G  
Sbjct: 676 --GI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVS 641
           G  LSGGQK RI++ARA+ K   I + D+  SA+D       ++Y     +  K+  + +
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDKTRILAT 787

Query: 642 IAHRLSTIRRSENVIVL--GHDGSVVEMGKFKELY-ANST 678
             H+LS + +++ +IVL    D    E+G FKEL   NST
Sbjct: 788 --HQLSLVEKADRIIVLSTSKDAPHFEIGTFKELIKTNST 825

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 128/486 (26%), Positives = 222/486 (45%), Gaps = 33/486 (6%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    ++ R+ +Q   + VK        + ++C  + Q    
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFT----ITVICVTTWQF--- 1093

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ TV+ + ++  
Sbjct: 1094 -IFIIVPLGVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQK 1150

Query: 329  ELSRYN-VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
              S  N   I +                    L+G +  L       + + Q  L+ G +
Sbjct: 1151 RFSHINQCRIDNNMSAFYPSVNANRWLAYRLELIGSVIILGAATLSVFRLKQGTLTAGMV 1210

Query: 388  TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTV--GH---KYQPE 442
               + Y       +  +     E+     +  R+ E  D K S +P V  GH   K  P 
Sbjct: 1211 GLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADIK-SEAPLVIEGHRPPKEWPG 1269

Query: 443  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 501
            +G I+F   S  Y  RP +  + K ++  I P   + IVG +G GKS++ L L R    +
Sbjct: 1270 QGDIKFNQYSTRY--RPELDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEAS 1327

Query: 502  TGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561
             G I+ID   I ++    LR ++ I+ Q+  +  GT+R+NI     YT  +   R++   
Sbjct: 1328 AGNIVIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYTD-EAMWRALELS 1386

Query: 562  CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
                + ++   +  D+ +   G+ LS GQ+Q + +ARA++ +  IL+LDEAT+A+DVE++
Sbjct: 1387 HLKEHILSMSNDGLDSQLTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVETD 1446

Query: 622  GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSAL 681
              I  T     K +  TI++IAHRL+TI  S+ +IVL  +G V E     +L  N+ S  
Sbjct: 1447 KVIQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGKVAEFDSPAQLLTNTKSLF 1503

Query: 682  SQLLNE 687
              L  E
Sbjct: 1504 YSLCAE 1509

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 124/243 (51%), Gaps = 24/243 (9%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           D +F +  +P  ++  K++NF+   G   C+VG  G GK+  ALL     + T G     
Sbjct: 632 DATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKT--ALL-----SSTLG----- 679

Query: 509 NQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    S+   +  V Q P +M+GT+++NI +G  Y    E      K C     
Sbjct: 680 --DLFRVKGFASVHGSVAYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKACALTID 735

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +    +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   + +
Sbjct: 736 LAILMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEH 795

Query: 627 TFGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
             G   L+ +K+  + +  +++S +  ++++ +L  +G +++ G + ++  ++ S L +L
Sbjct: 796 VLGSNGLLHTKTKLLAT--NKVSALSVADSIALLD-NGEIIQQGTYDDITKDADSPLWKL 852

Query: 685 LNE 687
           + +
Sbjct: 853 IKD 855

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 140/560 (25%), Positives = 240/560 (42%), Gaps = 72/560 (12%)

Query: 163  FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 222
            F + LY F  FF         A   +F +L  +       L    +K+ LH    F D  
Sbjct: 927  FYMGLYTFFVFFNYF------ATTSQFSVLCYMGLSAAKWLNLKAVKRLLHTPMSFLDTT 980

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGIVGVGMMCSLS-PQLSILLLFFT 278
             +G +++R   D    + ++  ++++ V+  +     IVGV +MC +  P  +I +    
Sbjct: 981  PIGRVLNRFTKD----TDTLDTELTESVRLFLFQASNIVGVVIMCIIYLPWFAIAV---- 1032

Query: 279  PPVLFSASVFGKQIRNTSKDLQEATG-QLTRVAE---EQLSGIKTVQSFVAEGNELSRYN 334
            P +L   +      +++S++++     Q + V     E LSG+ T++++  E   L++ +
Sbjct: 1033 PFLLLIFAAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIRAYRGEARFLTKSD 1092

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
              I  + + G               ++  ++F  ++   + L +  Q SI   +  +L T
Sbjct: 1093 FLINKMNEAGYVVVAIQRWVSIALDMIA-MAFALII---TLLCVTRQFSISAASVGVLLT 1148

Query: 395  EYTGNAVFGLSTFYSEIMQGAG---AASRL--------FELTDRKPSISPTVGHKYQPER 443
             Y       L+T    + QG     +A RL         E   R+P  SP    +  P  
Sbjct: 1149 -YVLQLPGLLNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRPETSPP---ESWPSE 1204

Query: 444  GVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 502
            G I+F  VS +Y  RP +  +   ++  +  G  + I G +G GKSTI   L R      
Sbjct: 1205 GAIDFDHVSLAY--RPGLPLVLHDVSLHVRGGEKIGICGRTGAGKSTIMSALYRMIELHD 1262

Query: 503  GTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNIT--------------YGLTY 548
            G+I ID  DI +L    LR ++ I+ Q+PVL  G +R N+                    
Sbjct: 1263 GSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSDNELWDALVRAGA 1322

Query: 549  TPTKEEIRSVAKQCFCHNFITKFPNTY-DTVIGPHGTLLSGGQKQRIAIARALIKKPTIL 607
              T++E  + A        +T     + +  +   G+  S G++Q +A+ RAL++   IL
Sbjct: 1323 IATEDEAAARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLLALTRALVRSSRIL 1382

Query: 608  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            ILDEATS++D E++  I             T++ IAHRL+TI   + ++VL   G V E 
Sbjct: 1383 ILDEATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDRILVLDQ-GRVCEF 1439

Query: 668  ----------GKFKELYANS 677
                      G F E+ A S
Sbjct: 1440 DTPHALFVRNGLFTEMCARS 1459

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/284 (29%), Positives = 124/284 (43%), Gaps = 44/284 (15%)

Query: 450 DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 509
           D S S   + + + FK+LN +IA G  V + G  G GKS++   +  +    +G I    
Sbjct: 580 DTSSSNEPKVNFKGFKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIY--- 636

Query: 510 QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPT--KEEIRSVAKQCFCHNF 567
           ++ + L C             P + + T++DNI +G  +     KE IR     C     
Sbjct: 637 KNGSLLLCGY-----------PWIQNTTVKDNILFGSPFDEARYKETIRV----CSLQAD 681

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--N 625
           +   P    T IG  G  LSGGQK RI +AR++ KK  I + D+  SA+D      I   
Sbjct: 682 LDLLPAGDKTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDE 741

Query: 626 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL------------ 673
              G L      T V   H+LS I R+  VI +  DG+ V+ G   EL            
Sbjct: 742 CMMGAL---DGKTRVLATHQLSLIARASKVIFIDLDGT-VDSGTLDELKSRHAGFVKLME 797

Query: 674 YANSTSALS------QLLNERAAPGPSDQQLQIEKVEEKEDTNE 711
           Y+N TS         ++ +E   PGP   Q +IE  E K+  ++
Sbjct: 798 YSNHTSTDEEEGQDGEVEHEENRPGPHRSQSEIEASELKKQVSK 841

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 129/488 (26%), Positives = 218/488 (44%), Gaps = 37/488 (7%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    ++ R+ +Q   + VK +      + ++C+ + Q    
Sbjct: 1039 FFETTPIGRILNRFSNDIYKIDSILGRTFSQFFVNAVKVVFV----MAVICATTWQ---- 1090

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L GI T++ +  E  
Sbjct: 1091 FIFVIIPLGVFYIYYQQYYLRTSRELRRL-DSITRSPVYSHFQETLGGITTIRGYNQEKR 1149

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS---IG 385
                    + +                    L+G +  L       + + +  L+   +G
Sbjct: 1150 FGHINQCRVDNNMSAFYPSINANRWLAFRLELIGSIIILGAATLSIFRLKEGTLTPGMVG 1209

Query: 386  DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK----YQP 441
               ++ L    T N +  ++    E+     +  R+ E    +      V  K      P
Sbjct: 1210 LSLSYALQITQTLNWIVRMTV---EVETNIVSVERVKEYAQLESEAPRIVEEKRPDEMWP 1266

Query: 442  ERGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
              G I+F++ S  Y  RP +  + K++N  I P   V IVG +G GKS++ L L R    
Sbjct: 1267 TEGDIKFENYSTRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEA 1324

Query: 501  TTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
            T G I+ID   I ++    LR ++ I+ Q+  +  GT+R+NI    T   T EEI  V +
Sbjct: 1325 TAGNIIIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENI--DPTNLFTDEEIWRVLE 1382

Query: 561  QCFCHNFITKF-PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
                   +     +  D  +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE
Sbjct: 1383 LSHLKEHVLSMGADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDVE 1442

Query: 620  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
            ++  +  T     K +  TI++IAHRL+TI  S+ +IVL   G +VE     EL A   S
Sbjct: 1443 TDKIVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-KGEIVEFDTPDELLAKPES 1499

Query: 680  ALSQLLNE 687
                L NE
Sbjct: 1500 LFYSLCNE 1507

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 120/241 (49%), Gaps = 20/241 (8%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           + +F +  +P  ++  K++NF+   G   CIVG  G GKS +   +L             
Sbjct: 628 NATFLWKRKPEYKVALKNINFQAKKGDLTCIVGKVGSGKSALIQSIL------------- 674

Query: 509 NQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++   +  V Q P +M+GT+++NI +G  Y   +E      K C     
Sbjct: 675 -GDLFRVKGFATVHGNVAYVSQVPWIMNGTVKENILFGHKYD--QEFYEKTIKACALTID 731

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +    +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   S+  + +
Sbjct: 732 LGILVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVEH 791

Query: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
             G      S T V   +++S +  ++++ +L  +G +V+ G ++E+ ++  S L +L+ 
Sbjct: 792 VLGPTGLLHSKTKVLCTNKISVLSIADSITLL-ENGEIVQQGSYEEVNSDEDSPLFKLIK 850

Query: 687 E 687
           E
Sbjct: 851 E 851

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 138/558 (24%), Positives = 240/558 (43%), Gaps = 80/558 (14%)

Query: 163  FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 222
            F + +Y F  F ++  L G      +F LL  +  R    L    + + +H    F ++ 
Sbjct: 839  FYMGMYSFFVFGSIVFLTG------QFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMEST 892

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGIVGVGMMCSLS-PQLSILLLFFT 278
             +G +++R   D    + S+  ++ D ++ ++   C IVG+ ++C +  P  +I +    
Sbjct: 893  PMGRIMNRFTKD----TESLDNQILDNLRFVVYQACTIVGISVLCIIYLPWFAIAIPGLG 948

Query: 279  PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE------------ 326
              +  + S +    R   +        +     + L G+ T++++ AE            
Sbjct: 949  LILFVACSHYQSSAREIKRLEAVQRSFIYNHLNDVLGGVDTIRAYGAEERFSYKLDYLID 1008

Query: 327  -GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIG 385
              NE S    A++    +               SLL       +    + +VL   L I 
Sbjct: 1009 KTNEASYLYTAVQR--WINIVINLVGISFTLIVSLLCVTKVFNLSGASTGVVLSYVLLIP 1066

Query: 386  DLT----AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQP 441
            DL       +  TE   N+V  L T+ +E+ Q A     +       PS       K  P
Sbjct: 1067 DLLNNTLTMVTQTENDMNSVERLVTYATELPQEASHGEEV-------PS-------KTWP 1112

Query: 442  ERGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
            E G I+F++V +++    P+V        KIA G  V I G +G GKST+   L R    
Sbjct: 1113 ENGEIKFENVRYTHRDGLPAV--LDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREV 1170

Query: 501  TTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
             +G +MID+ D++KLN  +LR ++ I+ Q+PVL  G++R N+       P  E    V K
Sbjct: 1171 ESGRVMIDDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNL------DPFGEYDDDVLK 1224

Query: 561  QCFCHNFITKFPNT---------------------YDTVIGPHGTLLSGGQKQRIAIARA 599
                   + KF  T                      D  +  +G   S G++Q +A+ARA
Sbjct: 1225 NALMRCTVGKFNKTGNESTEGIDTDADNGLVGKFRLDQDVEENGCNFSVGERQVLALARA 1284

Query: 600  LIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 659
            LI+  +IL+LDEAT+A+D  ++  +     +  K +  T++ +AHRL TI   + ++VL 
Sbjct: 1285 LIRNSSILVLDEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVL- 1341

Query: 660  HDGSVVEMGKFKELYANS 677
             +G ++ +   K L  N+
Sbjct: 1342 ENGKIIGLDTPKSLLDNN 1359

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 130/256 (50%), Gaps = 28/256 (10%)

Query: 464 FKSLNFKIAPGSSVCIVGPSGRGKST----IALLLLRYYNPTTGTIMIDNQDITKLNCKS 519
           F  LNF+I  G  + IVGP G GK++    I  L+ +Y N   G + +D   ++   C  
Sbjct: 531 FHDLNFEIMKGELIIIVGPIGSGKTSLLNAICGLMPQYGNE--GELEVDGSLVS---CGY 585

Query: 520 LRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD-TV 578
                      P + + T+RDNI +G  Y  +K   + V + C     + K  + YD T 
Sbjct: 586 -----------PWIQNTTVRDNILFGSKYDESK--FKRVIRMCSLEEDLEKL-SAYDMTE 631

Query: 579 IGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSM 637
           IG  G  LSGGQK RI +AR+L K+  I + D+  SA+D    +  +     + +K+K+ 
Sbjct: 632 IGERGVTLSGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKECLMEGLKNKTR 691

Query: 638 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQ 697
            + +  H+LS I +++ +IVLG+DG   +MG++++L   + + ++ +   +      +++
Sbjct: 692 VLAT--HQLSLIGKADQLIVLGNDGK-FDMGRYEDLIKTNETLINLMQYAKLQEEIQEKE 748

Query: 698 LQIEKVEEKEDTNEGE 713
             I+   EK +T   E
Sbjct: 749 EVIKDKNEKTETTISE 764

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 137/494 (27%), Positives = 218/494 (44%), Gaps = 78/494 (15%)

Query: 212  LHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLS 271
            LH    FFD   +G +++R   D   V + +T  +   +  LI     + ++  ++P   
Sbjct: 1089 LHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSIIFLITIITPHFL 1148

Query: 272  I------LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 325
            I      +L +F      +AS   K+I + +K        + +   E L G+ T+++F  
Sbjct: 1149 IVAVVVFILYYFVGMWYLTASRELKRIDSITK------SPIFQHFSETLVGVCTIRAFGD 1202

Query: 326  EG----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-- 379
            E       L + +   R  F +               + +       VLA GS++++   
Sbjct: 1203 EKRFILENLDKIDQNNRAFFYLSVAVKWFAFRVDIIGAFI-------VLASGSFILINIG 1255

Query: 380  ---SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--------DRK 428
               S L+   LT  +L+T+        L   YS       +  RL E +        D  
Sbjct: 1256 NIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSSIEQENYFDYN 1311

Query: 429  PSISPTVGHKYQPERGVIEFKDVSFSYPTR-PSVQIFKSLNFKIAPGSSVCIVGPSGRGK 487
                  +     PE G IE  ++S  Y +  P V   K+++F I P S V IVG +G GK
Sbjct: 1312 KDHIQELQQSSWPEHGQIEVDNLSLRYASNLPPV--IKNVSFTIEPQSKVGIVGRTGAGK 1369

Query: 488  STIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLT 547
            STI   L R   P TG I ID  DI++++  +LRR I I+ Q+P+L +GTI+ N+     
Sbjct: 1370 STIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNVDPCDE 1429

Query: 548  YTPTKEEIRSVAKQCFCHNFIT-------------------KFPNTYDTVIGPHGTLLSG 588
            Y   K  I  V  Q    N I+                   KF N   T I   G  +S 
Sbjct: 1430 YDNKK--IFKVLSQV---NLISTGEMEAAQNMGDDSNTARNKFVNL-QTEITEGGQNISQ 1483

Query: 589  GQKQRIAIARALIKKPTILILDEATSALDVESE----GAINYTFGQLMKSKSMTIVSIAH 644
            G++Q + IAR+L+++P I++LDEATS++D ES+    G I   F +       TI++IAH
Sbjct: 1484 GERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNK------STILTIAH 1537

Query: 645  RLSTIRRSENVIVL 658
            RL ++   + V+V+
Sbjct: 1538 RLRSVIDYDRVLVM 1551

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 118/480 (24%), Positives = 206/480 (42%), Gaps = 57/480 (11%)

Query: 223 KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMM-----CSLSPQLSILLLFF 277
            +G +I+ +  D++ VS  ++      V+A+I  ++ VG++      S    +SI+L+ F
Sbjct: 446 NLGTIINLISIDSFKVSE-ISTYFYMTVQAIIMVLIVVGLLFKFLGISALAGISIILMMF 504

Query: 278 TPPVLFS-ASVFGKQIRNTSKDLQEATGQLT--RVAE--EQLSGIKTVQSFVAEGNELSR 332
             P+ F  A + GK         Q++  Q T  R+A+  E L  I+ V+ F  E N +S+
Sbjct: 505 --PLNFRLAELLGK--------FQKSALQCTDKRIAKLNECLQNIRIVKYFAWENN-ISK 553

Query: 333 YNVAIRD-----IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
              +IR      +FQ                +L+  ++F  +  +  +  L + L+   L
Sbjct: 554 DIKSIRQNELRFLFQKALVWALSSFLWFVTPTLVTGVTF-AIYIFVQHQELNAPLAFTTL 612

Query: 388 TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQ-----PE 442
           + F L        +  LS   S + Q   +  R+ +  +   +       KY      P+
Sbjct: 613 SLFTLLK----TPLDQLSNMLSFMNQSIVSLDRIVKFINEDDT------EKYNQLTVSPD 662

Query: 443 RGVIEFKDVSFSY-PTRPSVQIFK--SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
              IEFK+ + ++        IFK   LN     G    I+G +G GKS + + LL   +
Sbjct: 663 ENKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLMGLLGELH 722

Query: 500 PTTGTIMIDN----QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 555
             +G+I +       D+   +   L        Q   L++ T+++NI +   Y   +   
Sbjct: 723 LISGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAWLLNDTVKNNIIFNGAYDDVR--Y 779

Query: 556 RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
           + V   C     +   P    T IG  G  LSGGQKQRI++ARA+      ++LD+  SA
Sbjct: 780 KEVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLLDDCLSA 839

Query: 616 LDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
           +D  +   I  N   G +M+++  T + + H +S   R     V+  +G V   G  K+L
Sbjct: 840 VDSHTAVWIYENCITGPIMENR--TCILVTHNVSLTIREAYFAVILENGKVKNQGTIKQL 897

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 124/493 (25%), Positives = 224/493 (45%), Gaps = 67/493 (13%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266
            ++ + LH    FFD+  +G +++R   D      S+ Q++   ++++    + V      
Sbjct: 1129 LLDRVLHARVRFFDSTPIGRIMNRFSKDI----ESIDQEIPPNIQSVFYSAIEVFA---- 1180

Query: 267  SPQLSILLLFFTPPVLFSA--------SVFGKQIRNTSKDLQE----ATGQLTRVAEEQL 314
                ++LL+ +  P  F          S+ G     TS++L+     +   + +   E L
Sbjct: 1181 ----TLLLISYITPAFFPVAIIIVLGYSIVGFFYLTTSRELKRLDSISKSPIFQHFSETL 1236

Query: 315  SGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
             G+ T+++F  +     + N+++ D  Q                  +  +  L + + G 
Sbjct: 1237 VGVTTIRAF-GDEQRFIKENLSMID--QNSMPFFYLWVVNRWLSFRIDLIGALVIFSSGV 1293

Query: 375  YLVLQ-SQLSIG----DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DR 427
            +++L  + +  G     LT  + +TE    A   L   YSE+     +  R+ E    ++
Sbjct: 1294 FILLNINNIDAGLAGISLTYAISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQ 1349

Query: 428  KPSISPTVGH----KYQPERGVIEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGP 482
            +P I+            P+ G +E  ++S  Y P  P V   K + F I P   V IVG 
Sbjct: 1350 EPLIADPANAVTPPPQWPDSGKVEVNNLSLKYAPHLPYV--IKDVTFTIEPLEKVGIVGR 1407

Query: 483  SGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNI 542
            +G GKSTI   L R+    TG+I +D  +I  ++ K LRR I I+ Q+P L +G+IR N+
Sbjct: 1408 TGAGKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSNL 1467

Query: 543  TYGLTYTPTKEEIRSVAK-----------------QCFCHNFITKFPNTYDTVIGPHGTL 585
                 Y  + EEI +  K                 Q      + KF N  ++ I   G+ 
Sbjct: 1468 DPYDEY--SDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKFLNL-ESEIAEGGSN 1524

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
             S GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  Q  +  + T+++IAHR
Sbjct: 1525 FSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQ--EFNNSTVLTIAHR 1582

Query: 646  LSTIRRSENVIVL 658
            L +I   + ++V+
Sbjct: 1583 LRSIVDYDKILVM 1595

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 111/235 (47%), Gaps = 9/235 (3%)

Query: 446 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           + F++V+  + +     + ++L+ +   G    IVG +G GK++I + LL     + G I
Sbjct: 706 LAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKI 765

Query: 506 MIDN---QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
           ++ +   +   +     +   I    Q   L++ T+R+NI +   +   + +  +V + C
Sbjct: 766 IVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFNAPFDQARYD--AVVEAC 823

Query: 563 FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                         T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +  
Sbjct: 824 SLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTAL 883

Query: 623 AI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYA 675
            I      G LM+ +  T + + H ++   ++ + +V+  DG V E G   EL A
Sbjct: 884 WIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKGTPIELLA 936

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  129 bits (325), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 136/549 (24%), Positives = 246/549 (44%), Gaps = 44/549 (8%)

Query: 167 LYEFLSFFTVALLIGCAA--NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKV 224
           ++ F+  +++ L +G AA  N    I+L   S R   +L  ++ K  +     FF+   V
Sbjct: 446 VWMFVGVYSL-LGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 504

Query: 225 GDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFS 284
           G +I+R  SD   V  S+    S   K+++  +V + ++    P   +  +F     ++ 
Sbjct: 505 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYY 564

Query: 285 ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG 344
            + +    R   + +  +   +  +  E L+G   + ++    N   R+     D  Q  
Sbjct: 565 QTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAY----NHYERFIYLNYDKIQSN 620

Query: 345 XXXXXXXXXXXXXXSLLGDLSFLTVLAYGSY-----LVLQSQLSIGDLTAFMLYT-EYTG 398
                         S+       T++   +      +  ++QLS G +   M Y+ E T 
Sbjct: 621 IDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTS 680

Query: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKP---SISPTVG-HKYQPERGVIEFKDVSFS 454
           +  + + T    I     +  R+ E  +  P   SI+P     +  P  G IEFK+ S  
Sbjct: 681 SLTWIVRTTVM-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTK 739

Query: 455 YPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT 513
           Y  R ++  + K +N  I P   + IVG +G GKST++L L R   P+ G I+ID+ +I+
Sbjct: 740 Y--RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNIS 797

Query: 514 KLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF-- 571
           +L    LR  + I+ Q+     GT+R N+     Y  +++E++   +     + + K   
Sbjct: 798 ELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY--SEDELKRAIELAHLKSHLEKMLG 855

Query: 572 ----------------PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
                            +  D  I  +G+ LS GQ+Q + +ARAL+    IL+LDEAT++
Sbjct: 856 NEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATAS 915

Query: 616 LDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYA 675
           +D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL   G+V E     +L +
Sbjct: 916 VDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVLDK-GNVKEFDSPSKLLS 972

Query: 676 NSTSALSQL 684
           +  S    L
Sbjct: 973 DKGSIFYSL 981

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 114/230 (49%), Gaps = 16/230 (6%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRR--QIG 525
           +F+   G  +C+VG  G GKST    +L      +G+          L  K + R   + 
Sbjct: 88  HFEAKRGDLICVVGRVGAGKSTFLKAILGQLPCMSGSK-------ESLAPKLIIRASSLA 140

Query: 526 IVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL 585
              QE  +M+ ++R+NI +G  +     ++    K C     +   P+  +T++G  G  
Sbjct: 141 YCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGIS 198

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIA 643
           LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I +   G+    K+ TI+   
Sbjct: 199 LSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTT 258

Query: 644 HRLSTIRRSENVIVLGHDGSVVEMGKFKELY--ANSTSALSQLLNERAAP 691
           + +S ++ S+ +  L  +G +VE G ++ +    N +S L +LL E   P
Sbjct: 259 NTVSILKHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEEFDTP 307

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  130 bits (326), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 134/548 (24%), Positives = 245/548 (44%), Gaps = 42/548 (7%)

Query: 167  LYEFLSFFTVALLIGCAA--NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKV 224
            ++ F+  +++ L +G AA  N    I+L   S R   +L  ++ K  +     FF+   V
Sbjct: 1017 VWMFVGVYSL-LGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 1075

Query: 225  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFS 284
            G +I+R  SD   V  S+    S   K+++  +V + ++    P   +  +F     ++ 
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYY 1135

Query: 285  ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQ-- 342
             + +    R   + +  +   +  +  E L+G   + ++    N   R+     D  Q  
Sbjct: 1136 QTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAY----NHYERFIYLNYDKIQSN 1191

Query: 343  ---VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 399
               V               ++   +   T L   + +  ++QLS G +   M Y+    +
Sbjct: 1192 IDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTS 1251

Query: 400  AVFGLSTFYSEIMQGAGAASRLFELTDRKP---SISPTVG-HKYQPERGVIEFKDVSFSY 455
            ++  +      I     +  R+ E  +  P   SI+P     +  P  G IEFK+ S  Y
Sbjct: 1252 SLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKY 1311

Query: 456  PTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITK 514
              R ++  + K +N  I P   + IVG +G GKST++L L R   P+ G I+ID+ +I++
Sbjct: 1312 --RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISE 1369

Query: 515  LNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF--- 571
            L    LR  + I+ Q+     GT+R N+     Y  +++E++   +     + + K    
Sbjct: 1370 LGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY--SEDELKRAIELAHLKSHLEKMLGN 1427

Query: 572  ---------------PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
                            +  D  I  +G+ LS GQ+Q + +ARAL+    IL+LDEAT+++
Sbjct: 1428 EAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASV 1487

Query: 617  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
            D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL   G+V E     +L ++
Sbjct: 1488 DMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVLDK-GNVKEFDSPSKLLSD 1544

Query: 677  STSALSQL 684
              S    L
Sbjct: 1545 KGSIFYSL 1552

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 123/250 (49%), Gaps = 16/250 (6%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIV 527
           +F+   G  +C+VG  G GKST    +L      +G+         KL  ++    +   
Sbjct: 659 HFEAKRGDLICVVGRVGAGKSTFLKAILGQLPCMSGS---KESLAPKLIIRA--SSLAYC 713

Query: 528 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLS 587
            QE  +M+ ++R+NI +G  +     ++    K C     +   P+  +T++G  G  LS
Sbjct: 714 SQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLS 771

Query: 588 GGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIAHR 645
           GGQK R+++ARA+  +  I +LD+  SA+D E S+  I +   G+    K+ TI+   + 
Sbjct: 772 GGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTNT 831

Query: 646 LSTIRRSENVIVLGHDGSVVEMGKFKELY--ANSTSALSQLLNERAAP----GPSDQQLQ 699
           +S ++ S+ +  L  +G +VE G ++ +    N +S L +LL E   P      SD++  
Sbjct: 832 VSILKHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEEFDTPIDNMNESDRRTD 890

Query: 700 IEKVEEKEDT 709
                ++E+T
Sbjct: 891 QSPERDEEET 900

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  129 bits (325), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 132/541 (24%), Positives = 233/541 (43%), Gaps = 31/541 (5%)

Query: 167  LYEFLSFFTVALLIGCAAN-FGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVG 225
            +++F++ + +  L   A N F   I+L   S R    L   + K  +    +FF+   +G
Sbjct: 1001 VWKFVAVYALIGLGSAAFNIFRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPIG 1060

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +I+R  SD   V  ++    S   ++++  I+ V ++    P   +          +  
Sbjct: 1061 RVINRFSSDIDSVDVNLQNVFSIFFRSILDYILTVILVSVAMPWFLLFNALIMIIYFYYE 1120

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS------FVAEGNELSRYNVAIRD 339
             ++  Q R   +    A   +  +  E L G   + +      F     E  +YN+ +  
Sbjct: 1121 KLYIVQSRELKRLTSIAYSPIISLMSETLGGQMVISAYNHSKMFKFMNIERVQYNLNVLF 1180

Query: 340  IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 399
             F+                S+   +   T L   + L   S +  G +   M Y     +
Sbjct: 1181 TFR-----STNRWLSIRLQSIGAFIILCTGLLALTTLRTSSPIGSGLIGLLMSYVLQVTS 1235

Query: 400  AVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG----HKYQPERGVIEFKDVSFSY 455
            A+  +     +I     +  R+ E     P     +      +  P+RG IEFK+ + +Y
Sbjct: 1236 ALTWIVRSTVQIETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQRGSIEFKNYTTTY 1295

Query: 456  PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKL 515
                S  + K+++  I P   V IVG +G GKST++L L R      GTI ID  DI+++
Sbjct: 1296 RANLS-PVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEGTIFIDGVDISRI 1354

Query: 516  NCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT- 574
                LR  + I+ Q+     GT+R N+     +T    E+ +V +       + +     
Sbjct: 1355 GLTDLRGNMAIIPQDAQAFEGTVRSNLDPFQKHTDV--ELWNVIELSHLKPHVLRMAEDD 1412

Query: 575  --------YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
                     D  I  +G+ LS GQ+Q + +ARAL+ +  +L+LDEAT+A+DVE++  I  
Sbjct: 1413 NLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDEATAAVDVETDKIIQE 1472

Query: 627  TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
            T     K +  TI++IAHRL TI  ++ ++VL   G V E    K L ++ ++   QL +
Sbjct: 1473 TIRTQFKDR--TILTIAHRLDTIMDNDKILVLDA-GGVKEFDSPKNLLSDESTLFYQLCD 1529

Query: 687  E 687
            +
Sbjct: 1530 K 1530

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 111/218 (50%), Gaps = 18/218 (8%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDIT-KLNCKSLRRQIGI 526
           +F  +P S  C++G  G GK+T+   +L      +G+     + I+ KL+ +     I  
Sbjct: 646 HFTASPKSLTCVIGKVGSGKTTLLKAILGQLPCISGS----KESISPKLSIRG--ESIAY 699

Query: 527 VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
             QE  +M+ TI++NI +G  +  T   +   A +      I   P+   T++G  G  L
Sbjct: 700 CPQEAWIMNDTIKENILFGHKFDETYYTLTVAACELLADFDI--LPDGDQTLVGEKGISL 757

Query: 587 SGGQKQRIAIARALIKKPTILILDEATSALDVE-----SEGAINYTFGQLMKSKSMTIVS 641
           SGGQK R+++ARA+  +  I +LD+  SA+D        E  ++   G L+++K  T++ 
Sbjct: 758 SGGQKARVSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSG-LLRNK--TVIL 814

Query: 642 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
             + +S ++ S+ +  L  +G +VE G + ++  ++ S
Sbjct: 815 STNTVSVLKHSQLIYAL-ENGIIVERGNYNDIIESANS 851

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  129 bits (325), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 126/489 (25%), Positives = 214/489 (43%), Gaps = 39/489 (7%)

Query: 218  FFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y V     R+ +Q + + VK +   IV    +C  + Q    
Sbjct: 1045 FFETTPIGRILNRFSNDIYKVDSLLGRTFSQFLVNAVKVVFTMIV----ICWTTWQF--- 1097

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ T++ +    N
Sbjct: 1098 -IFIIGPLGVLYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGMSTIRGY----N 1151

Query: 329  ELSRYN----VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSI 384
            +  R++      I +                     +G +  L       Y + Q  L+ 
Sbjct: 1152 QQRRFDHINHCRIDNNMSAFYPSINANRWLAFRLESIGSVIILGAATLSIYRLGQGTLTA 1211

Query: 385  GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK----YQ 440
            G +   + Y       +  +     E+     +  R+ E ++ K      +  K    + 
Sbjct: 1212 GMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIEEKRPAAHW 1271

Query: 441  PERGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
            P+ G I F   S  Y  RP +  + + +N  I P   + IVG +G GKS++ L L R   
Sbjct: 1272 PDSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRIVE 1329

Query: 500  PTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
             ++G I+ID   I ++    LR  + I+ Q+  +  GTIR+N+    TY  T +EI  V 
Sbjct: 1330 ASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENVDPTETY--TDDEIWRVL 1387

Query: 560  KQCFCHNFITKF-PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            +    +  +    P      +   G+ LS GQ+Q + +ARAL+    ILILDEAT+A+DV
Sbjct: 1388 ELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEATAAVDV 1447

Query: 619  ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANST 678
            E++  I  T     + +  TI++IAHR++TI  S+ ++VL   G V E      L  N  
Sbjct: 1448 ETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVLD-GGRVTEFDTPTNLLRNEG 1504

Query: 679  SALSQLLNE 687
            S    L  E
Sbjct: 1505 SQFHSLCQE 1513

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 120/250 (48%), Gaps = 38/250 (15%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           D +F +  +P  ++  K++NF+   G   C+VG  G GKS +   L              
Sbjct: 630 DATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRVGSGKSALIQSL-------------- 675

Query: 509 NQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
           + D+ ++    ++   +  V Q   +M+GT+++NI +G  Y P  E      K C     
Sbjct: 676 SGDLFRVKGFATVHGSVAYVSQVAWIMNGTVKENILFGHRYDP--EFYDKTIKACALTID 733

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +    +  +T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D    +  + +
Sbjct: 734 LAVLVDGDETLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVGKHLLEH 793

Query: 627 TFG---------QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANS 677
             G         +++ +  ++++SIA R          I L  +G +VE G + E+ A+ 
Sbjct: 794 VLGPTGLLRTKTKILATNKISVLSIADR----------IALLENGEIVEQGSYDEVTADG 843

Query: 678 TSALSQLLNE 687
            SALS+L+ +
Sbjct: 844 DSALSKLIRD 853

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  129 bits (324), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 133/522 (25%), Positives = 229/522 (43%), Gaps = 45/522 (8%)

Query: 167  LYEFLSFFTVALLIGCAA--NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKV 224
            L++F+  + + L I  AA  N    I+L   S R    L   +    L     FF++  +
Sbjct: 1025 LWKFVGIYAL-LGISSAAFDNIRAVIILLYSSIRGSKVLHNKMAVSVLKSPMGFFESTPI 1083

Query: 225  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFS 284
            G +I+R  SD   V R++    +   K ++   V + ++    P      L F   +L  
Sbjct: 1084 GRIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILLIGYNMP----WFLVFNAGLLVV 1139

Query: 285  ASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFV-AEGNELSRYNVAIRD 339
               +       S++L+     A   +  +  E L G   + +F  +E      +N   + 
Sbjct: 1140 YVYYQVFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAFRHSERFHFLNFN---KT 1196

Query: 340  IFQVGXXXXXXXXXXXXXXSLL---GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEY 396
             FQ+                L    G +  +T L   + +  + Q++ G +   M Y   
Sbjct: 1197 QFQIDAQFNLRSTNRWLSIRLQIIGGAMVLITALLTLATIGTKKQMTAGLVGLLMSYVLQ 1256

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPER-----GVIEFKDV 451
              N++  +    + I     +  R++E   + PS +P +    +PE+     G I FKD 
Sbjct: 1257 VTNSLMWIVRMTTMIETNIISVERIYEYC-QLPSEAPAIIESSRPEKSWPSMGEIIFKDY 1315

Query: 452  SFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQ 510
            S  Y  RP +  + K +N  I P   + +VG +G GKS+++L L R    T G+I ID  
Sbjct: 1316 STKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRLLESTGGSIEIDGV 1373

Query: 511  DITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITK 570
            DI+K+    LR  + I+ Q+     GT+R N+     Y+   +EI    +       I K
Sbjct: 1374 DISKIGLYDLRSHLSIIPQDAQAFEGTVRSNLDPFNQYSV--QEIWKAVELAHLKPHIIK 1431

Query: 571  F-----PN---------TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
                  P+           D  I  +G  +S GQ+Q + ++RAL+ K  +L+LDEAT+A+
Sbjct: 1432 MMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSKSKVLVLDEATAAV 1491

Query: 617  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
            D+E++  I  T     + K  TI++IAHR+ T+  S+ ++VL
Sbjct: 1492 DMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL 1531

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 123/250 (49%), Gaps = 22/250 (8%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIV 527
           +F+   G+  C+VG  G GKST+   +L      +G     + +I         R +   
Sbjct: 661 HFEAKKGALTCVVGRVGSGKSTLLRAILGQLPCRSGPKEFISPEIL-----VRARSVAYC 715

Query: 528 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLS 587
            Q P +M+ +I+DNI +G  Y  T   +    K C     +       +T++G  G  LS
Sbjct: 716 PQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGISLS 773

Query: 588 GGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIA 643
           GGQK R+++ARA+  +  + ++D+  SA+D E S+  I+   G+   L+K K  TI+   
Sbjct: 774 GGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIILTT 831

Query: 644 HRLSTIRRSENVIVLGHDGSVVEMGKFKELYA-NSTSALSQLLNE--RAAPGPSDQQLQI 700
           + +S ++ S N+I     G +VE G +++  +    S L +L+ E    A  PSD+    
Sbjct: 832 NAVSVLKHS-NMIYALQGGRIVEEGTYEQAVSRGDDSVLQKLIKEFDTFAENPSDK---- 886

Query: 701 EKVEEKEDTN 710
            K +E+ D++
Sbjct: 887 -KKDEENDSH 895

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 144/545 (26%), Positives = 247/545 (45%), Gaps = 46/545 (8%)

Query: 173  FFTVALLIGCAA----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 228
            F  V  LIG A+    N    ++L   S R   +L   + K  +     FF+   VG +I
Sbjct: 1020 FVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRII 1079

Query: 229  SRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVF 288
            +R  SD   V  ++    S   K+++  +V V ++    P   +  +F     ++  + +
Sbjct: 1080 NRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQTFY 1139

Query: 289  GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS------FVAEGNELSRYNVAIRDIFQ 342
                R   + +  +   +  +  E L+G   + +      F+    E  +YNV     F+
Sbjct: 1140 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVFNFR 1199

Query: 343  VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT-EYTGNAV 401
                             +L       +LA  + +  + QLS G +   M Y+ E TG+  
Sbjct: 1200 STNRWLSVRLQTIGATIVLAT----AILALAT-MNTKRQLSSGMVGLLMSYSLEVTGSLT 1254

Query: 402  FGLSTFYSEIMQGAGAASRLFELTDRKP---SISPTVG-HKYQPERGVIEFKDVSFSYPT 457
            + + T  + I     +  R+ E  +  P   SI+P     +  P +G IEFK+ S  Y  
Sbjct: 1255 WIVRTTVT-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKY-- 1311

Query: 458  RPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLN 516
            R ++  +  ++N KI P   V IVG +G GKST++L L R   PT G I+ID  DI+ + 
Sbjct: 1312 RENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIG 1371

Query: 517  CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-- 574
               LR  + I+ Q+     GT++ N+     Y  +++E++   +Q      + K  ++  
Sbjct: 1372 LFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRY--SEDELKRAVEQAHLKPHLEKMLHSKP 1429

Query: 575  ---------------YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
                            D  I  +G+ LS GQ+Q + +ARAL+ +  IL+LDEAT+++D+E
Sbjct: 1430 RGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDME 1489

Query: 620  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
            ++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL   GSV E     +L ++ TS
Sbjct: 1490 TDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVLDQ-GSVREFDSPSKLLSDKTS 1546

Query: 680  ALSQL 684
                L
Sbjct: 1547 IFYSL 1551

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 125/246 (50%), Gaps = 14/246 (5%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIV 527
           +F+   G  VC+VG  G GKST    +L      +G+    +    KL  +S    +   
Sbjct: 659 HFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGS---RDSIPPKLIIRS--SSVAYC 713

Query: 528 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLS 587
            QE  +M+ ++R+NI +G  +     ++    K C     +   P+  +T++G  G  LS
Sbjct: 714 SQESWIMNASVRENILFGHKFDQDYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLS 771

Query: 588 GGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIAHR 645
           GGQK R+++ARA+  +  I +LD+  SA+D E S+  I Y   G+    K+ TI+   + 
Sbjct: 772 GGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNT 831

Query: 646 LSTIRRSENVIVLGHDGSVVEMGKFKELY--ANSTSALSQLLNERAAP--GPSDQQLQIE 701
           +S ++ S+ +  L  +G +VE G ++++    N+TS L +LL E  +P    ++  +Q E
Sbjct: 832 VSILKHSQMIYAL-ENGEIVEQGNYEDVMNRKNNTSKLKKLLEEFDSPIDNGNESDVQTE 890

Query: 702 KVEEKE 707
              E E
Sbjct: 891 HRSESE 896

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 130/540 (24%), Positives = 234/540 (43%), Gaps = 36/540 (6%)

Query: 170  FLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLIS 229
            ++  + + +L   A  F +FI + +L       L    +++ LH    F D   +G +++
Sbjct: 911  YMGLYILFVLGSLAFMFTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVMN 970

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGIVGV----GMMCSLSPQLSILLLFFTPPVLFSA 285
            R   D    + ++  ++++ V+ LI  I  +     +     P  +I + F     +F A
Sbjct: 971  RFTKD----TDTLDNEITESVRLLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVFVA 1026

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 345
              +    R   +        +     E L G+ T++++ +E   L + +  I  + + G 
Sbjct: 1027 DHYQASGREIKRMDAVQRSFVYNNFNEVLGGMDTIKAYRSEQRFLMKSDFLINKMNEAGY 1086

Query: 346  XXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLS 405
                          +L  + F  ++A    +  Q  +S G +   + Y       +  L 
Sbjct: 1087 LVTSIQRWVAISLDMLA-VIFALIIALLC-VTRQFHVSAGSVGVMVTYVLQLPGLLNALL 1144

Query: 406  TFYSEIMQGAGAASRLFELT-----DRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPS 460
               ++      +A RL         + K  I  T   +  P  G I+F++VS +Y  RP 
Sbjct: 1145 RSQTQTENDLNSAERLVNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVSLAY--RPE 1202

Query: 461  VQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKS 519
            + +  K+++  I     + I G +G GKSTI   L R     TG I ID+ DI+ L    
Sbjct: 1203 LPVALKNVSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDDIDISTLGLYE 1262

Query: 520  LRRQIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKEEIRSVAKQCFCHN 566
            LR ++ I+ Q+PVL  G IR N+      T               ++++ S+  Q    N
Sbjct: 1263 LRSKLAIIPQDPVLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDAN 1322

Query: 567  FIT--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
             ++   F    D ++   G+  S G++Q +A+ RAL++   ILILDEATS++D  ++  I
Sbjct: 1323 GLSGDMFKFHLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYATDAKI 1382

Query: 625  NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
                 +  +  + TI+ IAHRL TI     ++VL   G VVE    K+LY +  S  +++
Sbjct: 1383 QSRIVE--EFSNCTILCIAHRLKTILAYNRILVLDQ-GQVVEFDTPKKLYNDRDSIFNEM 1439

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 112/244 (45%), Gaps = 22/244 (9%)

Query: 464 FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           F  LNF +     + I GP G GKS++   L  +   ++G++ I       L C      
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKGD---LLLCGY---- 644

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
                  P + + T++DNI +G  +   K + + V + C     +   P    T IG  G
Sbjct: 645 -------PWVQNATVKDNILFGSPFD--KPKYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK RIA+AR++ K   I + D+  SA+D    +  ++      +K K+  + + 
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTRILAT- 754

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANST--SALSQLLNERAAPGPSDQQLQI 700
            H+LS I ++  VI LG DGS  ++G   EL   +T  S L Q  N   A    D   + 
Sbjct: 755 -HQLSLIDKASRVIFLGLDGS-FDIGTVPELLKRNTGFSDLMQFQNSAPAEELEDDDTKA 812

Query: 701 EKVE 704
           + +E
Sbjct: 813 QNME 816

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  127 bits (318), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 146/522 (27%), Positives = 228/522 (43%), Gaps = 84/522 (16%)

Query: 206  HVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCS 265
            +++   LH +  FFD   VG +++R   D             +GV   +   + V + C 
Sbjct: 1078 NMLDLVLHANIRFFDVTPVGRIMNRFAKDI------------EGVDQELIPYLEVTIFC- 1124

Query: 266  LSPQLSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE-----------E 312
            L   LSI+ L    TP  L  A V         K    A  +L R+             E
Sbjct: 1125 LIQCLSIIFLITIITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSE 1184

Query: 313  QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL-SFLTVLA 371
             L+G+ T+++F   G+E  R+ +   D                   +   D+     VL 
Sbjct: 1185 TLAGVCTIRAF---GDE-KRFILENMDKIDQNNRAFFYLSVAVKWFAFRVDIIGAFIVLG 1240

Query: 372  YGSYLVLQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT- 425
             GS+++L      S L+   LT  +L+T+        L   YS       +  RL E + 
Sbjct: 1241 SGSFILLNIGDIDSSLAGISLTYSILFTD----GALWLVRLYSTFEMNMNSVERLKEYSG 1296

Query: 426  ----DRKPSISPTVGHKYQPERGVIEFKDVSFSYPTR-PSVQIFKSLNFKIAPGSSVCIV 480
                +   +    + +   PE G IE  ++S  Y +  P V   K+++F + P + + IV
Sbjct: 1297 IEQENYNENHIQALQNSLWPEHGKIEVDNLSLRYASNLPPV--IKNVSFTVDPQTKIGIV 1354

Query: 481  GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRD 540
            G +G GKSTI   L R   P TG I ID  DI+K++  +LRR I I+ Q+P+L +GTI+ 
Sbjct: 1355 GRTGAGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKS 1414

Query: 541  NITYGLTYTPTKE-EIRSVAKQCFCHNFIT------------KFPNTYD------TVIGP 581
            N+       P  E + R + K     N I+             F   ++      T I  
Sbjct: 1415 NL------DPYDEYDERRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNLRTEIVE 1468

Query: 582  HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE----GAINYTFGQLMKSKSM 637
             G  LS G+KQ + IAR+L+++P I++LDEATS++D +S+    G I   F +       
Sbjct: 1469 GGLNLSQGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEFSR------S 1522

Query: 638  TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
            TI++IAHRL ++   + V+V+   G V E     EL  N  S
Sbjct: 1523 TILTIAHRLRSVIDYDKVLVMDA-GEVKEYDHPYELLKNERS 1563

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 115/246 (46%), Gaps = 22/246 (8%)

Query: 441 PERGVIEFKDVSFSYPTRPS-VQIFK----SLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
           P++  I+FK  +  +    + +  F+    ++NF+I  G    I+G +G GKS + + LL
Sbjct: 657 PDKNKIKFKKATLVWNENDNDINKFRLCDLNINFRI--GKLNLILGSTGSGKSALLMGLL 714

Query: 496 RYYNPTTGTIMIDNQD-----ITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP 550
                 +G+I++   +     I  LN   L        Q   L++GT+R+NI +   Y  
Sbjct: 715 GELYLLSGSIIVPGLEPRHDMIPDLN--GLTNSFAYCSQSAWLLNGTVRNNIIFNGVYDE 772

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
            +   ++V   C     +   P    T IG  G  LSGGQKQRI++ARA+      ++LD
Sbjct: 773 NR--YKNVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLD 830

Query: 611 EATSALDVESEGAINYTF---GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
           +  SA+D  +   I Y     G LMK++  T + + H +S   R     V+  +G V   
Sbjct: 831 DCLSAVDSHTAIWI-YEICITGLLMKNR--TCILVTHNISLAIRKAYFAVILENGKVKSQ 887

Query: 668 GKFKEL 673
           G   EL
Sbjct: 888 GTITEL 893

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  127 bits (318), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 131/245 (53%), Gaps = 11/245 (4%)

Query: 446  IEFKDVSFSY-PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
            I F  V   Y P  P V   K+++F + P S V IVG +G GKST+ + L R    T GT
Sbjct: 1238 ISFDHVYVRYAPHLPDV--LKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIELTNGT 1295

Query: 505  IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC-- 562
            I I   DI  LN ++LRR++ ++ Q+P L SGTI+ NI     Y  + +E+   A++   
Sbjct: 1296 IRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFGRY--SDQELTHFARRIGL 1353

Query: 563  FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
            F      +  N+  +++   G  +S GQ+Q + +ARAL++K  ILILDEAT+++D E++ 
Sbjct: 1354 FSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASIDHETDA 1413

Query: 623  AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALS 682
             I         S    ++++AHR+STI   + VIVL  D  +V+      L      A  
Sbjct: 1414 TIQQVVRDF--SSGGIVITVAHRMSTIIDYDQVIVL--DSGIVKENNHPYLLLKQNGAFH 1469

Query: 683  QLLNE 687
            Q+  E
Sbjct: 1470 QMCKE 1474

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 145/323 (44%), Gaps = 29/323 (8%)

Query: 365 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT-----GNAVFGLSTFYSEIMQGAGAAS 419
           + +T   +G+ + LQ Q     +T    YT  T      N +  L+T    I+Q   +  
Sbjct: 556 TLVTAATFGASIYLQKQ----KITVASAYTALTLFALLRNPLTQLATMLGTIIQTTVSIQ 611

Query: 420 RLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI 479
           R+ +  +R  +    +      E G   F++ S ++    +  + K+L           I
Sbjct: 612 RIEKFLNRSNTKKHEILKDSFTEMG---FRNASLTWNRFDTGFMLKNLTIDFELHKLNVI 668

Query: 480 VGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIR 539
           +GPSG GKS++ L LL   +   G+I +    +    C           Q P + + T++
Sbjct: 669 IGPSGSGKSSVLLALLGELDLIEGSIRVPRGYMHDDRCS-----FAFCSQTPWITNATVK 723

Query: 540 DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARA 599
           +NI +   +   + +   V   C     I +     +TV+G  G  LSGGQ+QR+A+ARA
Sbjct: 724 ENIVFSSQFNTKRYQ--EVLHACGLEEDILEMQEGDETVVGDKGMTLSGGQRQRLALARA 781

Query: 600 LIKKPTILILDEATSALDVESEGAINYTF-----GQLMKSKSMTIVSIAHRLSTIRRSEN 654
           +      L+LD+  SA+D    G   + F     G LMK K  T +   H ++ +++  +
Sbjct: 782 VYSGAEHLLLDDCLSAVD---PGMAVWIFQKCIMGPLMKGK--TCILATHNIALVQKHAD 836

Query: 655 VIVLGHDGSVVEMGKFKELYANS 677
           +I+L  +G V ++GK ++   +S
Sbjct: 837 MIILLDNGRVSKIGKARDFNFDS 859

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  127 bits (318), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 124/486 (25%), Positives = 214/486 (44%), Gaps = 33/486 (6%)

Query: 218  FFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y V     R+ +Q   + VK     IV    +CS + Q    
Sbjct: 1020 FFETTPIGRVLNRFSNDIYKVDELLGRTFSQFFVNAVKVSFTIIV----ICSSTWQF--- 1072

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L GI T++ +  +G 
Sbjct: 1073 -VFVIIPLGTLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGISTIRGYQQQGR 1130

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT 388
             L      + +                     +G +  L       + + Q  L+ G + 
Sbjct: 1131 FLHINQARVDNNMSAFYPSVNANRWLAFRLEFIGSIIILGAATLSVFRLKQGALTPGMIG 1190

Query: 389  AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPE-----R 443
              + Y      ++  +     E+     +  R+ E  +  P  +P V    +P       
Sbjct: 1191 LSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPE-APAVIESNRPAEDWPTH 1249

Query: 444  GVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 502
            G I+F++ S  Y  RP + +  +++N  I P   + IVG +G GKS++ L L R      
Sbjct: 1250 GAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIEAAE 1307

Query: 503  GTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
            G I+ID      +  + LR  + I+ Q+  +  GT+R+NI     Y  T EEI    +  
Sbjct: 1308 GRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENIDPTNEY--TDEEIWHALELA 1365

Query: 563  FCHNFITKF-PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
               + I     +  ++++   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++
Sbjct: 1366 HLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDVETD 1425

Query: 622  GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSAL 681
              I  T     K++  TI++IAHR++TI  S+ ++VL   G + E    + L  N  S  
Sbjct: 1426 QVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEFDSPEALLKNRESLF 1482

Query: 682  SQLLNE 687
              L  E
Sbjct: 1483 YSLCQE 1488

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 140/278 (50%), Gaps = 33/278 (11%)

Query: 427 RKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGR 485
           RKP ++ T       E  +    D +F +  +P  ++  K++NF+   G   CIVG  G 
Sbjct: 599 RKPKVTKT------GEVAINVGADATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGS 652

Query: 486 GKSTIALLLLRYYNPTTGTIMIDNQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITY 544
           GKS +   +L               D+ ++    S+   I  V Q P +M+GT+++NI +
Sbjct: 653 GKSALIQGIL--------------GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKENILF 698

Query: 545 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKP 604
           G  Y     +  +  + C     ++  P   +T++G  G  LSGGQK RI++ARA+  + 
Sbjct: 699 GHKYDADFYD--TTLRACALAVDLSILPKGDETLVGEKGISLSGGQKARISLARAVYARA 756

Query: 605 TILILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
              +LD+  +A+D   ++  I +  G   L+ SK   + +  +++S +  ++++ +L  +
Sbjct: 757 DTYLLDDPLAAVDEHVAKHLIEHVLGSQGLLSSKVKVLAT--NKISVLSIADHISLL-EN 813

Query: 662 GSVVEMGKFKELYANSTSALSQLL---NERAAPGPSDQ 696
           G +++ G ++E+ ++ +SALS+++    ++   G  D+
Sbjct: 814 GEIIQQGSYEEVTSDKSSALSKIIANYGKKQTKGKGDE 851

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  126 bits (317), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 131/559 (23%), Positives = 236/559 (42%), Gaps = 49/559 (8%)

Query: 169  EFLSFFTVALLIGCAA----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKV 224
            +FL F T+  +IG  +    N    I+L   S R   +L   +    +     FF+   +
Sbjct: 1019 DFLKFVTIYAIIGLLSAAFNNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPI 1078

Query: 225  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFS 284
            G +++R  SD   +   +    S   ++++  +V + ++    P    L         + 
Sbjct: 1079 GRIVNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVLIMIYFYY 1138

Query: 285  ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG 344
             + +    R   +    +   +  +  E L G   + +F    +  SR+N    +  Q  
Sbjct: 1139 QAYYIMLSRELKRLTTISYSPIMSLISETLGGFSVINAF----DHTSRFNFFNFETVQYN 1194

Query: 345  XXXXXXXXXXXXXXSL-LGDLSFLTVLAYG--SYLVL--QSQLSIGDLTAFMLYTEYTGN 399
                          S+ L  +  L +LA G  S+  L  + QLS G +   M Y+    +
Sbjct: 1195 IDCVFQFRSTNRWLSVRLQTIGNLIILATGLLSFATLGTKKQLSSGMVGLLMSYSLQVTS 1254

Query: 400  AVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPE----RGVIEFKDVSFSY 455
            ++  +     +I     +  R  E  + KP     + +   PE     G IEF + +  Y
Sbjct: 1255 SLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPREGAIEFNNYTTKY 1314

Query: 456  PTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITK 514
              R ++  + K +N  I P   + IVG +G GKST+ L L R    T G+I ID  DI+K
Sbjct: 1315 --RENLDPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGIDISK 1372

Query: 515  LNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF--- 571
            +  + LR  + I+ Q+     GTIR N+     +  + EE+    +       I +    
Sbjct: 1373 IGLEDLRSNLAIIPQDAQAFEGTIRSNLDPFDQH--SDEELWRAVELSHLKQHILRMNEE 1430

Query: 572  ---------------PNTYD------TVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
                           P++++      T I  +G+ +S GQ+Q + ++RAL+    +LILD
Sbjct: 1431 ANDRESDSSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVLILD 1490

Query: 611  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
            EAT+A+D+E++  +  T     K +  TI++IAHR+ T+   + ++VL   G V E    
Sbjct: 1491 EATAAIDMETDKIVQDTIKNEFKER--TILTIAHRIDTVMNYDKILVLDK-GEVAEFDTV 1547

Query: 671  KELYANSTSALSQLLNERA 689
              L ++  +   +L  + A
Sbjct: 1548 SNLLSDKNTMFYKLCEQGA 1566

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 114/226 (50%), Gaps = 16/226 (7%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIV 527
           NF +  GS  CIVG  G GKSTI   +L      +    +D     K+  ++    I   
Sbjct: 650 NFTVKKGSLTCIVGKVGSGKSTILHAILGQLPCISA---LDQTRAPKVTIRA--TSIAYC 704

Query: 528 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLS 587
            QE  +M+ ++++NI +G  +      +  V + C   + ++  P+  +T++G  G  L 
Sbjct: 705 PQEAWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSILPDGDETIVGEKGISLV 762

Query: 588 GG-QKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSI 642
           GG QK RI++ARA+  +  + +LD+  SA+D   S+  I Y   +   L+++K  TI+  
Sbjct: 763 GGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--TIILS 820

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANS-TSALSQLLNE 687
            + ++ ++ S+ +  +   G +VE   ++ +  +S  S + +L+ E
Sbjct: 821 TNNVNVLKNSQKIYAI-EKGEIVEESDYENVMNSSDASRIKKLIEE 865

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 127/524 (24%), Positives = 225/524 (42%), Gaps = 36/524 (6%)

Query: 175  TVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
            TV L + C  +  R+             L   +    L     FF+   +G +++R  +D
Sbjct: 995  TVVLWVFCTIHGSRY-------------LHDAMASSVLRAPMSFFETTPIGRILNRFSND 1041

Query: 235  AYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRN 294
             Y V   + +  S     ++     + ++C+ + Q  +++L    P+      + +    
Sbjct: 1042 IYKVDELLGRTFSQFFVNVVKVTFTIVVICTSTWQFILVVL----PLSVLYIYYQQYYLR 1097

Query: 295  TSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGNELSRYNVA-IRDIFQVGXXXX 348
            TS++L+     +TR       +E L G+ T++ +  +    +  N A I +         
Sbjct: 1098 TSRELRR-LDSVTRSPIYAHFQETLGGVSTIRGY-GQQKRFAHINQARIDNNMSAFYPAV 1155

Query: 349  XXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFY 408
                        LG +  L       + + Q  L+ G +   + Y      ++  +    
Sbjct: 1156 NANRWLAFRLEFLGSIIILGAATLSVFRLKQGTLTAGMIGLSLSYALQITQSLNWIVRMT 1215

Query: 409  SEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPT---RPSVQ-IF 464
             E+     +  R+ E  + KP  +P +    +P +G     D+ F + +   RP +Q I 
Sbjct: 1216 VEVETNIVSVERIKEYAELKPE-APAIIESSRPPKGWPSQGDIRFEHYSTRYRPELQLIL 1274

Query: 465  KSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQI 524
            + +N  I     V IVG +G GKS++ L L R      G I ID      +    LR ++
Sbjct: 1275 RDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGHIFIDGLSTDTIGLADLRHKL 1334

Query: 525  GIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-YDTVIGPHG 583
             I+ Q+  + +GT+R+N+    T   T EEI    +       +    N    T++   G
Sbjct: 1335 SIIPQDSQVFAGTLRENV--DPTEEFTDEEIWHALELSHLKEHVMSMGNDGLQTMLTECG 1392

Query: 584  TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 643
            + LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T     K++  TI++IA
Sbjct: 1393 SNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRVIQETIRTAFKNR--TILTIA 1450

Query: 644  HRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
            HR++TI  S+ +IVL ++G V E    + L     S    L  E
Sbjct: 1451 HRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRPDSLFYSLCKE 1493

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 130/266 (48%), Gaps = 30/266 (11%)

Query: 427 RKPSISPTVGHKYQPERGVIEFK---DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGP 482
           R+PS++          +G I  K   D +F +  +P  ++  K++NF+   G   CIVG 
Sbjct: 606 REPSVT---------SKGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELTCIVGR 656

Query: 483 SGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNI 542
            G GKS +   +L       G   I                +  V Q P +M+GT+++NI
Sbjct: 657 VGSGKSALIQSILGDLFRVKGFATIHGS-------------VAYVSQIPWIMNGTVKENI 703

Query: 543 TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIK 602
            +G  Y P+  E     K C  +  ++  P    T++G  G  LSGGQK R+++ARA+  
Sbjct: 704 LFGHKYDPSFYE--KTVKACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAVYS 761

Query: 603 KPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
           +    +LD+  +A+D   ++  ++   G      S T V   ++++ +  ++++ +L  +
Sbjct: 762 RADTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIADSIALL-EN 820

Query: 662 GSVVEMGKFKELYANSTSALSQLLNE 687
           G +V+ G + E+  +  SALS+L++E
Sbjct: 821 GEIVQQGSYDEVVRDDGSALSKLIHE 846

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 142/584 (24%), Positives = 246/584 (42%), Gaps = 63/584 (10%)

Query: 139  VIGIVLDTLKTSSGSDFF-DLKIPIFSLPLYEFL-SFFTVALLIGCAANFGRFILLRILS 196
            VIG    +L +S    F+ + K P  S   Y  L SFF      G     G++ L+  + 
Sbjct: 895  VIGTTFLSLFSSVWLSFWTEQKFPNRSTSFYMGLYSFFVFG---GYLFMNGQYTLICYMG 951

Query: 197  ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI-- 254
                  L    +++ LH    + D   +G +++R   D    + S+  ++++ ++  +  
Sbjct: 952  VTASKVLNLKAVERVLHTPMAYMDTTPIGRILNRFTKD----TDSLDNELTESLRLFMTQ 1007

Query: 255  -CGIVGVGMMCSLS-PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEE 312
               I+GV +MC +  P  +I + F     +  A  +    R   +        +     E
Sbjct: 1008 FANIIGVCVMCIIYLPWFAIAIPFLVLIFVLIADHYQASGREVKRLDAIQRSFVYNNLNE 1067

Query: 313  QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAY 372
             L G+ T++++ ++   L + +  I  + + G               ++  ++F  ++  
Sbjct: 1068 VLGGMDTIKAYGSQERFLVKTDFLINKMNEAGYLLVALQRWVAIFLDMIA-VAFALII-- 1124

Query: 373  GSYLVLQSQL-----SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG----AASRL-F 422
             S L +  Q      S+G L  ++L      N +    T     M  A      A+ L  
Sbjct: 1125 -SLLCVTRQFHISPASVGVLLTYVLQLPGLLNTILRALTQTENDMNSAERLVYCANELPL 1183

Query: 423  ELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVG 481
            E   ++P ++P    +  P +G I F+DVSF+Y  RP + +  K ++  I     + I G
Sbjct: 1184 EADYKRPELAPP---ESWPSKGEIVFEDVSFAY--RPGLPVVLKGISLDIKSQEKIGICG 1238

Query: 482  PSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDN 541
             +G GKSTI   L R    + G I ID+ DI ++    LR+++ I+ Q+PVL  GTIR N
Sbjct: 1239 RTGAGKSTIMSALYRLNELSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKN 1298

Query: 542  ----------------ITYGLTYTPTKEEIR-----SVAKQCFCHNFITKFPNTYDTVIG 580
                            ++ G       E ++     S+      H F        D  + 
Sbjct: 1299 LDPFQEHPDELLWKSLVSGGAISAEEVEVVKGQKPDSIGSLSSMHKF------HLDQKVE 1352

Query: 581  PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIV 640
              G   S G++Q +A+ RAL+++  ILILDEATS++D E++  I             TI+
Sbjct: 1353 EEGANFSLGERQLLALTRALVRQSKILILDEATSSVDYETDNKIQSRIAAAF--GDCTIL 1410

Query: 641  SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
             IAHRL TI   + ++VL   G + E    + LY        Q+
Sbjct: 1411 CIAHRLKTILTYDRILVL-EQGEIEEFDTPRSLYEKKDGIFRQM 1453

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 80/231 (34%), Positives = 108/231 (46%), Gaps = 23/231 (9%)

Query: 458 RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNC 517
           + S   FK+LN  I  G  V I GP G GKS++   +  +   T+GT+ +D      L C
Sbjct: 590 KKSFHGFKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDGD---LLMC 646

Query: 518 KSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + + T+RDNI +G  Y   KE    V + C     I   P    T
Sbjct: 647 GY-----------PWIQNATVRDNIIFGSPYD--KERFDEVVRVCSLKADIDILPGGELT 693

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMKSK 635
            IG  G  LSGGQK RI +AR++ K   I + D+  SA+D      I      G+L   K
Sbjct: 694 EIGERGITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---K 750

Query: 636 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
             T +   H+LS I ++  VIVLG DGS  E GK ++L   S   L  LL+
Sbjct: 751 GKTRILATHQLSLIEKASVVIVLGVDGS-FEAGKLEDL-KRSNKTLINLLH 799

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  119 bits (297), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 89/280 (31%), Positives = 144/280 (51%), Gaps = 40/280 (14%)

Query: 417 AASRLFELTDRKPS-----ISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKI 471
           +  R+ E TD  PS     ISP       P+ G +E K++S  Y    S +   +++FK+
Sbjct: 3   SVERIKEYTD-IPSESNGYISPPAN---WPQTGDVELKNLSLRYSPHSS-KALDNVSFKV 57

Query: 472 APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEP 531
             G+ V IVG +G GKS+I   + R  +   GTI IDN+DI  +  + LR  I  + Q+P
Sbjct: 58  KAGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDP 117

Query: 532 VLMSGTIRDNITYGLTYTPTKEEIRSV------AKQC--FCHNFITKFPN---------- 573
            L  GT+R N+     Y+    +I  V       ++C   C  F  + PN          
Sbjct: 118 TLFDGTVRSNLDPFDRYSDV--QIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRF 175

Query: 574 -TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLM 632
              +TV+   G+ LS GQ+Q + +AR+++    I+++DEAT+++D  S+  I  T  + M
Sbjct: 176 IDLNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETM 235

Query: 633 KSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE 672
             K+ TI++IAHRL ++   + ++V+       EMG+ KE
Sbjct: 236 --KNTTILTIAHRLRSVIDYDKILVM-------EMGRVKE 266

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 130/475 (27%), Positives = 220/475 (46%), Gaps = 51/475 (10%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    ++ R+  Q  ++ VK     +V    +C  + Q    
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDEILGRTFAQFFANVVKVSFTIVV----ICMATWQ---- 1094

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ T++ + ++ N
Sbjct: 1095 FIFIVLPLSVLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGLTTIRGY-SQQN 1152

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDL 387
                 N       +V                L   L F+ +V+   + ++   +L  G L
Sbjct: 1153 RFVHINQT-----RVDNNMSAFYPSVNANRWLAFRLEFIGSVIILAASMLAVIRLGNGTL 1207

Query: 388  TA--------FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 439
            TA        F L    + N +  ++    E+     +  R+ E  + K S +P +   +
Sbjct: 1208 TAGMIGLSLSFALQITQSLNWIVRMTV---EVETNIVSVERIKEYAELK-SEAPYIIKDH 1263

Query: 440  Q-----PERGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALL 493
            +     PE G I+F  V++S   RP ++ I K ++  I P   + IVG +G GKS++ L 
Sbjct: 1264 RPPASWPESGEIKF--VNYSTRYRPELELILKDIDLHIHPKEKIGIVGRTGAGKSSLTLA 1321

Query: 494  LLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKE 553
            L R     +G I+ID   I  +    LR  + I+ Q+  +  GT+R+NI     Y  T E
Sbjct: 1322 LFRIIEAASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENIDPTNRY--TDE 1379

Query: 554  EIRSVAKQCFCHNFITKF-PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEA 612
            EI +        + I     N  +T++   G+ LS GQ+Q + +ARAL+    ILILDEA
Sbjct: 1380 EIWNALALSHLKDHILGMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILILDEA 1439

Query: 613  TSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            T+A+DVE++  I  T     K +  TI++IAHR++TI  S+ +IVL   G V E 
Sbjct: 1440 TAAVDVETDQLIQKTIRNAFKER--TILTIAHRINTIMDSDRIIVLD-KGRVTEF 1491

 Score = 97.4 bits (241), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 136/288 (47%), Gaps = 46/288 (15%)

Query: 446 IEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           ++  D +F +  +P  ++  K++NF    G   CIVG  G GKS +   LL         
Sbjct: 624 VKVNDATFLWQRKPEYKVALKNINFVAKKGELTCIVGKVGSGKSALIQSLL--------- 674

Query: 505 IMIDNQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
                 D+ ++    ++   +  V Q P +M+GT++DNI +G  Y P  E  +   K C 
Sbjct: 675 -----GDLIRVKGFATVHGDVANVSQVPWIMNGTVKDNILFGHKYDP--EFYQLTIKACA 727

Query: 564 CHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEG 622
               ++  P+   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++ 
Sbjct: 728 LSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVAKH 787

Query: 623 AINYTFG---------QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            I +  G         +++ +  +T++SIA          + I L  +G +++ G + ++
Sbjct: 788 LIEHVLGPHGLLHSKTKVLATNKITVLSIA----------DSITLMENGEIIQQGSYDQV 837

Query: 674 YANSTSALSQLLNE---RAAPGPSDQ-----QLQIEKVEEKEDTNEGE 713
             ++ S LS+L+ E   +  P PS       +L  E +E   D+   E
Sbjct: 838 NESTNSPLSKLIAEFGKKGKPTPSQSTTSLAKLASEGIESYSDSKISE 885

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  123 bits (309), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 86/249 (34%), Positives = 129/249 (51%), Gaps = 9/249 (3%)

Query: 441  PERGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
            P +G I+F++ S  Y  RP +++  K +N  I P   + IVG +G GKS++ L L R   
Sbjct: 1253 PSQGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKSSLTLALFRIIE 1310

Query: 500  PTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
              +G I ID   I  +  + LR  + I+ Q+  L  GTIR+NI     Y  T E+I    
Sbjct: 1311 AASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENIDPTNEY--TDEQIWRAL 1368

Query: 560  KQCFCHNFITKF-PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            +     + +        D  +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DV
Sbjct: 1369 ELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDV 1428

Query: 619  ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANST 678
            E++  I  T     K++  TI++IAHR++TI  S+ ++VL   G V E      L  N  
Sbjct: 1429 ETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLKNPE 1485

Query: 679  SALSQLLNE 687
            S    L  E
Sbjct: 1486 SLFYSLCYE 1494

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 120/240 (50%), Gaps = 20/240 (8%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           D +F +  +P  ++  K++NF    G   C+VG  G GKS +   +L             
Sbjct: 621 DATFLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQAIL------------- 667

Query: 509 NQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    S+   I  V Q P +M+GT++DNI +G  Y  +   +    K C     
Sbjct: 668 -GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKDNILFGHKYDESFYTM--TLKACALIVD 724

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +   P    T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++  + +
Sbjct: 725 LAVLPKGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEH 784

Query: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686
             G      S T V   ++++ +  ++++ +L  +G +++ G + ++ +  +SALS++++
Sbjct: 785 VLGPNGLLASKTKVLATNKITVLSIADHIALL-ENGEIIQQGSYDDVTSAKSSALSKIIS 843

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  122 bits (307), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 143/291 (49%), Gaps = 22/291 (7%)

Query: 408  YSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQ-IFKS 466
            YSEI      A  L E  DR+PS +        P  G I+F+  S  Y  RP +  I K 
Sbjct: 1253 YSEI---PSEAPYLIE--DRRPSPN-------WPTDGAIQFQHYSTRY--RPGLDLILKD 1298

Query: 467  LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGI 526
            +N  I P   + IVG +G GKS++ L L R      G I+ID   I ++    LR ++ I
Sbjct: 1299 INLDIKPKEKIGIVGRTGAGKSSLTLALFRLIEAAEGRIVIDGVPIDQMGLYDLRHKLSI 1358

Query: 527  VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-YDTVIGPHGTL 585
            + Q+  +  G++R+NI     Y  + EEI  V       N +    N    T +   G  
Sbjct: 1359 IPQDSQVFEGSVRENIDPTEQY--SDEEIWRVLDLSHLKNHVLNMGNDGLLTQLSEGGGN 1416

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  +  T       +  TI++IAHR
Sbjct: 1417 LSVGQRQLMCLARALLVPTKILVLDEATAAVDVETDKVLQETIRTAFADR--TILTIAHR 1474

Query: 646  LSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERA-APGPSD 695
            L+TI  S+ ++VL   G V E    + L  N  +    L  +    P PS+
Sbjct: 1475 LNTIMDSDRILVLDA-GRVAEFDTPENLLKNPGTMFYGLCQDAGFVPRPSN 1524

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 125/243 (51%), Gaps = 24/243 (9%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           + +F +  +P  ++  K++NF+   G   C+VG  G GKS +   LL             
Sbjct: 635 NATFLWKRKPEYKVALKNVNFQAKKGELNCVVGRVGSGKSALIQSLL------------- 681

Query: 509 NQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++   I  V Q   +M+GT++DNI +G  Y P  E      K C     
Sbjct: 682 -GDLFRVKGFATVHGNIAYVSQVAWIMNGTVKDNILFGHKYDP--EFYEKTIKACALTID 738

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +   P+   T++G  G  LSGGQK R+++ARA+  +  I +LD+  +A+D   S   I++
Sbjct: 739 LAILPDGDKTIVGEKGISLSGGQKARLSLARAVYSRADIFLLDDPLAAVDEHVSTHLIDH 798

Query: 627 TFGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
             G   L+K+K+  + +  +++S +  +++V +L  +G +++ G F E+   + S LS+L
Sbjct: 799 VLGPNGLLKTKTKILAT--NKISALSIADSVTLL-ENGEIIQQGTFCEITKAADSPLSKL 855

Query: 685 LNE 687
           + E
Sbjct: 856 IKE 858

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  122 bits (306), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 133/528 (25%), Positives = 232/528 (43%), Gaps = 63/528 (11%)

Query: 173  FFTVALLIGCAANFGRFILLRIL----SERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 228
            +  V  + G  A+    I   IL    S      L   ++   L     FF+   +G ++
Sbjct: 969  YLGVYFMFGLGASLSTLIQSAILWIYCSIHASVYLHESMLAAVLRAPMSFFETTPIGRIL 1028

Query: 229  SRLGSDAY----VVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFS 284
            +R  +D Y    +++R+ +Q  ++  +     IV    +C  + Q +    FF  P+   
Sbjct: 1029 NRFSNDIYKVDELLARTFSQFFANTTRVSFTIIV----ICVTTWQFT----FFVIPLAML 1080

Query: 285  ASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDI 340
               + +    TS++L+         +    +E L+G+ +++ +     +L R+ + I   
Sbjct: 1081 YIYYQQYYLKTSRELRRLDSVTKSPVYAHFQETLNGVSSIRGY----GQLDRF-IHINQA 1135

Query: 341  FQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNA 400
             ++                L   L F+     GS ++  +      L+ F L +    + 
Sbjct: 1136 -RINNNTSAYYPSMNVNRWLAYRLEFI-----GSCIIFFA----ATLSVFRLASGSLTSG 1185

Query: 401  VFGLSTFYS---------------EIMQGAGAASRLFELTDRKPS----ISPTVGHKYQP 441
            + GLS  Y+               E+     +  R+ E  + +P     I+ +V     P
Sbjct: 1186 MVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELEPEAPQFIANSVPSGDWP 1245

Query: 442  ERGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
            + G I+F++ S  Y  RP +  I + +N  I P   V IVG +G GKS++AL L R    
Sbjct: 1246 KDGEIKFENYSTRY--RPGLDLILRGINLHIKPHERVGIVGRTGAGKSSLALSLFRIIEA 1303

Query: 501  TTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
              G I ID   I  +    LR+++ I+ Q+  +  GT+RDNI     Y  T E+I    +
Sbjct: 1304 AEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNIDPTKQY--TDEQIWKALE 1361

Query: 561  QCFCHNFITKF-PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
                 + +     +  DT +   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE
Sbjct: 1362 LSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLIPFRILVLDEATAAIDVE 1421

Query: 620  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            ++  I  T       +  TI++IAHR++TI  S+ ++VL   G+V E 
Sbjct: 1422 TDKVIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVL-DKGTVAEF 1466

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 115/525 (21%), Positives = 220/525 (41%), Gaps = 102/525 (19%)

Query: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQK---VSDGVKALICGIVGVGMM 263
           + KK LH   E       GD+++ +  DA  + R +TQ    +  G   L   +  +  +
Sbjct: 366 IYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQWGNVIWSGPFQLCLCLYSLHRL 424

Query: 264 CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ-- 321
                 + ++LL FT P+    S   + ++   K+  +   + TR+  E L+ IK+++  
Sbjct: 425 LGPCIWVGVVLLLFTLPL---NSYISRVLKRLQKEQMKNKDERTRLISEILNNIKSLKLY 481

Query: 322 ----------SFVAEGNELS--------------RYNVAIRDIFQVGXXXXXXXXXXXXX 357
                      +V    EL               +YN+     F V              
Sbjct: 482 AWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNIIP---FLVSCSTFAVFVLTQKG 538

Query: 358 XSLLGDLSF------------LTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLS 405
             L  DL F            L VL       +++ ++IG LT F+   E   +A+    
Sbjct: 539 RPLTTDLVFPALTLFNLLSFPLAVLPIAITSFIEASVAIGRLTNFLTAEELQRDAI---- 594

Query: 406 TFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQI-F 464
                                R+P++    G        V    + +F +  +P  ++  
Sbjct: 595 --------------------TREPAVKAPGG------VAVALADNATFLWQRKPEYKVAL 628

Query: 465 KSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSL-RRQ 523
           K++NF+       CI+G  G GKS +   +L               D+ ++N  ++ R  
Sbjct: 629 KNINFRAKKSELTCIIGKVGSGKSALIQAML--------------GDLFRVNGSAVVRGN 674

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
           +  V Q   +M+GT+RDNI +G  Y    +  +   K C     ++  P+  +T +G  G
Sbjct: 675 VAYVSQVAWIMNGTVRDNILFGHKYDA--KFYQQTIKACALTVDLSILPDGDNTFVGEKG 732

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ--LMKSKSMTIV 640
             LSGGQK R+++ARA+  +    +LD+  +A+D   ++  +   FG   L+KSK+  + 
Sbjct: 733 ISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLT 792

Query: 641 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLL 685
           +  ++++ +  ++++++L  +G +V+ G F E+ ++  SA+S+L+
Sbjct: 793 T--NKITALEIADHIVLL-ENGEIVQQGTFSEVISDEDSAISKLV 834

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 130/504 (25%), Positives = 228/504 (45%), Gaps = 53/504 (10%)

Query: 175  TVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
            T+ L + C     R+ L  I++  V   LRA ++         FF+   +G +++R  +D
Sbjct: 1012 TIILWVFCTIRGSRY-LHSIMAASV---LRAPMV---------FFETTPIGRILNRFSND 1058

Query: 235  AYVVS----RSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGK 290
             Y V     R+  Q   +  K     IV    +C  + Q   L+L    P++     + +
Sbjct: 1059 IYKVDELLGRTFAQFFVNVTKVSFTIIV----ICVTTWQFIFLIL----PMIVLYVYYQQ 1110

Query: 291  QIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 346
                TS++L+         +    +E L G+ T++ +  + +  +  N +     ++   
Sbjct: 1111 YYLRTSRELRRLDSVTKSPVYAHFQESLGGLSTIRGY-DQQDRFTHINQS-----RIDNN 1164

Query: 347  XXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDLTAFML-----YTEYTGNA 400
                         L   L F+ T++ +G+  +   +L  G LT  M+     Y      +
Sbjct: 1165 MSAFYPSVNANRWLAFRLEFIGTIIIFGAASLSMLRLKAGSLTPGMIGLSLSYALQITQS 1224

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQP-----ERGVIEFKDVSFSY 455
            +  +     E+     +  R+ E ++ K S +P V   ++P      +G I+F+  S  Y
Sbjct: 1225 LNWIVRMTVEVETNIVSVERIKEYSEIK-SEAPLVIEDHRPPADWPSKGDIKFEHYSTRY 1283

Query: 456  PTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKL 515
                ++ + K +N  + P   + IVG +G GKS++ L L R      G I+ID   I ++
Sbjct: 1284 RENMNL-VLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEAAEGRIVIDGVPINEI 1342

Query: 516  NCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF-PNT 574
                LR ++ I+ Q+  +  GT+R+NI     Y  + EEI  V +     N +     + 
Sbjct: 1343 GLHDLRHKLSIIPQDSQVFEGTVRENIDPTNQY--SDEEIWRVLELSHLKNHVLSMSKDG 1400

Query: 575  YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS 634
              T +   G  LS GQ+Q + +ARAL+    ILILDEAT+A+DVE++  I  T     K 
Sbjct: 1401 LMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDVETDQVIQETIRTAFKD 1460

Query: 635  KSMTIVSIAHRLSTIRRSENVIVL 658
            +  TI++IAHRL+TI  S+ ++VL
Sbjct: 1461 R--TILTIAHRLNTIMDSDRILVL 1482

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 113/509 (22%), Positives = 217/509 (42%), Gaps = 59/509 (11%)

Query: 203 LRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKV----SDGVKALICGIV 258
           L + + KK L    E  D    GD+++ +  D   + + +TQ      S   + L+C +V
Sbjct: 386 LTSTIYKKALVLSNEAADMSSTGDIVNLMSVDVQRL-QDLTQYCHLIWSGPFQILLC-LV 443

Query: 259 GVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIK 318
            +  +   S  + +++L    P+    S+  +  +   K   +   + +R+  E L+ IK
Sbjct: 444 SLYKLLGRSMWIGVIILVIMMPL---NSMLMRIQKKLQKVQMKNKDERSRLISEILNNIK 500

Query: 319 TVQSFVAEGN-----ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
           +++ +  E       E  R +  ++++ ++G               L+   +F  V  Y 
Sbjct: 501 SLKLYSWEAPYKAKLEHVRNDKELKNLTKMGVYMALTSFQFNIVPFLVSCSTF-AVFVYT 559

Query: 374 SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP 433
               L + L    L  F L +         L+ F    ++ + + +RL+     +     
Sbjct: 560 EKKPLTTDLVFPALALFNLLSFPLNVVPMVLTAF----IEASVSVNRLYSFLTNEELQKD 615

Query: 434 TVGHKYQPER-GVIEFK---DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKS 488
            V H  + ++ G +  K   D +F +  +P  Q+  K++N ++  G   C+VG  G GKS
Sbjct: 616 AVHHLPKAQKAGDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSGKS 675

Query: 489 TIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTY 548
            +   LL       G               ++      V Q P +M+GT++DNI +G  Y
Sbjct: 676 ALVQSLLGDLYRVKGY-------------AAVHGSTAYVSQVPWIMNGTVKDNILFGHKY 722

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI 608
            P   ++    K C     +   P+   T++G  G  LSGGQK R+++ARA   +    +
Sbjct: 723 DPVFYDL--TIKACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLARATYARADTYL 780

Query: 609 LDEATSALDVE-SEGAINYTFGQ--LMKSKS-------MTIVSIAHRLSTIRRSENVIVL 658
           LD+  +A+D   ++  I +  G   L+KSK+       +T++SIA  +S +         
Sbjct: 781 LDDPLAAVDEHVAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISLVE-------- 832

Query: 659 GHDGSVVEMGKFKELYANSTSALSQLLNE 687
              G +++ G ++++  +  S LS L+ E
Sbjct: 833 --GGEIIQHGSYEDISKDLDSPLSNLVKE 859

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 138/550 (25%), Positives = 231/550 (42%), Gaps = 45/550 (8%)

Query: 167  LYEFLSFFTVALLIGCAANFGRFILLRIL-SERVVARLRAHVIKKTLHQDAEFFDNHKVG 225
            L+ F+  + +  +I  A N  R I++ I  S R   +L  ++    ++    FF+   +G
Sbjct: 1013 LWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIG 1072

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +I+R   D   V   +    S   ++L+  IV V ++    P   +  +F      +  
Sbjct: 1073 RIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYYQ 1132

Query: 286  SVFGKQIRNTSKDLQEATG----QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
            + +      TS++L+  T      +  +  E L+G   + ++    N   R++    +  
Sbjct: 1133 AYYIV----TSRELKRLTSITYSPIMSLISETLAGYLVINAY----NHAKRFSYFNFESV 1184

Query: 342  QVGXXXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEY 396
            Q                S+ L  +  L VLA G    S +    QL+ G +   M Y+  
Sbjct: 1185 QFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQ 1244

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP----TVGHKYQPERGVIEFKDVS 452
              N++  +     +I     +  R+ E  +  P        T   K  P  G I+F D S
Sbjct: 1245 VTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYS 1304

Query: 453  FSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQD 511
              Y  R ++  +   +N +I P   + IVG +G GKST+ L L R    T G I+ID  D
Sbjct: 1305 TKY--RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVD 1362

Query: 512  ITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYT--------------PTKEEI-- 555
            I+ L    LR  + I+ Q+     GTIR N+     ++              P  E I  
Sbjct: 1363 ISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLERIIS 1422

Query: 556  -RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
             R    +    N   K  N  +  I  +G+ LS GQ+Q + ++RAL+    IL+LDEAT+
Sbjct: 1423 NRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATA 1482

Query: 615  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
            ++D+E++  I  T       +  TI++IAHR+ T+   + ++VL   G V E      L 
Sbjct: 1483 SVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVLDK-GEVREFDSPDTLL 1539

Query: 675  ANSTSALSQL 684
             N  S    L
Sbjct: 1540 ENKNSIFYNL 1549

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 126/254 (49%), Gaps = 19/254 (7%)

Query: 464 FKSLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRR 522
           FK++N F++  GS  CIVG  G GK+T+   +L      +G      Q+           
Sbjct: 644 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGA-----QESIPPKLIIRGN 698

Query: 523 QIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPH 582
            I    Q+  +M+ ++++NI +G  Y      +    + C     +   P+  +T++G  
Sbjct: 699 SIAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVGEK 756

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMT 638
           G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I     +   L+KSK  T
Sbjct: 757 GISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK--T 814

Query: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANS-TSALSQLLNERAAPGPSDQQ 697
           I+   + +S ++ S+ +  L  +  ++E G + ++  +S  S L  L+NE      ++ +
Sbjct: 815 IILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSSEDSKLKALINEFDNDRDNNSK 873

Query: 698 LQIEKVEEKEDTNE 711
              E+V E+  T+E
Sbjct: 874 ---EEVSEERKTSE 884

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 137/249 (55%), Gaps = 30/249 (12%)

Query: 441  PERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
            P+ G IEFK++S  Y    S +   +++FK+  G+ V IVG +G GKS+I   + R  + 
Sbjct: 1301 PQTGEIEFKNLSLRYSPHSS-KALDNVSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDW 1359

Query: 501  TTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
             +GTI+IDN+DI  ++ + LR  I  + Q P L  GTIR N+     Y+  K+   ++AK
Sbjct: 1360 ESGTIIIDNKDIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSD-KQVFDALAK 1418

Query: 561  -------QCFCHNFITK-------FPNTY---DTVIGPHGTLLSGGQKQRIAIARALIKK 603
                   +  C   +T         PN +   ++V+   G+ LS GQ+Q + +AR+++  
Sbjct: 1419 VGLIERNEVLC--LVTDRQQSSSFSPNKFSDLNSVVRSGGSNLSQGQRQLLCLARSMLGS 1476

Query: 604  PTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGS 663
              I+++DEAT+++D  S+  I  T  + M++   TI++IAHRL ++     ++V+     
Sbjct: 1477 RKIMLIDEATASIDYISDAKIQKTIRETMENT--TILTIAHRLRSVIDYNKILVM----- 1529

Query: 664  VVEMGKFKE 672
              +MG+ KE
Sbjct: 1530 --DMGRVKE 1536

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 124/256 (48%), Gaps = 10/256 (3%)

Query: 446 IEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           + FKD +  +    +    K+++ +    S   I+GP+G GKS++ L LL   N  +G I
Sbjct: 664 VGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLCSGQI 723

Query: 506 MI---DNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
            +   D++D  ++    +   +    Q P L+SGTI DNI +G    P +    +V K C
Sbjct: 724 YVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFNAVIKAC 781

Query: 563 FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                +        T +G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+D E+  
Sbjct: 782 CLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVDPETAL 841

Query: 623 AI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSA 680
            I      G +MK ++  I S  H +S I +    +V+  +G V   GK  +L A S + 
Sbjct: 842 NIYEKCLCGPIMKGRTCIITS--HNISLITKKAEWLVILDNGEVKGQGKPSDL-AESNNF 898

Query: 681 LSQLLNERAAPGPSDQ 696
           L + +N   A    +Q
Sbjct: 899 LKESMNNGLADESGNQ 914

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 138/550 (25%), Positives = 231/550 (42%), Gaps = 45/550 (8%)

Query: 167  LYEFLSFFTVALLIGCAANFGRFILLRIL-SERVVARLRAHVIKKTLHQDAEFFDNHKVG 225
            L+ F+  + +  +I  A N  R I++ I  S R   +L  ++    ++    FF+   +G
Sbjct: 1041 LWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIG 1100

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +I+R   D   V   +    S   ++L+  IV V ++    P   +  +F      +  
Sbjct: 1101 RIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYYQ 1160

Query: 286  SVFGKQIRNTSKDLQEATG----QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
            + +      TS++L+  T      +  +  E L+G   + ++    N   R++    +  
Sbjct: 1161 AYYIV----TSRELKRLTSITYSPIMSLISETLAGYLVINAY----NHAKRFSYFNFESV 1212

Query: 342  QVGXXXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEY 396
            Q                S+ L  +  L VLA G    S +    QL+ G +   M Y+  
Sbjct: 1213 QFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQ 1272

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP----TVGHKYQPERGVIEFKDVS 452
              N++  +     +I     +  R+ E  +  P        T   K  P  G I+F D S
Sbjct: 1273 VTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYS 1332

Query: 453  FSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQD 511
              Y  R ++  +   +N +I P   + IVG +G GKST+ L L R    T G I+ID  D
Sbjct: 1333 TKY--RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVD 1390

Query: 512  ITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYT--------------PTKEEI-- 555
            I+ L    LR  + I+ Q+     GTIR N+     ++              P  E I  
Sbjct: 1391 ISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLERIIS 1450

Query: 556  -RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
             R    +    N   K  N  +  I  +G+ LS GQ+Q + ++RAL+    IL+LDEAT+
Sbjct: 1451 NRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATA 1510

Query: 615  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
            ++D+E++  I  T       +  TI++IAHR+ T+   + ++VL   G V E      L 
Sbjct: 1511 SVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVLDK-GEVREFDSPDTLL 1567

Query: 675  ANSTSALSQL 684
             N  S    L
Sbjct: 1568 ENKNSIFYNL 1577

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 126/254 (49%), Gaps = 19/254 (7%)

Query: 464 FKSLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRR 522
           FK++N F++  GS  CIVG  G GK+T+   +L      +G      Q+           
Sbjct: 672 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGA-----QESIPPKLIIRGN 726

Query: 523 QIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPH 582
            I    Q+  +M+ ++++NI +G  Y      +    + C     +   P+  +T++G  
Sbjct: 727 SIAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVGEK 784

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMT 638
           G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I     +   L+KSK  T
Sbjct: 785 GISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK--T 842

Query: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANS-TSALSQLLNERAAPGPSDQQ 697
           I+   + +S ++ S+ +  L  +  ++E G + ++  +S  S L  L+NE      ++ +
Sbjct: 843 IILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSSEDSKLKALINEFDNDRDNNSK 901

Query: 698 LQIEKVEEKEDTNE 711
              E+V E+  T+E
Sbjct: 902 ---EEVSEERKTSE 912

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1546

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 133/555 (23%), Positives = 222/555 (40%), Gaps = 85/555 (15%)

Query: 203  LRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGIV 258
            L + ++   L     FF+   +G +++R  +D Y V     R+ +Q  S+ VK     +V
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFSNAVKVTFTLVV 1068

Query: 259  GVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQ 313
                +C  + Q     +FF  P+ F    + +    TS++L+     +TR       +E 
Sbjct: 1069 ----ICVSTWQF----IFFIVPMSFLYIYYQQYYMRTSRELRR-LDSVTRSPTISHFQET 1119

Query: 314  LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
            L GI T++ +  E   +      + +                     LG +  L     G
Sbjct: 1120 LGGISTIRGYSQENRFIHINQQRVDNNMSAYYPSINCNRWLAFRLEFLGSVIILGASTLG 1179

Query: 374  SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL---FELTDRKPS 430
             Y + Q  ++ G +   + Y      ++  +     E+     +  R+    EL    PS
Sbjct: 1180 IYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSELASEAPS 1239

Query: 431  I----SPTVGHKYQPERGVIEFKDVSFSYPTRPSVQ---IFKSLNFKIAPGSSVCIVGPS 483
            I     P V     P+ G ++F      Y TR       + K +   I P   + IVG +
Sbjct: 1240 IVEDKRPDVN---WPQDGAVKFN----HYYTRYRADLDYVLKDITLDIKPREKIGIVGRT 1292

Query: 484  GRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNIT 543
            G GKS++ L L R    + G I +D  +  ++    LR ++ I+ Q+  +  GT+RDNI 
Sbjct: 1293 GAGKSSLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNID 1352

Query: 544  YGLTYTPTKEEIRSVAKQCFCHNFITKFP------------------------------- 572
                Y  T EEI    +     + I                                   
Sbjct: 1353 PTGQY--TDEEIWKALELSHLKSHIINMSKHSSSDSSSNESLSPASNNSSGNNDNSNSSS 1410

Query: 573  -------------NTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
                         N  +T +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE
Sbjct: 1411 DGLTSSGLEDISHNALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVE 1470

Query: 620  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
            ++  I  T     K++  TI++IAHRL+TI  S+ ++VL   G + E    + L  +  S
Sbjct: 1471 TDQLIQETIRSAFKNR--TILTIAHRLNTIMDSDRILVLD-KGEIKEFDSPQTLLGDKDS 1527

Query: 680  ALSQLLNERAAPGPS 694
                L  E+A   P+
Sbjct: 1528 LFYSLC-EQAGLTPA 1541

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 120/243 (49%), Gaps = 24/243 (9%)

Query: 450 DVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508
           D +F +  +P  ++  K++NF+   G   CIVG  G GKS +   +L             
Sbjct: 615 DATFLWKRKPEYKVALKNINFQARKGELTCIVGKVGSGKSALIQSIL------------- 661

Query: 509 NQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++   +  V Q P +M+GT+++NI +G  +   K+      K C     
Sbjct: 662 -GDLFRVKGFATVHGDVAYVSQVPWIMNGTVKENILFGHKFD--KKFYEKTIKACALTID 718

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           ++  P+   T++G  G  LSGGQK R+++ARA+  +    + D+  +A+D    +  I +
Sbjct: 719 LSILPDGDSTLVGEKGISLSGGQKARLSLARAVYARADTYLFDDPLAAVDEHVGKHLIEH 778

Query: 627 TFGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
             G   L+ SK+     +A    T+    + I L  +G +++ GK++E+ ++  S L +L
Sbjct: 779 VLGPNGLLHSKTKV---LATNKITVLNIADYITLLDNGEIIQRGKYEEVTSDPGSPLCKL 835

Query: 685 LNE 687
           +NE
Sbjct: 836 INE 838

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 138/289 (47%), Gaps = 26/289 (8%)

Query: 417  AASRLFELTDRKPSISPTVGH----KYQPERGVIEFKDVSFSYPTRPSVQ-IFKSLNFKI 471
            +  R+ E  +  P     +      K  P RG I F++ S  Y  R ++  + K +  +I
Sbjct: 1264 SVERILEYCNLPPEADAIIEESRPPKEWPSRGAITFQNYSTKY--RENLDPVLKDITVEI 1321

Query: 472  APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEP 531
             P   + IVG +G GKST++L L R   P+ G+I+ID  DI KL    LR  + I+ Q+ 
Sbjct: 1322 KPQEKIGIVGRTGAGKSTLSLALFRLLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDA 1381

Query: 532  VLMSGTIRDN-----------ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-----Y 575
                GTI+ N           I   L  +  K  I  +A +    N  T    T      
Sbjct: 1382 QAFEGTIKSNLDPFGQYSDEEIWRALELSHLKPHILKMASEENTENSETTTEATRSHELL 1441

Query: 576  DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
               I  +G  LS GQ+Q + ++RAL+    IL+LDEAT+A+D+E++  I  T     K +
Sbjct: 1442 SARITENGGNLSIGQRQLLCLSRALLNHSKILVLDEATAAVDMETDKIIQETIKTAFKDR 1501

Query: 636  SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
              TI++IAHR+ T+  S+ ++VL   G V E      L A+ ++    L
Sbjct: 1502 --TILTIAHRIDTVMDSDKIMVLDK-GEVKEFDTPTNLLADKSTIFYNL 1547

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 124/252 (49%), Gaps = 28/252 (11%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIV 527
           +F+   G   CIVG  G GKST    +L      +G   +D     KL  ++  + I   
Sbjct: 650 HFEARKGDLTCIVGRVGSGKSTFLQAILGQLPCISG---LDEHVPPKLIIRA--KSIAYC 704

Query: 528 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLS 587
            Q+P +M+ +++DN+ +G  +   ++  ++  ++C     +   P+   T++G  G  LS
Sbjct: 705 PQQPWIMNASLKDNVIFG--HRLNEDYYKATIRKCQLLPDLDILPDGDQTLVGEKGISLS 762

Query: 588 GGQKQRIAIARALIKKPTILILDEATSALDVE-----SEGAINYTFGQLMKSKSMTIVSI 642
           GGQK R+++ARA+  +  + +LD+  SA+D E      E  +N   G L   K+ T++  
Sbjct: 763 GGQKARLSLARAVYARADVYLLDDILSAVDAEVSKNIVEQVLNRGTGIL---KNKTVILT 819

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKE-LYANSTSALSQLLNERAAPGPSDQQLQIE 701
            + +S ++ S+N+  L  DG +VE   + + +  + +S L  L+ E  +   S       
Sbjct: 820 TNAVSVLKHSQNIYAL-LDGEIVENKSYADAMSCDDSSILKTLIQEFDSNENS------- 871

Query: 702 KVEEKEDTNEGE 713
               +EDT +G+
Sbjct: 872 ----REDTKDGQ 879

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 132/251 (52%), Gaps = 7/251 (2%)

Query: 438  KYQPERGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
            K  P  G I+F+     Y  R  +  + K +N +I P   + IVG +G GKS++ L L R
Sbjct: 1286 KEWPVAGEIKFEHYYTRY--REDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFR 1343

Query: 497  YYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556
                T+G I+ID   I ++    LR  + I+ Q+  +  GTIR+NI     +T   +  R
Sbjct: 1344 IIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENIDPTNQFTDA-DIWR 1402

Query: 557  SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
            ++       + +    +   T++   G+ LS GQ+Q + +ARAL+    +L+LDEAT+A+
Sbjct: 1403 ALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAV 1462

Query: 617  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
            DVE++  I  T     K +  TI++IAHR++TI  ++ +IVL   G VVE    + L  N
Sbjct: 1463 DVETDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIVLD-KGKVVEFDTPEALLKN 1519

Query: 677  STSALSQLLNE 687
            + S    L  E
Sbjct: 1520 TNSIFYSLSKE 1530

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 113/507 (22%), Positives = 224/507 (44%), Gaps = 47/507 (9%)

Query: 199 VVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKV----SDGVKALI 254
           V + L + + +K L    E  +    GD+++ +  D   + + +TQ +    S  ++ ++
Sbjct: 396 VKSALTSIIYQKALVLSNEASNTSSTGDIVNLMSVDVQKL-QDLTQWIHLIWSGPLQIVL 454

Query: 255 CGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQL 314
           C ++ +  +   S  + +L+L    PV    S   K  +N  K   +   + TRV  E L
Sbjct: 455 C-LISLYKLLGHSMWVGVLILTIMIPV---NSFLMKIQKNLQKSQMKFKDERTRVISEIL 510

Query: 315 SGIKTVQSFVAEGN-----ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTV 369
           + +K+++ +  E       E  R    ++++ ++G               L+   +F  V
Sbjct: 511 NNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQFNIVPFLVSCSTF-AV 569

Query: 370 LAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE-LTD-- 426
             Y     L + L    LT F L +      +  +    + I++ + + SRLF  LT+  
Sbjct: 570 FVYTEDKALTTDLVFPALTLFNLLS----FPLMVIPNVITAIIESSVSVSRLFNFLTNEE 625

Query: 427 -RKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVGPSG 484
            +K ++      K   +  V    + +F +  +P  ++  K++N++   G   CIVG  G
Sbjct: 626 LQKDAVQRLPKVKEIGDVAVNVGDNATFLWKRKPEYKVALKNINYQAKKGELSCIVGKVG 685

Query: 485 RGKSTIALLLLRYYNPTTGTIMIDNQDITKLN-CKSLRRQIGIVQQEPVLMSGTIRDNIT 543
            GKS     LL               D+ ++    ++   +  V Q   +M+GT+RDN+ 
Sbjct: 686 SGKSAFLQSLL--------------GDLFRVKGFATIHGSVAYVSQVAWIMNGTVRDNVL 731

Query: 544 YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKK 603
           +G  Y P  E      K C     +    +   T++G  G  LSGGQK R+++ARA+  +
Sbjct: 732 FGHKYDP--EFYEKTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYAR 789

Query: 604 PTILILDEATSALDVE-SEGAINYTFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660
               +LD+  +A+D   S   + +  G   L+ SK+  + +  +++S +  ++++ +L  
Sbjct: 790 ADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSKTRILAT--NKISVLSAADSITLL-E 846

Query: 661 DGSVVEMGKFKELYANSTSALSQLLNE 687
           +G + + G + +   +  SAL +LL E
Sbjct: 847 NGEITQQGTYADCRKDEESALGKLLKE 873

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 130/540 (24%), Positives = 228/540 (42%), Gaps = 43/540 (7%)

Query: 167  LYEFLSFFTVALLIGCAANFGRFILLRIL-SERVVARLRAHVIKKTLHQDAEFFDNHKVG 225
            ++++++ + +  +   A    R I++ +  S R        +    +     FF+   VG
Sbjct: 1030 IWKYVAVYALIGVTSSAFELARTIIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPVG 1089

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +++R  SD   +       +S   ++++  ++ + ++    P     LLF T  +L   
Sbjct: 1090 RIVNRFSSDVNSIDEDFQHIISFFFRSMLDYLITIVIITVSMPWF---LLFNT--ILLGI 1144

Query: 286  SVFGKQIRNT-SKDLQEATG----QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA---- 336
              + + +    S++L+  T      +  +  E L G   + ++    N  + YN      
Sbjct: 1145 YYYYQTLYVVLSRELKRLTSISYSPVMSLLSETLGGHVVINAY-KHANIFNYYNFENIQT 1203

Query: 337  -IRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTE 395
             I  IF                 +++  ++ L  LA    L   + +S G +   M Y  
Sbjct: 1204 NINFIFNFRSTNRWLSMRLQTIGAVIVLITSLMALAS---LGTSNPISAGLIGLLMSYAL 1260

Query: 396  YTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS----ISPTVGHKYQPERGVIEFKDV 451
               +++  +      I     +  R+ E  D KP     I  +   K  P+RG I F+  
Sbjct: 1261 QVSSSLMWIIRMAVNIETTIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEHY 1320

Query: 452  SFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQ 510
            +  Y  R ++  + K ++ +I     + +VG +G GKST+ L L R   P  G I ID  
Sbjct: 1321 TTKY--RENLDPVLKDIDLRIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGI 1378

Query: 511  DITKLNCKSLRRQIGIVQQEPVLMSGTIRDN-----------ITYGLTYTPTKEEIRSVA 559
            DI+ L    LRR + I+ Q+     GT+R N           I   L  +  K  I  + 
Sbjct: 1379 DISTLGLYDLRRSLSIIPQDAQAFEGTVRSNLDPFNRHTDAEIWKALELSHLKPHIERIV 1438

Query: 560  KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
             +    +   K  +  DT I  +G  LS GQ+Q + ++RAL+    ILILDEAT+A+D E
Sbjct: 1439 SE--LPDDENKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRE 1496

Query: 620  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTS 679
            ++  I  T     K +  TI++IAHR+ T+  S+ ++VL   G V E      L  N  S
Sbjct: 1497 TDKIIQETIRTAFKDR--TILTIAHRIDTVLDSDKIMVLDK-GEVKEFDTPDNLLKNKES 1553

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 121/265 (45%), Gaps = 18/265 (6%)

Query: 457 TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLN 516
           + P V +    NF        CIVG  G GKST    +L    P   +   D+    K  
Sbjct: 636 SSPGVALKSIENFSAKKAQLTCIVGRVGSGKSTFLQAILGQL-PCVSS---DSASGVKPK 691

Query: 517 CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576
                  +    Q+P +M+ +++DNI +G  Y   +   +   K C     +   P+   
Sbjct: 692 VVIRADNLAYCPQQPWIMNASLKDNILFGYKYD--EAMYKKTIKACQLLPDLEILPDGDQ 749

Query: 577 TVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---LM 632
           T++G  G  LSGGQK R+++ARA+  +  + +LD+  SA+D    +  I+    +   L+
Sbjct: 750 TLVGEKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLL 809

Query: 633 KSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANS-----TSALSQLLNE 687
           K+K  T++   + ++ +  S+ +I L  +G +VE   ++E+ +        S+L +++ E
Sbjct: 810 KNK--TVILTTNAVNVLVHSD-MIYLLKNGKIVESNSYEEVMSKDRNNGEKSSLREIIEE 866

Query: 688 RAAPGPSDQQLQIEKVEEKEDTNEG 712
            A+    +   +  +    +D N G
Sbjct: 867 FASNESEETAEKKSESSTIDDKNVG 891

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 118/533 (22%), Positives = 234/533 (43%), Gaps = 60/533 (11%)

Query: 170  FLSFFTVALLIGCAANFG----RFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVG 225
            F+S F  A  +  A  FG    + I  ++LS   +A+LR H             D   VG
Sbjct: 1050 FISSFLTAGKVWVAVLFGTNATKKIFAKLLSSIFLAKLRFH-------------DITPVG 1096

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +++R   D  ++ + +         +++  +  + ++  ++P+     L F  P+    
Sbjct: 1097 RIMNRFSKDMDIIDQQLIPNFEGLFYSVVVCLWVIFLIGYITPRF----LLFAIPLCALY 1152

Query: 286  SVFGKQIRNTSKDLQEA----TGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD-- 339
             + G      S++L+         + ++  E + G+ T+++   E   +++  VAI    
Sbjct: 1153 YIVGSLYLRASRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQTLVAIDKSN 1212

Query: 340  --IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYL-VLQSQLSIGDLTAFMLYTEY 396
               F +               +L+   S L ++    YL    + + + +  +F    ++
Sbjct: 1213 APFFYLNLATEWITYRVDIIGALILFSSSLMIVLKAPYLDAGLAGILLSNAFSFTETAQW 1272

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYP 456
                  G+    S + +         E ++     +P       P+ G IEF++++  Y 
Sbjct: 1273 IIKVFSGVELLMSSVERIKEYVDVPLESSESNNYATPLAN---WPQTGDIEFENLTLRYS 1329

Query: 457  TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLN 516
               S +    ++FK+  G+ V IVG +G GKS+I   + R  +   GTI+IDN+DI  + 
Sbjct: 1330 PHSS-KALDGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTIIIDNKDIKYVP 1388

Query: 517  CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTK--------------EEIRSVAKQC 562
             + LR  I  + Q P L  GTIR N+     Y+  +              E + S+  Q 
Sbjct: 1389 LECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQSEGLCSLPGQK 1448

Query: 563  FCHNFITKFPNTY---DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
              +    K  N +   +TV+   G+ +S GQ+Q + +AR+++    I+++DEAT+++D  
Sbjct: 1449 LSYPSNHKLRNRFIDLNTVVKSGGSNISQGQRQLLCLARSMLGARNIMLIDEATASIDYV 1508

Query: 620  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE 672
            S+  I  T  + M++   T+++IAHRL ++   + ++V+       +MG+ +E
Sbjct: 1509 SDAKIQKTIRETMRNT--TVLTIAHRLRSVIDYDKILVM-------DMGRVEE 1552

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 91/192 (47%), Gaps = 11/192 (5%)

Query: 507 IDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
           + ++D  ++    +   +    Q P L+SGTI+DNI +G  +   +++   V K C    
Sbjct: 729 VHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFGEFFN--QQKFDDVIKCCCLEK 786

Query: 567 FITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI-- 624
            I        T +G  G  LSGGQ+QRIA+ARA+      L+ D+  SA+D E+   I  
Sbjct: 787 DIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDPETALHIYE 846

Query: 625 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684
               G +MK ++  + S  H +S I +    +V+  +G V   GK  +L  +     S+ 
Sbjct: 847 ECLCGPMMKGRTCIVTS--HNISLIIKQAQWLVILDNGEVKAQGKPSDLIES-----SKF 899

Query: 685 LNERAAPGPSDQ 696
           L E     P D+
Sbjct: 900 LKESINNDPGDK 911

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  103 bits (258), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 117/505 (23%), Positives = 212/505 (41%), Gaps = 54/505 (10%)

Query: 202  RLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVG 261
            RL     K+ L+    F D   +G +++R   D  V+   +T      V  +   +VGV 
Sbjct: 898  RLNLSAAKRILYAPMSFIDTTPMGRILNRFTKDTDVLDNELTDSTRMFVFQM-ANVVGVF 956

Query: 262  MM-------CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQL 314
            ++        +++  +S+LLL F      SA    K++    +        +     E L
Sbjct: 957  ILSIAYLPYVAIAVPISVLLLLFIGDHYQSAGREVKRLEAIQRSF------VYNNLGEVL 1010

Query: 315  SGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
             G+ T++++ A+   L + +  +    + G              +L  DL  + +    +
Sbjct: 1011 DGLDTIRAYNAQSRFLRKSDYFLNRTNEAGYLVIGARCWV----ALTTDLVAIAIALIVT 1066

Query: 375  YLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQG-------AGAASRLFELTDR 427
             L +   + I   +A +L T      V  +  +++ +++G         +  R+      
Sbjct: 1067 LLCVTRVIHITPSSAGVLLT-----VVLQMPAYFNMVLRGFTELENNMNSTQRVHYYATA 1121

Query: 428  KPSISP-----TVGHKYQPERGVIEFKDVSFSYPTRPSVQI-FKSLNFKIAPGSSVCIVG 481
             P  +P            P  G I F++VSF+Y  RP + +    ++F +  G  + I G
Sbjct: 1122 LPQEAPQYLPGAAPPAGWPAAGEIVFQEVSFAY--RPGLPLALCGVSFHVRAGEKIGICG 1179

Query: 482  PSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDN 541
             +G GK+++   L R     +G+I ID  DI  L    LR  + I+ Q+P+L  GT+R N
Sbjct: 1180 RTGAGKTSVTTALYRLSELESGSIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKN 1239

Query: 542  ITYGLTYTPTKEEIRSVAKQCFCHNFITK---FPNTY----DTVIGPHGTLLSGGQKQRI 594
            +       P  E            + +      P ++    D  +   G   S G++Q +
Sbjct: 1240 L------DPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGANFSLGERQLL 1293

Query: 595  AIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 654
            A+ARAL++   ILILDEATS++D  ++  +        + +  T++ +AHRL TI   + 
Sbjct: 1294 ALARALVRSTRILILDEATSSVDYATDARVQARIAA--EFRQATVLCVAHRLRTIISYDR 1351

Query: 655  VIVLGHDGSVVEMGKFKELYANSTS 679
            ++VL   G V E      L+A   S
Sbjct: 1352 ILVLDQ-GRVAEFDTPYRLFARKDS 1375

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 104/214 (48%), Gaps = 21/214 (9%)

Query: 464 FKSLN---FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSL 520
           F  LN   F I  G  + ++G  G GK+++   +  Y   TTG++ ++    + L C   
Sbjct: 548 FTGLNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNG---SLLFC--- 601

Query: 521 RRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 580
               G+    P + + TIRDNI +G ++  T+ +   V   C        FP    T +G
Sbjct: 602 ----GV----PWIQNATIRDNIIFGSSFDQTRYD--EVVNACALEADFKIFPAGDKTEVG 651

Query: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIV 640
             G  LSGGQK RI++ARA+ K   I + D+  SA+D      I      L + ++ T +
Sbjct: 652 ERGITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRI 710

Query: 641 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
              H+L+ ++ +  VI LG DGS  +MG   EL+
Sbjct: 711 LATHQLALVQEASRVIFLGQDGS-FDMGTPAELH 743

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 123/265 (46%), Gaps = 34/265 (12%)

Query: 457 TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLN 516
           ++ S   F  L+F++  G  + I G  G GK+++   L  + + T G I  + +    L 
Sbjct: 583 SKTSFSGFSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR---MLF 639

Query: 517 CKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITKFPNTY 575
           C +           P + + TIRDNIT+G   +P  E + R V + C     ++  P   
Sbjct: 640 CGA-----------PWIQNATIRDNITFG---SPYDENLYREVMRVCSLDRDMSVLPAGD 685

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMK 633
            T +G  G  LSGGQK RI +AR + K   I + D+  SA+D     +I  +   G+L  
Sbjct: 686 KTEVGERGITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKL-- 743

Query: 634 SKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL------YANSTSALSQLLNE 687
               T +   H++S   ++  VI LG DGS  ++G   EL      +AN     SQ  +E
Sbjct: 744 -GDKTRILATHQISLTEQASRVIYLGTDGS-FDIGTVDELKTRNVQFANLMKLASQTESE 801

Query: 688 RAAPGPS----DQQLQIEKVEEKED 708
                 S    D++ Q+ ++++ +D
Sbjct: 802 SKDDNISSEKFDREDQLRQLQQLDD 826

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/376 (21%), Positives = 157/376 (41%), Gaps = 40/376 (10%)

Query: 188  RFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQ--K 245
            +F L+  L  R    +    + + LH    F D   +G +++R   D  ++   +T+  +
Sbjct: 939  QFSLVSYLGLRASKNINLQSLHRLLHVPVSFIDTTPLGRILNRFTKDTDILDNELTESLR 998

Query: 246  VSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQ 305
            +      +I G++             I+ + + P    +  +        S   Q +  +
Sbjct: 999  MFSYQFTVIWGVI-------------IMSIIYLPWFAVAVPLLVVVFILVSDHYQCSARE 1045

Query: 306  LTRVA-----------EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXX 354
            + R+             E +SG+ T++++ AE   L + ++ I  + ++           
Sbjct: 1046 IKRLEAVQRSFVLNNFNEVISGVDTIKAYHAEARFLKKSDILIDRMNEMTFPLYASQRWV 1105

Query: 355  XXXXSLLGDLSFL--TVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIM 412
                 ++  L  L  ++L    +  + S  S G L  ++L      N +    T   ++ 
Sbjct: 1106 SILIGMIAVLFALIISILCVTGWFNI-SPASTGVLLTYVLQLPNLFNTLLRAMT---QLE 1161

Query: 413  QGAGAASRLFELTDRKPSISP-----TVGHKYQPERGVIEFKDVSFSYPTRPSVQ-IFKS 466
                +A R+    +  P  +P         K  PERG I F +V+ +Y  RP +  + + 
Sbjct: 1162 NDMNSAERVLSYANSLPKEAPYRIPEMAPPKAWPERGAITFDNVALAY--RPGLPLVLQD 1219

Query: 467  LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGI 526
            ++F I+ G  + I G +G GKSTI   L R    + G++ ID  DI  +   +LR ++ I
Sbjct: 1220 VSFHISSGEKIGICGRTGAGKSTITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSI 1279

Query: 527  VQQEPVLMSGTIRDNI 542
            + Q+P+L  GTIR N+
Sbjct: 1280 IPQDPLLFRGTIRKNL 1295

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 62/112 (55%), Gaps = 3/112 (2%)

Query: 576  DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
            D  +   G+  S G++Q +A+ARAL+++  ILILDEATS++D E++  I     Q  + +
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARIVQ--EFQ 1475

Query: 636  SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
              TI+ +AHRL TI   + ++V+   G V E      LY    S    + ++
Sbjct: 1476 HATIMCVAHRLKTILHYDRILVM-EKGRVAEFDTPLRLYNEQGSIFRSMCDQ 1526

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 105/220 (47%), Gaps = 13/220 (5%)

Query: 496 RYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 555
           + Y PT     ++++D  ++    +   +    Q P L+SGTI+DN+ +G  +   K++ 
Sbjct: 709 KIYVPT-----VESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFGEIFN--KQKF 761

Query: 556 RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
             V K C     I        T +G  G  LSGGQ+QRIA+ARA+      LILD+  SA
Sbjct: 762 DDVMKSCCLDKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSA 821

Query: 616 LDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
           +D E+   I      G +MK ++  I S  H +S + +  + +V+   G V   GK  +L
Sbjct: 822 VDPETALYIYEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEVKSQGKPSDL 879

Query: 674 YANSTSALSQLLNERAAPGPSDQQLQIEKVEEKEDTNEGE 713
              S   L + +N   +   +  Q+ +++    + T  G+
Sbjct: 880 -IKSNEFLRESINND-SKNTTHNQIDLKRSTTSKKTKNGD 917

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 90/187 (48%), Gaps = 19/187 (10%)

Query: 471 IAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQE 530
           + PGSS+ I+GP+  GKS+I  +L   +     T ++     + L C        I Q+ 
Sbjct: 595 LGPGSSLLILGPNSCGKSSIQRILAEIWPIYNKTGLVSIPAESDLMC--------IAQRP 646

Query: 531 PVLMSGTIRDNITYGLTYTPTKE------EIRSVAKQCFCHNFITKFPN-TYDTVIGPHG 583
             +  GT RD I Y ++     E      E+  + K+      + +    +Y   +    
Sbjct: 647 YFIQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKLDYLLKRSEGLSYLDFVADWK 706

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 643
            +LSGG+KQR+  AR +  +P  L+LDEAT+A+ V+ E   +Y F  L K +    +SI+
Sbjct: 707 DILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-FNFISIS 762

Query: 644 HRLSTIR 650
            R S I+
Sbjct: 763 QRPSLIK 769

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 120/253 (47%), Gaps = 36/253 (14%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLR---YYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           L F    GSS+ I+GP+G GKS+I  ++      YN   G + I +++            
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIAEIWPVYNKN-GLLSIPSEN-----------N 678

Query: 524 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 575
           I  + Q+P     GT+RD I Y ++           KE ++ + +    +        TY
Sbjct: 679 IFFIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTY 738

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
              I     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K  
Sbjct: 739 LDAIADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRY 794

Query: 636 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSD 695
               +SI+ R + I+  E ++ +G +      GK++     +  A++ + NE       +
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGENRD----GKWQLQAVGTDEAITSIDNE-----IEE 845

Query: 696 QQLQIEKVEEKED 708
            + ++E+V+  ED
Sbjct: 846 LERKLERVKGWED 858

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 102/237 (43%), Gaps = 48/237 (20%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y       + K +N  +   S + +VG +G GK+T+  +++    PT G 
Sbjct: 531 IIQLQDVSFGYEENSP--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGY 588

Query: 505 IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           +            ++ R +IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNPRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  K    Y   +G  G           LLSGGQK R+A A   +  P IL+LDE ++
Sbjct: 620 KTFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 666
            LD     A+     N+T G LM S  +++  I H  S I  SE+  V   DG++ +
Sbjct: 680 HLDTAGLDALIDALKNFTGGVLMVSHDISV--IDHVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 109/232 (46%), Gaps = 31/232 (13%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLR---YYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           L F    GSS+ I+GP+G GKS+I  ++      YN   G + I  ++            
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIAEIWPVYNKN-GLLSIPPEN-----------N 678

Query: 524 IGIVQQEPVL-MSGTIRDNITYGLTYT-------PTKEEIRSVAKQCFCHNFITKFPNTY 575
           I  + Q+P     GT+RD I Y ++           KE ++ + +    +        TY
Sbjct: 679 IFFIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKLDYLLKRAVGLTY 738

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
              +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K  
Sbjct: 739 LDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLF-NLLKRY 794

Query: 636 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
               +SI+ R + I+  E ++ +G +      GK++     +  A++ + NE
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGENRD----GKWQLQAVGTDEAITSIDNE 842

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 100/206 (48%), Gaps = 27/206 (13%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLL---LRYYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           L F    GSS+ I+GP+G GKS+I  ++      YN   G + I +++            
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIADVWPVYNKN-GLLSIPSEN-----------N 678

Query: 524 IGIVQQEPVL-MSGTIRDNITYGLTYT-------PTKEEIRSVAKQCFCHNFITKFPNTY 575
           I  + Q+P     GT+RD I Y ++           KE ++ +A+    +        TY
Sbjct: 679 IFCIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRLDYLLKRGVGLTY 738

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
              +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K  
Sbjct: 739 LDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRY 794

Query: 636 SMTIVSIAHRLSTIRRSENVIVLGHD 661
               +SI+ R + I+  E ++ +G +
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGEN 820

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 98/437 (22%), Positives = 184/437 (42%), Gaps = 52/437 (11%)

Query: 250 VKALICGIVGVGMMCSLSPQ-----LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEA-- 302
           + ++I  IV + M+  L        L +LLL F P  +F A       R+TS+   E   
Sbjct: 497 IGSIIMIIVSLSMLVRLLGTAAFVGLCVLLLIF-PLNVFLA-------RSTSRFQHEGLL 548

Query: 303 -TGQLTRVAEEQLSGIKTVQSFVAEGNELSRY----NVAIRDIFQVGXXXXXXXXXXXXX 357
            T +  +   E  S IK ++ F  E N ++      +  +R +  +              
Sbjct: 549 VTDKRIQNLNELFSSIKIIKCFTWEDNFINHILRTRDSEVRKMKLISVIWSCNAIIWYLT 608

Query: 358 XSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGL--------STFYS 409
            +L+  +SF       +Y +   + ++    AF      T  ++FGL        S+  +
Sbjct: 609 PTLITSISF-------AYFIFCERATLTAPIAF------TALSLFGLLKMPLDQLSSTIN 655

Query: 410 EIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNF 469
            I+Q   +  R+    D +P +          +     F   +  +       I ++LN 
Sbjct: 656 YIVQSVISLRRIQSFLD-EPDMDKQKNLLLSKDGTYFMFSGATIGWSINNKGFILENLNV 714

Query: 470 KIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI---DNQDITKLNCKSLRRQIGI 526
           K        + GP+G GKS + + LL   +   G I +    ++    ++   L   I  
Sbjct: 715 KFKSKKLNVVAGPTGAGKSLLLMSLLGETHLFKGEIHVPSLASKHELMIHGDGLTNSISY 774

Query: 527 VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
             Q P +++ +I++NI +G  +   +     V + C   N +    +  ++++G  G  L
Sbjct: 775 CSQIPWIINDSIKNNILFGSEFNLKRYN--DVIRACCLTNDLRLLQDGDNSIVGDRGQNL 832

Query: 587 SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF---GQLMKSKSMTIVSIA 643
           SGGQ+QR+++ARA+  K   +ILD+  SA+D +    I Y     G LMK ++  +VS  
Sbjct: 833 SGGQRQRVSLARAIYSKSMHIILDDCLSAVDSKCAKDI-YDLCLTGPLMKGRTCILVSHN 891

Query: 644 HRLSTIRRSENVIVLGH 660
             L  I+++  +++L +
Sbjct: 892 VEL-VIKKAAYLLILDN 907

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 104/210 (49%), Gaps = 20/210 (9%)

Query: 461 VQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSL 520
           + + + L FK  PGSS+ I+GP+G GK++I  ++   + P      I N++   L+  + 
Sbjct: 589 INLSQKLMFK-GPGSSMLILGPNGSGKTSIQRIIAEIW-P------IYNKN-GLLSVPAE 639

Query: 521 RRQIGIVQQEPVLMSGTIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITKFPNT 574
           R  I I Q+   +  GT R+ I Y ++           +E+  V K+      + +    
Sbjct: 640 RELICIPQKPYFIQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLEYLLKRDKGW 699

Query: 575 -YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMK 633
            Y   +     +LSGG++QR+  AR +  KP  ++LDEAT+A+  + E   +Y F  ++K
Sbjct: 700 RYLDAVAEWKDVLSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLF-NMLK 755

Query: 634 SKSMTIVSIAHRLSTIRRSENVIVLGHDGS 663
                 ++I+ R S I+  +  + +G D S
Sbjct: 756 RYRFNFITISQRPSLIKYHDLALEIGADES 785

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 113/250 (45%), Gaps = 33/250 (13%)

Query: 460 SVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKS 519
           ++ I K L F+  PGSS+ I+GP+G GK++I  ++   +       ++     + L C  
Sbjct: 587 NLNINKKLAFQ-GPGSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGLLSIPPASDLFC-- 643

Query: 520 LRRQIGIVQQEPVLMSG-TIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITKFP 572
                  V Q+P  + G T R+ I Y ++           +E+  +  +      + +  
Sbjct: 644 -------VPQKPYFIQGGTFREQIIYPMSADQYFDMGYRDKELTHILGEVKLDYLLKRDK 696

Query: 573 NT-YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQL 631
              Y   +     +LSGG++QRI  AR +  KP  ++LDEAT+A+  + E   +Y FG L
Sbjct: 697 GWRYLDAVAEWKDVLSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-L 752

Query: 632 MKSKSMTIVSIAHRLSTIRRSENVIVLGHDGS-----------VVEMGKFKELYANSTSA 680
           +K      ++I+ R S I+  +  + +  DG+           +  + K  E+  N    
Sbjct: 753 LKRYRFNFITISQRPSLIKYHDLALDISTDGTWRLQNLGTDEVITSIEKEIEMLENKLKN 812

Query: 681 LSQLLNERAA 690
           ++    ERAA
Sbjct: 813 VNVWEGERAA 822

>Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 109/232 (46%), Gaps = 31/232 (13%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLR---YYNPTTGTIMIDNQDITKLNCKSLRRQ 523
           L F    GSS+ I+GP+  GKS+I  ++      YN   G + I +++            
Sbjct: 631 LPFLQGSGSSLLILGPNSCGKSSIQRIIAEIWPVYNKN-GLLSIPSEN-----------N 678

Query: 524 IGIVQQEPVL-MSGTIRDNITYGLTYT-------PTKEEIRSVAKQCFCHNFITKFPNTY 575
           I  + Q+P     GT+RD I Y ++           KE ++ + +    +        TY
Sbjct: 679 IFCIPQKPYFSKGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVRLDYLLKRGVGLTY 738

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
              +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K  
Sbjct: 739 LDAVADWKDLLSGGEKQRVNFARVMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRY 794

Query: 636 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNE 687
               +SI+ R + I+  E ++ +G +      GK++     +  A++ + NE
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGENRD----GKWQLQAVGTDEAITSIDNE 842

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 114/242 (47%), Gaps = 31/242 (12%)

Query: 446 IEFKDVSFSYP----TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYN 499
           + F+++S+  P    ++   ++  S+   + PG  + I+G SG GK+T+   L + R   
Sbjct: 396 LSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQMLAIMGGSGAGKTTLLDILAMKRKTG 455

Query: 500 PTTGTIMIDNQDITKLNCKSLRRQIGIVQQ-----------EPVLMSGTIRDNITYGLTY 548
              GTI ++   I  LN K   + IG V Q           E VL S  +R  +   + +
Sbjct: 456 RVQGTIAVNGHSI--LN-KLYSKMIGFVDQDDFLLPTLTVYETVLNSALLR--LPRSMPF 510

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTIL 607
           T  ++ +  V ++        +  +  D +IG      +SGG+K+R++IA  L+  P IL
Sbjct: 511 TAKRKRVNRVLEE-------LRIMDIKDRIIGNDFERGISGGEKRRVSIACELVTSPAIL 563

Query: 608 ILDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVVE 666
            LDE TS LD  +   +     +L K+ + T+V SI    S I    + +VL  DG ++ 
Sbjct: 564 FLDEPTSGLDANNANNVIECLVRLAKNYNRTLVLSIHQPRSNIFNLFDKLVLLSDGEMIY 623

Query: 667 MG 668
            G
Sbjct: 624 SG 625

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 122/271 (45%), Gaps = 36/271 (13%)

Query: 444 GVIEFKDVSFSYPT-RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYNP 500
             + F++++++  + +    I K ++  I PG  + ++G SG GK+T+   L + R    
Sbjct: 375 AALSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTLLDILAMKRKTGQ 434

Query: 501 TTGTIMIDNQDITKLNCKSLRRQIGIVQQ-----------EPVLMSGTIRDNITYGLTYT 549
            TG+I ++  DI +   K   + IG V Q           E VL S  +R  +    ++ 
Sbjct: 435 VTGSIKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSALLR--LPRSFSFA 489

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTILI 608
             +  +  V ++        +  +  D VIG      +SGG+K+R++IA  L+  P IL 
Sbjct: 490 AKQTRVYQVLEE-------LRILDIKDRVIGNDFERGISGGEKRRVSIACELVTSPLILF 542

Query: 609 LDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVVEM 667
           LDE TS LD  +   +     +L K+ + T+V SI    S I +  + +VL  +G +V  
Sbjct: 543 LDEPTSGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLLSNGEMV-- 600

Query: 668 GKFKELYANSTSALSQLLNERAAPGPSDQQL 698
                 Y+     + + L       PSD  +
Sbjct: 601 ------YSGDAIRVGEFLRNNGYRCPSDYNI 625

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 121/239 (50%), Gaps = 21/239 (8%)

Query: 443  RGVIEFKDVSFSYPTRPS-VQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN-- 499
            +GV  +KDV +  P + S  ++   ++  + PG +  ++G SG GK+T+  +L +  +  
Sbjct: 799  KGVFMWKDVDYVIPYKGSEKKLLDKVSGFVKPGLT-ALMGASGAGKTTLLNVLAQRMDFG 857

Query: 500  -PTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSG-TIRDNITYGLTY-----TPTK 552
              ++G I++D + + +      +R +G VQQ+ +     T+R+++ +          P  
Sbjct: 858  IVSSGEILVDAKPVDR----KFKRSVGYVQQQDIHTQELTVRESLQFSARLRRPDSVPDA 913

Query: 553  EEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDE 611
            E++  V K       +    +  D V+G  G  L+  Q+++++I   L+ KPT+L+ LDE
Sbjct: 914  EKMEYVEKIIV----VLGMQDYSDAVVGEAGFGLNVEQRKKLSIGVELVAKPTLLLFLDE 969

Query: 612  ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS-ENVIVLGHDGSVVEMGK 669
             TS LD +S  AI     +L ++    + +I    +T+  S + +++L   GSVV  G 
Sbjct: 970  PTSGLDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFESFDRLLLLKDGGSVVYWGN 1028

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 91/207 (43%), Gaps = 38/207 (18%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y   P   + K +N  +   S + +VG +G GK+T+  +++    PT G 
Sbjct: 534 IIQLQDVSFGYD--PESLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGF 591

Query: 505 IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSVAKQC 562
           +            ++ R +IG   Q  V      +  + +  T  P K  EE R      
Sbjct: 592 V-----------SRNGRLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKNDEEYR------ 634

Query: 563 FCHNFITKFPNTYDTVIGPHG----TLLSGGQKQRIAIARALIKKPTILILDE-----AT 613
                +  F      + G  G     LLSGGQK R+A A   +  P IL+LDE      T
Sbjct: 635 ---RHLGSF-----GITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDT 686

Query: 614 SALDVESEGAINYTFGQLMKSKSMTIV 640
           S LD   +   N++ G LM S  ++I+
Sbjct: 687 SGLDALEDSLKNFSGGVLMVSHDISII 713

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H 
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSHD 426

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 427 RAFLNEVATDIIYQHN 442

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 92/212 (43%), Gaps = 46/212 (21%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y   P   + K +N  I   S + +VG +G GK+T+  ++L    P +G 
Sbjct: 531 IIQLQDVSFGYS--PDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGY 588

Query: 505 IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           +            ++ R +IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNPRLRIGYFTQHHV-------DSM-----------DLSTSAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  K    Y   +G  G           LLSGGQK R+A A   +  P ILILDE ++
Sbjct: 620 KTFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVS 641
            LD     A+     N+T G LM S  +++++
Sbjct: 680 HLDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 91/191 (47%), Gaps = 21/191 (10%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIV 527
           N  + PGSS+ I+GP+  GKS+I  ++   +     T ++     + + C        I 
Sbjct: 592 NVLLGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKTGLLSIPSESDMMC--------IA 643

Query: 528 QQEPVLMSGTIRDNITYGLTYTPTKE------EIRSVAKQCFCHNFITKFPN--TYDTVI 579
           Q+   +  GT RD I Y +      E      E+  V K+    +++ K  +   Y   +
Sbjct: 644 QRPYFIQGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKEVKL-DYLLKRADALNYLDHV 702

Query: 580 GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTI 639
                +LSGG+KQR+  AR +  +P  ++LDEAT+A+  + E   +Y F  L K +    
Sbjct: 703 ADWKDVLSGGEKQRMNFARIMFHRPKFIVLDEATNAISADME---DYLFNMLKKFR-FNF 758

Query: 640 VSIAHRLSTIR 650
           +SI+ R S I+
Sbjct: 759 ISISQRPSLIK 769

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 103/241 (42%), Gaps = 48/241 (19%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y    S  + K +N  +   S + +VG +G GK+T+  +++    P TG 
Sbjct: 532 IIQLQDVSFGYD--ESQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGH 589

Query: 505 IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           +            ++ R +IG   Q  +       D++           ++ + A     
Sbjct: 590 V-----------SRNPRLRIGYFTQHHI-------DSM-----------DLNASAVDWMS 620

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  K    Y   +G  G           LLSGGQK R+A A   +  P ILILDE ++
Sbjct: 621 KTFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSN 680

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            LD     A+     N++ G LM S  ++++        I  SE+  V   DG++ +  K
Sbjct: 681 HLDTAGLDALVQALKNFSGGVLMVSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKK 738

Query: 670 F 670
           +
Sbjct: 739 Y 739

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 424

Query: 646 LSTIRRSENVIVLGHD 661
            S +      I+  H+
Sbjct: 425 RSFLNEVATDIIYQHN 440

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 101/239 (42%), Gaps = 55/239 (23%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y  +    + K +N  +   S + +VG +G GK+T+  +++    PT+G 
Sbjct: 531 IIQLQDVSFGYEEQSL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGY 588

Query: 505 IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           +            ++ R +IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNGRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             +  K    Y   +G  G           LLSGGQK R+A A   +  P IL+LDE ++
Sbjct: 620 KTYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            LD     A+      +T G LM         ++H +S I    N I +  DG+V + G
Sbjct: 680 HLDTTGLEALVDALKKFTGGVLM---------VSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa]
           {ON} similar to uniprot|P25371 Saccharomyces cerevisiae
           YCR011C ADP1 Shows homology to ATP-dependent permeases
           Active transport ATPase
          Length = 1020

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 122/265 (46%), Gaps = 22/265 (8%)

Query: 443 RGVIEFKDVSFSYPT-RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYN 499
           R  + F+D+S+S  + +  + +   ++  + PG  + ++G SG GK+T+   L +     
Sbjct: 364 RSTLTFEDISYSITSNKKEINLLNGISGSVRPGEIMALMGGSGAGKTTLLDILAMKEKAG 423

Query: 500 PTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLM-SGTIRDNI-TYGLTYTPTKEEIRS 557
             +G I ++ + +TK N   L   IG V QE  L+ + T+ + +    L   P K  +  
Sbjct: 424 KVSGLIKVNGKGVTKQN---LAEIIGFVDQEDFLLPTLTVYETVLNSALLRLPRK--MSF 478

Query: 558 VAKQCFCHNFITKFPNTYDTVIGPHGTL---LSGGQKQRIAIARALIKKPTILILDEATS 614
            AKQ   +  + +                  +SGG+K+R++IA  L+  P+IL LDE TS
Sbjct: 479 TAKQKRVYQVLEELRIIDIKDRIIGDDFDRGISGGEKRRVSIACELVTSPSILFLDEPTS 538

Query: 615 ALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            LD  +   +     +L    + T+V SI    S I +S + +VL   G +V        
Sbjct: 539 GLDSNNANNVIECLVRLALHYNRTLVLSIHQPRSNIFKSFDKLVLLSQGEMV-------- 590

Query: 674 YANSTSALSQLLNERAAPGPSDQQL 698
           ++ + + +S+ L       PSD  +
Sbjct: 591 FSGAATDVSEFLRNNNYNCPSDYNI 615

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 116/256 (45%), Gaps = 37/256 (14%)

Query: 466 SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY---YNPTTGTIMIDNQDITKLNCKSLRR 522
           +L F   PGSS+ I+GP+  GKS+I  ++      YN   G + I  +D  +L C     
Sbjct: 675 TLPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKN-GLMSIPAED--ELMC----- 726

Query: 523 QIGIVQQEPVL-MSGTIRDNITY----------GLTYTPTKEEIRSVAKQCFCHNFITKF 571
               + Q P     GT RD I Y          GL      + +  V  +        K 
Sbjct: 727 ----IPQRPYFSKGGTFRDQIIYPMGSDEFFDRGLKDKLLVQILADVKLEYLLKR--DKG 780

Query: 572 PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQL 631
            + +D V      +LSGG+KQR+  AR L  KP  +ILDEAT+A+ V+ E   +Y F ++
Sbjct: 781 WSYFDAVF-DWKDVLSGGEKQRMNFARILFHKPRFVILDEATNAISVDME---DYLF-KM 835

Query: 632 MKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAP 691
           +K      +SI+ R S ++  + ++ +  D    + G +      +  A+S + NE    
Sbjct: 836 LKKYRFNFISISQRPSLVKYHDLLLEISED----KEGTWTLQTLGTDEAISSIDNEIEEL 891

Query: 692 GPSDQQLQIEKVEEKE 707
                ++Q+ + E +E
Sbjct: 892 EAKLMKVQVWEEERRE 907

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 120/249 (48%), Gaps = 31/249 (12%)

Query: 444 GVIEFKDVSFSYPT----RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLL--RY 497
             + F+++S++ P+         I K+++  + PG  + I+G SG GK+T+  +L   R 
Sbjct: 431 AALSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRK 490

Query: 498 YNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQ-----------EPVLMSGTIRDNITYGL 546
               +G I I+ +++++   + + + IG V Q           E VL S  +R  +   +
Sbjct: 491 SGHVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLR--LPNSM 545

Query: 547 TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPT 605
           T+   ++ +  V ++        +  N  D +IG      +SGG+K+R++IA  L+  P 
Sbjct: 546 TFYQKQQRVFQVLEE-------LRIYNIKDRLIGDDFERGISGGEKRRVSIACELVTSPL 598

Query: 606 ILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR-LSTIRRSENVIVLGHDGSV 664
           IL LDE TS LD  +   +     +L K+ + T+V   H+  S I    + +VL   G +
Sbjct: 599 ILFLDEPTSGLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEM 658

Query: 665 VEMGKFKEL 673
           V  G+ + +
Sbjct: 659 VYSGEIRRV 667

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 114/247 (46%), Gaps = 31/247 (12%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGI 526
           L F     SS+ I+GP+G GKS+I  ++   +       ++   D + L C         
Sbjct: 633 LPFLSGQASSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLSKPDSSSLLC--------- 683

Query: 527 VQQEPVLM-SGTIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITKFPN-TYDTV 578
           + Q+P     GT RD I Y ++           + +  +  +      + + P  +Y   
Sbjct: 684 IPQKPYFTRGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEVHLDYLLKRAPGWSYLDE 743

Query: 579 IGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMT 638
           +     +LSGG+KQR+  AR L  KP  ++LDEAT+A+  + E   +Y F  L K +  +
Sbjct: 744 VTEWKDVLSGGEKQRMNFARILFHKPKFIVLDEATNAISADME---DYLFNMLKKFR-FS 799

Query: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQL 698
            ++I+ R S I+  + ++ +         GK++     +  A++ + +E       + Q+
Sbjct: 800 FITISQRPSLIKYHDMLLEIADRD-----GKWQLQTLGTDEAITTIDHE-----IEELQI 849

Query: 699 QIEKVEE 705
           +++KVEE
Sbjct: 850 KLQKVEE 856

>SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa]
           {ON} highly similar to gnl|GLV|KLLA0D04554g
           Kluyveromyces lactis KLLA0D04554g and similar to YCR011C
           uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1027

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 127/274 (46%), Gaps = 39/274 (14%)

Query: 443 RGVIEFKDVSFSYPTR--PSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
           +  + F+++++   +    S Q+  S++  + PG  + I+G SG GK+T+ L +L   N 
Sbjct: 367 KATLTFENINYQVRSSKGSSTQVLNSISGSVKPGEILAIMGGSGAGKTTL-LDILAMKNK 425

Query: 501 T---TGTIMIDNQDITKLNCKSLRRQIGIVQQEP-----------VLMSGTIRDNITYGL 546
           T   TG+I ++  ++TK N     + +G V QE            VL S  +R  +   +
Sbjct: 426 TGKVTGSIRLNGTEVTKQN---YSKIVGFVDQEDFLLPTLTVYETVLNSALLR--LPRSM 480

Query: 547 TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPT 605
           ++   ++ +  V ++        +     + VIG      +SGG+K+R++IA  L+  P 
Sbjct: 481 SFAAKQKRVYQVLEE-------LRIFEIRNRVIGNDLERGISGGEKRRVSIACELVTSPL 533

Query: 606 ILILDEATSALDVESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSENVIVLGHDGSV 664
           IL LDE TS LD  +   +     +L    + T I+SI    S I +  + +VL  +G +
Sbjct: 534 ILFLDEPTSGLDSNNANNVIECLVRLANHYNRTLILSIHQPRSNIFKLFDKLVLLSEGEL 593

Query: 665 VEMGKFKELYANSTSALSQLLNERAAPGPSDQQL 698
           V        Y+     +S+ L  +    PSD  +
Sbjct: 594 V--------YSGEAVRVSEFLRNQGFTCPSDYNI 619

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 122/288 (42%), Gaps = 63/288 (21%)

Query: 408 YSEIMQGAGAASRLFELTDRKPSISPTVGHKY------QPER---GVIEFKDVSFSYPTR 458
           Y+ +++ A +  ++ +  +    + P V  K       Q ER    V+ F D+SF Y + 
Sbjct: 346 YANLVKQAKSRQKILDKMEADGLVQPVVPDKVFSFRFPQVERLPPPVLAFDDISFHYESN 405

Query: 459 PSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI------------- 505
           PS  +++ LNF +   S + +VGP+G GKST+  ++     P +G +             
Sbjct: 406 PSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGVYSQ 465

Query: 506 -MIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
              D  D+TK   + +R +   + Q+     G +     YGLT      ++ +       
Sbjct: 466 HSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEGQTVQMAT------- 515

Query: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES---- 620
                                LS GQ+ R+  A   +++P +L+LDE T+ LD+ +    
Sbjct: 516 ---------------------LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSL 554

Query: 621 EGAIN-YTFGQLMKSKSMTIVS-IAHRLSTIRRSENVIVLGHDGSVVE 666
             AIN +  G ++ S    ++  IA  +  +   EN      DGS+++
Sbjct: 555 ADAINEFNGGVVVVSHDFRLLDKIAQDIFVV---ENKTATRWDGSILQ 599

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/328 (21%), Positives = 139/328 (42%), Gaps = 65/328 (19%)

Query: 363 DLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTGN--AVFGLSTFYSEIMQGAG 416
           D+    + AYG    SY+  +S+L    +  +    E   +       +  Y+ +++ A 
Sbjct: 294 DMRLQKLTAYGGNYDSYVKTRSELETNQMKQYHKQQEEIAHIKKFIASAGTYANLVKQAK 353

Query: 417 AASRLFELTDRKPSISPTVGHKY------QPER---GVIEFKDVSFSYPTRPSVQIFKSL 467
           +  ++ +  +    + P V  +       + ER    V+ F ++SFSY  +P   ++++L
Sbjct: 354 SRQKILDKMEADGLVQPVVSDRVFSFRFPEVERLPPPVLAFDEISFSYDEKPENNLYENL 413

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI--------------MIDNQDIT 513
           NF +   S V +VGP+G GKST+  ++     P  G +                D  D+T
Sbjct: 414 NFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRVSRHTHVKLGVYSQHSQDQLDLT 473

Query: 514 KLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 573
           K   + +R + G + ++     G +     YGLT      ++                  
Sbjct: 474 KSALEFVRDKYGHISEDFQYWRGQLG---RYGLTGEGQTVQM------------------ 512

Query: 574 TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMK 633
                    GT LS GQ+ R+  A   + +P +L+LDE T+ LD+ +  ++     + + 
Sbjct: 513 ---------GT-LSEGQRSRVVFALLALDQPNVLLLDEPTNGLDIPTIDSL----AEAID 558

Query: 634 SKSMTIVSIAHRLSTIRR-SENVIVLGH 660
           + +  +V ++H    + R ++++ V+ H
Sbjct: 559 AFNGGVVVVSHDFRLLDRIAKDIYVVEH 586

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 845

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 94/208 (45%), Gaps = 29/208 (13%)

Query: 474 GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVL 533
           GSS+ I+GP+  GKS+I  +L   +       ++       L C         V Q P  
Sbjct: 615 GSSLLILGPNSCGKSSIERILTEIWPIYNKNGLLSTPPSHDLFC---------VPQRPYF 665

Query: 534 MSG-TIRDNITYGLTYTPTKEE----------IRSVAKQCFCHNFITKFPNTYDTVIGPH 582
           + G T RD I Y +TY    E           +R V           +  N +D  I   
Sbjct: 666 IQGGTFRDQIIYPMTYEQFHERGHKDTYLVQILREVRLDYLLKR--DRGLNYFDA-IADW 722

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 642
             +LSGG+KQR+   R +  +P  ++LDEAT+A+ V+ E  + +T   ++K      +SI
Sbjct: 723 KDVLSGGEKQRMNFTRIMFHRPRFVVLDEATNAISVDMEDHL-FT---MLKRYRFNFISI 778

Query: 643 AHRLSTIRRSENVIVL--GHDGSVVEMG 668
           + R S I+  + ++ L  G D S+  +G
Sbjct: 779 SQRPSLIKYHDYLLELTNGTDWSLQALG 806

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 100/239 (41%), Gaps = 55/239 (23%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y  +    + K +N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVSFGYDEKN--LLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGY 588

Query: 505 IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           +            ++ R +IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNGRLRIGYFTQHHV-------DSM-----------DLTTSAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  K    Y   +G  G           LLSGGQK R+A A   +  P ILILDE ++
Sbjct: 620 KTFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            LD     A+     N++ G LM         ++H +S I    N I +  +G+V + G
Sbjct: 680 HLDTTGLDALIDALKNFSGGVLM---------VSHDISVINSVCNEIWVSEEGTVKKFG 729

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 134/326 (41%), Gaps = 65/326 (19%)

Query: 372 YGSYLVLQSQLSIGDLTAFMLYTEYTGN--AVFGLSTFYSEIMQGAGAASRLFELTDRKP 429
           Y SY   +S+L    +  +    E   +       +  Y+ +++ A +  ++ +  +   
Sbjct: 308 YDSYAKTRSELETNQMKQYNKQQEEIAHIKKFIASAGTYANLVRQAKSRQKILDKMEADG 367

Query: 430 SISPTVGHKY------QPER---GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 480
            + P V  K       + ER    V+ F ++SF+Y   P   ++++LNF +   S + +V
Sbjct: 368 LVQPVVPDKVFSFRFQEVERLPPPVLAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALV 427

Query: 481 GPSGRGKSTIALLLLRYYNPTTGTI--------------MIDNQDITKLNCKSLRRQIGI 526
           GP+G GKST+  ++     P  G +                D  D+TK   + +R +   
Sbjct: 428 GPNGVGKSTLLKIMTGDLTPQAGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSH 487

Query: 527 VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
           + Q+     G +     YGLT    K ++                           GT L
Sbjct: 488 ISQDFQYWRGQLG---RYGLTGDGQKAQM---------------------------GT-L 516

Query: 587 SGGQKQRIAIARALIKKPTILILDEATSALDVES----EGAIN-YTFGQLMKSKSMTIVS 641
           S GQ+ R+  A   ++ P IL+LDE T+ LD+ +      AIN +  G ++ S    ++ 
Sbjct: 517 SEGQRSRVVFALLALQAPNILLLDEPTNGLDIPTIDSLAEAINTFNGGVVVVSHDFRLLD 576

Query: 642 -IAHRLSTIRRSENVIVLGHDGSVVE 666
            IA  +  +   EN      DGS++E
Sbjct: 577 KIAQDIFVV---ENKTAYRWDGSILE 599

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 99/234 (42%), Gaps = 54/234 (23%)

Query: 408 YSEIMQGAGAASRLFELTDRKPSISPTVGHKY------QPER---GVIEFKDVSFSYPTR 458
           Y+ +++ A +  ++ +  +    + P V  K       Q ER    V+ F D+SF Y + 
Sbjct: 346 YANLVKQAKSRQKILDKMEADGLVQPVVPDKVFSFRFPQVERLPPPVLAFDDISFHYESN 405

Query: 459 PSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI------------- 505
           PS  +++ LNF +   S + +VGP+G GKST+  ++     P +G +             
Sbjct: 406 PSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGVYSQ 465

Query: 506 -MIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
              D  D+TK   + +R +   + Q+     G +     YGLT      ++ +       
Sbjct: 466 HSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEGQTVQMAT------- 515

Query: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
                                LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 516 ---------------------LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 112/244 (45%), Gaps = 29/244 (11%)

Query: 443 RGVIEFKDVSFSYPTR--PSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYY 498
             V+ FKD+ +  P     S  +   ++  + PG  + ++G SG GK+T+   L + +  
Sbjct: 393 EAVLTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAMKKKA 452

Query: 499 NPTTGTIMIDNQDITKLNCKSLRRQIGIVQQ-----------EPVLMSGTIRDNITYGLT 547
              +G I ++ + I+K   K   + IG V Q           E VL S  +R  +   L 
Sbjct: 453 GKVSGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSALLR--LPRALP 507

Query: 548 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTI 606
           +   +  +  V ++        +  +  D +IG      +SGG+K+R++IA  L+  P I
Sbjct: 508 FEAKRSRVYKVLEE-------LRILDIKDKIIGNEFERGISGGEKRRVSIACELVTSPLI 560

Query: 607 LILDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVV 665
           L LDE TS LD  +   +     +L ++   T+V SI    S I +  + +VL  +G +V
Sbjct: 561 LFLDEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSNGEMV 620

Query: 666 EMGK 669
             G+
Sbjct: 621 YSGE 624

>KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]
           {ON} highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 98/241 (40%), Gaps = 48/241 (19%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF +   PS  + K +N  +   S + IVG +G GK+T+  +L+    P  G 
Sbjct: 531 IIQLQDVSFGFD--PSQLLLKDVNLDVQMDSRIAIVGANGCGKTTLLKILMEQLRPLQG- 587

Query: 505 IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
                                 V + P L        + Y   +     ++ + A     
Sbjct: 588 ---------------------YVSRNPRL-------RVAYFTQHHVDSMDLNASAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
           + F  +    Y   +G  G           LLSGGQK R+A A   +  P IL+LDE ++
Sbjct: 620 NTFPGRTDEEYRRHLGAFGITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            LD     A+      +T G LM S  ++++      + I  SEN  V   +G++ +   
Sbjct: 680 HLDTAGLDALMDALKKFTGGVLMVSHDISVIDGV--CNEIWVSENGTVRRFEGTIFDYKN 737

Query: 670 F 670
           +
Sbjct: 738 Y 738

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+V ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 96/208 (46%), Gaps = 33/208 (15%)

Query: 460 SVQIFKSLN------FKIAPGSSVCIVGPSGRGKSTIALLLLRY---YNPTTGTIMIDNQ 510
           S Q FK +N      F    GSS+ I+GP+  GK++I  ++      YN   G + + +Q
Sbjct: 645 STQDFKQINDMSSIPFIHGSGSSLLILGPNSSGKTSIQRIIAEIWPIYNKN-GLLSVPSQ 703

Query: 511 DITKLNCKSLRRQIGIVQQEPVLMS-GTIRDNITYGLTYTPTKEE------IRSVAKQCF 563
           +            I  + Q P   S GT+RD I Y ++     +       +  + K+  
Sbjct: 704 E-----------NIFCIPQRPYFTSSGTLRDQIIYPMSSDEFFDRGLKDSLLIQILKEVN 752

Query: 564 CHNFITKFPN-TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
               + +    TY   +     LLSGG+KQRI  AR L  KP  ++LDEAT+A+  + E 
Sbjct: 753 LKYLMKRSKGLTYLDTVADWKDLLSGGEKQRINFARILFHKPRFIVLDEATNAISQDME- 811

Query: 623 AINYTFGQLMKSKSMTIVSIAHRLSTIR 650
             +Y F  ++K      ++I+ R S I+
Sbjct: 812 --DYLFN-ILKKYRFNFITISQRPSLIK 836

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 123/275 (44%), Gaps = 40/275 (14%)

Query: 363 DLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTGN--AVFGLSTFYSEIMQGAG 416
           D+    + AYG    SY+  +S+L    +  +    E   +       +  Y+ +++ A 
Sbjct: 293 DMRLQQLTAYGGNYDSYVKTRSELETNQMKQYSKQQEEIAHIKKFIASAGTYANLVKQAK 352

Query: 417 AASRLFELTDRKPSISPTVGHK-----YQP-ER---GVIEFKDVSFSYPTRPSVQIFKSL 467
           +  ++ +  +    +   V  K     + P ER    V+ F D+SFSY   P   +++ L
Sbjct: 353 SRQKILDKMEADGLVQAVVADKVFSFRFPPVERLPPPVLAFDDISFSYDDNPENNLYEKL 412

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIV 527
           NF +   S + +VGP+G GKST+  ++     P +G +            +    ++G+ 
Sbjct: 413 NFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGRV-----------SRHTHVKLGVY 461

Query: 528 QQEPVLMSGTIRDNITYGLTYTP---TKEEIRSVAKQC-FCHNFITKFPNTYDTVIGPHG 583
            Q         +D +   LT +P    +++  ++++   +    + ++  T +      G
Sbjct: 462 SQHS-------QDQLD--LTKSPLEFVRDKYPNISQDFQYWRGQLGRYGLTGEAQTSQMG 512

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
           T LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 513 T-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR011W
            (SNQ2) - ABC transporter [contig 8] FULL
          Length = 1489

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 114/235 (48%), Gaps = 18/235 (7%)

Query: 444  GVIEFKDVSFSYPTRPSV-QIFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNPT 501
            GV  +K+V+F+ P + S  ++  +++   APGS   ++G SG GK+T +  L  R     
Sbjct: 843  GVFVWKEVNFTIPYKGSTRKLLDNVSGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGII 902

Query: 502  TGTIMIDNQDITKLNCKSLRRQIGIVQQEPV-LMSGTIRDNITYGLTY-----TPTKEEI 555
            TG ++++ + I      S  R+ G VQQ+ V +   T+R++  +          P  E++
Sbjct: 903  TGDMLVNGKPID----ASFERRTGYVQQQDVHVKEMTVRESFQFAARMRRPQSIPESEKL 958

Query: 556  RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATS 614
              V K       I    +  + +IG  G  L+  Q+++++I   L  KP +L+ LDE TS
Sbjct: 959  AYVEKII----EILDMEDYAEALIGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTS 1014

Query: 615  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 668
             LD +S  AI     +L ++    + +I    +T+    + +++L   G  V  G
Sbjct: 1015 GLDSQSSWAIVQLMRRLAEAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1069

>YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}
           Putative ABC transporter
          Length = 1294

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 114/249 (45%), Gaps = 36/249 (14%)

Query: 448 FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP------- 500
           +K+ +F + T+   +I +S+N    PG    I+GPSG GKS++  L+             
Sbjct: 697 WKEGNFHHETK---EILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFD 753

Query: 501 TTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYG-------LTYTPTKE 553
           T+G+IM ++  +++L  K++   +     + +L + T+++ + Y        LT     E
Sbjct: 754 TSGSIMFNDIQVSELMFKNVCSYVS-QDDDHLLAALTVKETLKYAAALRLHHLTEAERME 812

Query: 554 E----IRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTILI 608
                IRS+  +  C N           +IG      +SGG+K+R+ +   L+  P IL+
Sbjct: 813 RTDNLIRSLGLK-HCEN----------NIIGNEFVKGISGGEKRRVTMGVQLLNDPPILL 861

Query: 609 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGHDGSVVE 666
           LDE TS LD  +   I     +L + +  TI+   H  R    +R  NV++L   G    
Sbjct: 862 LDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQPRSELFKRFGNVLLLAKSGRTAF 921

Query: 667 MGKFKELYA 675
            G   E+ A
Sbjct: 922 NGSPDEMIA 930

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 68/142 (47%), Gaps = 11/142 (7%)

Query: 576 DTVIGPHGTL-LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS 634
           DT++G +    LSGG+K+R++I   +I  P+I+ LDE T+ LD  S   +  T  +L K 
Sbjct: 175 DTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKE 234

Query: 635 KSMT-IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE---LYANSTSALSQLLNERAA 690
              T I+SI    S I    + + +   G+VV   K       + +    + QL+N    
Sbjct: 235 DGRTFIMSIHQPRSDILFLLDQVCILSKGNVVYCDKMDNTIPYFESIGYHVPQLVN---- 290

Query: 691 PGPSDQQLQIEKVEEKEDTNEG 712
             P+D  + +  V+ + D  E 
Sbjct: 291 --PADYFIDLSSVDSRSDKEEA 310

>TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa]
           {ON} Anc_8.661 YPL147W
          Length = 872

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 88/193 (45%), Gaps = 21/193 (10%)

Query: 466 SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIG 525
           SL F   PG+S+ I+GP+  GKS+I  ++   +       ++       L C        
Sbjct: 632 SLPFFEGPGASLLILGPNSCGKSSIQRIIAEIWPVYNKNGLLSIPSEGNLFC-------- 683

Query: 526 IVQQEPVLM-SGTIRDNITYGLTYT-------PTKEEIRSVAKQCFCHNFITKFPNTYDT 577
            V Q+P     GT+RD I Y ++           K  ++ + +    +    K   TY  
Sbjct: 684 -VPQKPYFTRGGTLRDQIIYPMSSDEFFDRGFKDKHLVQILGEVRLEYLLKRKKGWTYLD 742

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637
            +     +LSGG+KQR+  AR +  KP  ++LDE T+A+  + E   +Y F  L+K    
Sbjct: 743 AVADWKDVLSGGEKQRMNFARIMFHKPRFVVLDEGTNAISADME---DYLF-NLLKRYRF 798

Query: 638 TIVSIAHRLSTIR 650
             +SI+ R S I+
Sbjct: 799 NFISISQRPSLIK 811

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 82/188 (43%), Gaps = 45/188 (23%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           V+ F D+SF Y + PS  ++++LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 505 I--------------MIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           +                D  D+TK   + +R +   V Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPSVSQDFQYWRGQLG---RYGLTGEG 508

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
              ++ +                            LS GQ+ R+  A   +++P +L+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 611 EATSALDV 618
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR011C (ADP1) and
           YOL075C
          Length = 1011

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 127/271 (46%), Gaps = 39/271 (14%)

Query: 446 IEFKDVSFS-YPTRPS-VQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT-- 501
           + F+++ +  +P+R S V+I  S++  ++PG  + ++G SG GK T  L +L   N    
Sbjct: 364 LTFENLCYKVFPSRSSPVRILNSISGYVSPGEILAVMGGSGAGK-TCLLDILGMKNKAGE 422

Query: 502 -TGTIMIDNQDITKLNCKSLRRQIGIVQQ-----------EPVLMSGTIRDNITYGLTYT 549
            +GT+ I+   ITK    ++ + +G V Q           E VL S  +R  +   +++ 
Sbjct: 423 VSGTVKINGVPITK---HTVSKVVGFVDQDNHLLPTLTVYETVLNSALLR--LPRSMSFA 477

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTILI 608
             ++ +  V ++        +  +  D +IG      +SGG+K+R++IA  L+  P IL 
Sbjct: 478 AKQKRVYQVLEE-------LRIFDIRDRLIGNDFERGISGGEKRRVSIACELVTSPLILF 530

Query: 609 LDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVVEM 667
           LDE TS LD  +   +     +L      T+V SI    S I R  + +VL ++G +V  
Sbjct: 531 LDEPTSGLDSNNANNVIECLVRLASQYRRTLVLSIHQPRSNIFRLFDNLVLLNEGEMV-- 588

Query: 668 GKFKELYANSTSALSQLLNERAAPGPSDQQL 698
                 Y+   + ++  L       PSD  +
Sbjct: 589 ------YSGPITRVNDFLRNTGFNCPSDYNI 613

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 113/237 (47%), Gaps = 21/237 (8%)

Query: 445  VIEFKDVSFSYP-TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP--T 501
            V+ ++D+ +     R S +I  +++  + PG+   ++G SG GK+T+   L         
Sbjct: 852  VVHWRDLCYEVRIKRESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVI 911

Query: 502  TGTIMIDNQDITKLNCKSLRRQIGIVQQEPV-LMSGTIRDNITYGLTY-----TPTKEEI 555
            TG I +D     KL  +S  R IG  QQ+ + L + T+R+++ +          P  E+ 
Sbjct: 912  TGGIFVDG----KLRDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKR 967

Query: 556  RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATS 614
            + V +     N +   P   D ++G  G  L+  Q++R+ I   L+ KP +LI LDE TS
Sbjct: 968  KYVEEVI---NVLEMEPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTS 1023

Query: 615  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST--IRRSENVIVLGHDGSVVEMGK 669
             LD ++  +I     +L  ++   I+   H+ S   I+  + ++ L   G  V  G+
Sbjct: 1024 GLDSQTAWSICQLIRKL-ANRGQAILCTIHQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 81/188 (43%), Gaps = 45/188 (23%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           V+ F D+SF Y + PS  +++ LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 505 I--------------MIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           +                D  D+TK   + +R +   + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEG 508

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
              ++ +                            LS GQ+ R+  A   +++P +L+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 611 EATSALDV 618
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 72/317 (22%), Positives = 140/317 (44%), Gaps = 47/317 (14%)

Query: 372 YGSYLVLQSQLSIGDLTAFMLYTEYTGN--AVFGLSTFYSEIMQGAGAASRLFELTDRKP 429
           Y SY+  +++L    +  +    E   +       +  Y+ +++ A +  ++ +  +   
Sbjct: 308 YDSYIKTRTELETNQMKQYNKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADG 367

Query: 430 SISPTVGHKY------QPER---GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 480
            I P V  +       Q +R    V+ F D+SFSY  +P   +++ LNF +   S + +V
Sbjct: 368 LIQPVVQDRVFSFRFPQVDRLPPPVLAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALV 427

Query: 481 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRD 540
           GP+G GKST+  ++       TG +M  +  ++    +    ++G+  Q     S    D
Sbjct: 428 GPNGVGKSTLLKIM-------TGELMSQSGRVS----RHTHVKLGVYSQH----SQDQLD 472

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600
                L +   K    S   Q +    + ++  T +      GT LS GQ+ R+  A   
Sbjct: 473 LTKSALEFVRDKYSNISQDFQ-YWRGQLGRYGLTGEAQTVLMGT-LSEGQRSRVVFALLA 530

Query: 601 IKKPTILILDEATSALDVES----EGAINYTFGQLMKSKSMTIVSIAHRLSTIRR-SENV 655
           +++P +L+LDE T+ LD+ +      AIN   G         +V ++H    + + ++++
Sbjct: 531 LEQPNVLLLDEPTNGLDIPTIDSLADAINEFNG--------GVVVVSHDFRLLDKIAKDI 582

Query: 656 IVLGH------DGSVVE 666
            V+ H      DGS++E
Sbjct: 583 FVVEHKTATRWDGSILE 599

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q08234 Saccharomyces cerevisiae YOL075C
           Hypothetical ORF
          Length = 1270

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 108/234 (46%), Gaps = 21/234 (8%)

Query: 455 YPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI---------ALLLLRYYNPTTGTI 505
           +  + + QI + +N    PG    I+GPSG GKS++         + LL++++  +TG+I
Sbjct: 679 WLQKKTKQILQDVNAVFKPGMINAIMGPSGSGKSSLLNLISGRSNSSLLVKFH--STGSI 736

Query: 506 MIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLT---YTPTKEEIRSVAKQC 562
           +++   I+K   KS+   +     + +L S T+R+   +      +  T ++ RS   + 
Sbjct: 737 LLNTNSISKEMFKSVCSYVS-QDDDHLLASLTVRETFEFAAALRLHYMTSQQRRSKIDEI 795

Query: 563 FCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
                +T   NT   VIG      +SGG+K+R+ I   L+    IL+LDE TS LD  + 
Sbjct: 796 LLALGLTHCENT---VIGNEFVKGISGGEKRRVTIGVQLLNNSPILLLDEPTSGLDSFTS 852

Query: 622 GAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            AI      L      T++   H  R    ++  +V++L   G     G   E+
Sbjct: 853 AAILEILENLCTEDGKTVIITIHQPRSELFQKFGHVLLLARSGRAAFNGSPNEM 906

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMT-IVSIAH 644
           LSGG+K+R+++A  L+  P+ + LDE T+ LD  S   +  +  +L +    + I+S+  
Sbjct: 164 LSGGEKRRLSVATQLVSNPSFMFLDEPTTGLDAYSAFLLVKSLKKLARDGQKSFIMSVHQ 223

Query: 645 RLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
             S I    + + +   G+VV  GK  E+
Sbjct: 224 PRSDIMFLLDSVCILSKGNVVYCGKTTEM 252

>Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W
            (REAL)
          Length = 1501

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 114/236 (48%), Gaps = 18/236 (7%)

Query: 443  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNP 500
            +GV  +KDV F+ P   S + +  +++    PG+   ++G SG GK+T +  L  R    
Sbjct: 850  KGVFIWKDVCFTIPYEGSTRMLLDNVSGYCVPGTMTALMGESGAGKTTLLNTLAQRNVGI 909

Query: 501  TTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSG-TIRDNITYGLTYT-----PTKEE 554
             TG ++++ + I      S  R+ G VQQ+ + ++  T+R+++ +          P  E+
Sbjct: 910  ITGDMLVNGRPID----ASFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQRLPDSEK 965

Query: 555  IRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEAT 613
            +  V K       +       + ++G  G  L+  Q+++++I   L+ KP +L+ LDE T
Sbjct: 966  MEYVEKII----RVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPT 1021

Query: 614  SALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 668
            S LD +S  AI     +L K+    + +I    +T+    + +++L   G  V  G
Sbjct: 1022 SGLDSQSSWAIIQLLRKLSKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1077

>KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 99/226 (43%), Gaps = 37/226 (16%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSFSY  + S  +   +N  +   S + +VG +G GK+T+  +++    PT G 
Sbjct: 531 IIQLQDVSFSY--KESDPLLTDVNLDVQMDSRISLVGANGCGKTTLLKVMMEQLRPTKGF 588

Query: 505 IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP--TKEEIRSVAKQC 562
           +            ++ R +IG   Q  V      +  + +  T  P  T EE R      
Sbjct: 589 V-----------SRNPRLRIGYFTQHHVDSMDLNQSAVDWMSTAFPGKTDEEYRR----- 632

Query: 563 FCHNFITKFPNTYDTVIGPHG----TLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
                +  F      + G  G     LLSGGQK R+A A   +  P IL+LDE ++ LD 
Sbjct: 633 ----HLGAF-----GISGSLGIQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDT 683

Query: 619 ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 664
               A+       +KS +  ++ ++H +S I    N I +   G V
Sbjct: 684 AGLDAL----VDALKSFNGGVLMVSHDISVINSVCNEIWVSEGGKV 725

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 95/235 (40%), Gaps = 55/235 (23%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DV+F Y    +  + K +N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVTFGY--NENNLLLKDVNLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKGY 588

Query: 505 IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           +            ++ R ++G   Q  V                     ++ + A +   
Sbjct: 589 V-----------SRNPRLRLGYFAQHHV------------------DAMDLNASAVEWMS 619

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  +    Y   +G  G           LLSGGQK R+A A   +  P +LILDE ++
Sbjct: 620 KTFPGRSDEEYRRHLGSFGITGSLGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 664
            LD     A+     N+T G LM         ++H +S I    N I +  DGS 
Sbjct: 680 HLDTSGIDALVDALKNFTGGVLM---------VSHDISVINSVCNEIWVSEDGSA 725

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   TI+ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P25371 Saccharomyces cerevisiae
           YCR011C ADP1 Shows homology to ATP-dependent permeases
           Active transport ATPase
          Length = 1022

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 111/244 (45%), Gaps = 37/244 (15%)

Query: 471 IAPGSSVCIVGPSGRGKSTIALLLLRYYNPT---TGTIMIDNQDITKLNCKSLRRQIGIV 527
           + PG  + I+G SG GK+T+ L +L   N T   TG+I ++  DI K       + IG V
Sbjct: 397 VKPGEMLAIMGGSGAGKTTL-LDILAMKNKTGKVTGSIKVNGVDIDK---DKYSKIIGFV 452

Query: 528 QQEP-----------VLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576
            QE            VL S  +R  +   L+++  +  +  V ++        +  +  D
Sbjct: 453 DQEDYLLPTLTVYETVLNSALLR--LPRQLSFSAKQRRVYDVLEE-------LRIFDIRD 503

Query: 577 TVIGP-HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
            VIG  +   +SGG+K+R++IA  L+  P +L LDE TS LD  +   +     +L    
Sbjct: 504 RVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIECLVRLANHY 563

Query: 636 SMTIV-SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAPGPS 694
           + T+V SI    S+I +  + +VL  +G +V        Y+     +++ L       P 
Sbjct: 564 NKTLVLSIHQPRSSIFQLFDKLVLLSNGKMV--------YSGDAHKVNEFLKNEGYACPP 615

Query: 695 DQQL 698
           D  +
Sbjct: 616 DYNI 619

>Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {ON}
           complement(86642..88900) [2259 nt, 753 aa]
          Length = 752

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 102/233 (43%), Gaps = 32/233 (13%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y  +    +   +N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVSFGYNEKN--LLLADVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLKGY 588

Query: 505 IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP--TKEEIRSVAKQC 562
           +            ++ R +IG   Q  V      +  + +  T  P  T EE R      
Sbjct: 589 V-----------SQNGRLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKTDEEYR------ 631

Query: 563 FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                +  F  T    +     LLSGGQK R+A A   +  P ILILDE ++ LD     
Sbjct: 632 ---RHLGAFGITGSLSLQKM-QLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTSGID 687

Query: 623 AI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
           A+      +T G LM S  ++++S  +  + I  SEN  V   DG++ +   +
Sbjct: 688 ALVDAMKKFTGGILMVSHDISVIS--NVCNEIWVSENGTVKRFDGTIYDYRDY 738

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE T+ LDV S   I Y   + +K+   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPTNMLDVPS---IAY-LSEYLKTYPSTVLTVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa]
            {ON} highly similar to uniprot|P32568 Saccharomyces
            cerevisiae YDR011W SNQ2 ABC transporter
          Length = 1484

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 111/236 (47%), Gaps = 12/236 (5%)

Query: 444  GVIEFKDVSFSYPTRPSV-QIFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNPT 501
            GV  +KDV ++ P +    Q+  +++   APG+   ++G SG GK+T +  L  R     
Sbjct: 835  GVFLWKDVCYTIPFKGGQRQLLDNISGYCAPGTLTALMGESGAGKTTLLNTLAQRNVGII 894

Query: 502  TGTIMIDNQDITKLNCKSLRRQIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAK 560
            TG ++++   I      S  R+ G VQQ+ + +   T+R+++ +        E I    K
Sbjct: 895  TGDMLVNGSPID----ASFERRTGYVQQQDIHIKEMTVRESLQFS-ARMRRPESIPDSEK 949

Query: 561  QCFCHNFIT--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALD 617
              +    I         D ++G  G  L+  Q+++++I   L  KP +L+ LDE TS LD
Sbjct: 950  MSYVEKLIEILGMQEYADALVGDVGYGLNVEQRKKLSIGVELAAKPNLLLFLDEPTSGLD 1009

Query: 618  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMGKFKE 672
             ++  AI     +L ++    + +I    +T+  + + +++L   G  V  G   E
Sbjct: 1010 SQASWAIVQLLKKLAQAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGPIGE 1065

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 97/223 (43%), Gaps = 21/223 (9%)

Query: 462 QIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL---LRYYNPTTGTIMID---NQDITKL 515
           +I + +N    PG  + ++G  G G S+    +   +  +   TG I  D    +D+ K 
Sbjct: 159 KIIQGVNLLALPGEMILVLGRPGAGCSSFLKTISGEVDQFPEVTGDISYDGIPQKDMMKK 218

Query: 516 NCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF------IT 569
               +     +    P L   T++  + + L        + + +++ +  +       I 
Sbjct: 219 YKPDVIYNGEMDVHFPHL---TVKQTLDFALACKVPSVRVNNASRKQYIASMRELYATIF 275

Query: 570 KFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
              +TY+T +G      +SGG+++R++IA AL  + +I   D AT  LD  +  A+ Y  
Sbjct: 276 GLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDAST--ALEYAQ 333

Query: 629 G-QLMKS--KSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
             ++M +  KS  +V+I      I  + + + + +DG  +  G
Sbjct: 334 AIRIMTNLLKSTALVTIYQASENIYETFDKVTVLYDGRQIYFG 376

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 95/209 (45%), Gaps = 27/209 (12%)

Query: 466 SLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIG 525
           S+ F  + GSS+ I+GP+G GKS+I  ++   +       ++       L C        
Sbjct: 636 SIPFLNSAGSSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLSKPTEANLLC-------- 687

Query: 526 IVQQEPVLM-SGTIRDNITY----------GLTYTPTKEEIRSVAKQCFCHNFITKFPNT 574
            V Q+P     GT+RD I Y          GL      + +R V           K  + 
Sbjct: 688 -VPQKPYFTRGGTLRDQIIYPMSSDEFFDRGLKDKLLVQVLREVKLDYLLKR--DKGWSY 744

Query: 575 YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS 634
            DTV      +LSGG+KQR+  AR +  KP  ++LDEAT+A+  + E   +Y F  ++K 
Sbjct: 745 LDTV-SDWKDVLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---DYLFN-VLKR 799

Query: 635 KSMTIVSIAHRLSTIRRSENVIVLGHDGS 663
                ++I+ R S I+  + ++ +  D S
Sbjct: 800 YRFNFITISQRPSLIKYHDLLLEISDDNS 828

>ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 861

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 92/200 (46%), Gaps = 21/200 (10%)

Query: 472 APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEP 531
           + G+S+ I+GP+  GKS+I  ++   +       ++     + L C         V Q P
Sbjct: 629 STGASLLILGPNSCGKSSIQRIITEVWPVYNKNGLLSIPAPSNLFC---------VPQRP 679

Query: 532 VLM-SGTIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITK-FPNTYDTVIGPHG 583
                GT RD I Y ++           + +  + K+      + +    +Y   +    
Sbjct: 680 YFTRGGTFRDQIIYPMSSDEFFDRGLKDKNLARILKEVHLDYLLDREIGCSYMDAVADWK 739

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 643
            +LSGG+KQR+  AR L  +P  ++LDEAT+A+ V+ E   +Y F  L+K      ++I+
Sbjct: 740 DVLSGGEKQRMNFARILFHRPRFVVLDEATNAISVDME---DYLF-NLLKRYRFNFITIS 795

Query: 644 HRLSTIRRSENVIVLGHDGS 663
            R S I+  + ++ +   GS
Sbjct: 796 QRPSLIKYHDMLLEVDSSGS 815

>KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] {ON}
            similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011W SNQ2 ABC transporter
          Length = 1499

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 112/232 (48%), Gaps = 12/232 (5%)

Query: 444  GVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNPT 501
            G+  +++V ++ P R S + +  +++   APG+   ++G SG GK+T +  L  R     
Sbjct: 851  GIFIWRNVCYTIPYRGSTRRLLDNVSGYCAPGTLTALMGESGAGKTTLLNTLAQRNVGII 910

Query: 502  TGTIMIDNQDITKLNCKSLRRQIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAK 560
            TG ++++   I      S  R+ G VQQ+ V +   T+R+++ +        + +    K
Sbjct: 911  TGDMLVNGNHID----ASFERRTGYVQQQDVHVKEMTVRESLQFA-ARMRRPQSVPEAEK 965

Query: 561  QCFCHNFIT--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALD 617
              +  + I         D ++G  G  L+  Q+++++I   L  KP +L+ LDE TS LD
Sbjct: 966  MAYVEDIIEILDMEEYADALVGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLD 1025

Query: 618  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 668
             +S  AI     +L ++    + +I    +T+  + + +++L   G  V  G
Sbjct: 1026 SQSSWAIVQLMRRLAEAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1077

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/252 (20%), Positives = 100/252 (39%), Gaps = 34/252 (13%)

Query: 443 RGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL---LRYYN 499
           RG+ E K+       R +  I ++ N    PG  + ++G  G G S+    +   +  + 
Sbjct: 160 RGIREAKN-------RKTRDIVRNANILARPGEMILVLGRPGAGCSSFLKTVSGEVDNFE 212

Query: 500 PTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
              G I  D     ++  K     I   + +      T++  + + L+ T  ++ + + +
Sbjct: 213 EVRGEISYDGISQKEMMAKFKTDVIYNGETDVHFPHLTVQQTLDFALSCTTPQKRLDNAS 272

Query: 560 KQCFCHNFITKFPNTYDTVIGPHGTL-----------LSGGQKQRIAIARALIKKPTILI 608
           +      +IT     Y T+ G   T            +SGG+++R++IA AL  + +I  
Sbjct: 273 RS----EYITAMRELYGTIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALASRGSIYC 328

Query: 609 LDEATSALDVESEGAINYTFGQLMK-----SKSMTIVSIAHRLSTIRRSENVIVLGHDGS 663
            D AT  LD  +       F Q ++      KS+  V+I      I    + + +  DG 
Sbjct: 329 WDNATRGLDASTA----LEFAQAIRIMTNLQKSVAFVTIYQASENIYECFDKVTVLFDGR 384

Query: 664 VVEMGKFKELYA 675
            +  G  ++  A
Sbjct: 385 QIYYGHVEDAKA 396

>Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {ON}
           YOL075C (REAL)
          Length = 1302

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 107/247 (43%), Gaps = 33/247 (13%)

Query: 448 FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL-------LRYYNP 500
           FK+   S     + +I +S+N    PG    I+GPSG GKS++  L+       L     
Sbjct: 702 FKNWKESKLHHETKEILQSVNAVFKPGMINAIMGPSGSGKSSLLNLISGRLKSSLFAKFD 761

Query: 501 TTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTY-----------T 549
           T+GTIM ++  +++L  K++   +     + +L + T+++ + Y                
Sbjct: 762 TSGTIMFNDIQVSELMFKNVCSYVS-QDDDHLLATLTVKETLKYAAALRLHHLNEAERTE 820

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTILI 608
            T   IRS+  +  C N           +IG      +SGG+K+R+ +   L+  P IL+
Sbjct: 821 RTDNLIRSLGLK-HCEN----------NIIGNEFVKGISGGEKRRVTMGVQLLSDPPILL 869

Query: 609 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGHDGSVVE 666
           LDE TS LD  +   I      L K    T++   H  R    +R  NV++L   G    
Sbjct: 870 LDEPTSGLDSFTSATILEILENLCKEHGKTVIITIHQPRSELFKRFGNVLLLAKSGRTAF 929

Query: 667 MGKFKEL 673
            G   E+
Sbjct: 930 NGSPDEM 936

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 127/288 (44%), Gaps = 42/288 (14%)

Query: 457 TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLL-------------LRYY----N 499
           ++ +  +  S +  +  GS + ++G SG GK+T+  +L             +RY      
Sbjct: 38  SKTNTTLVNSFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLRHEGSIRYVLEDSE 97

Query: 500 PTTGTIMIDNQDI----TKLNCKSLRRQIGIV-----QQEPVLMSGTIRDNITYGLTYTP 550
           P +G    ++ D+    ++L+ +    Q  ++     QQ+ +    T R+ + +      
Sbjct: 98  PGSGYGSEESVDVKAKNSRLDGEDHHTQKHVIMAYLPQQDVLSPRLTCRETLNFA---AD 154

Query: 551 TKEEIRSVAKQCFCHNFITKFP--NTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTIL 607
            K    S  K+      I +    +  DT++G +    LSGG+K+R++I   +I  P+I+
Sbjct: 155 LKLNSSSRTKKLMVEQLIEELGLRDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIM 214

Query: 608 ILDEATSALDVESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSENVIVLGHDGSVVE 666
            LDE T+ LD  S   +  T  +L K    T I+SI    S I    + + +   G+V+ 
Sbjct: 215 FLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLSQVCILSKGNVIY 274

Query: 667 MGKFKE---LYANSTSALSQLLNERAAPGPSDQQLQIEKVEEKEDTNE 711
             K ++    + +   ++ QL+N      P+D  + +  V+ + D  E
Sbjct: 275 CDKMEKTIPYFESIGYSVPQLVN------PADYFIDLSSVDSRSDKEE 316

>NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON} 
          Length = 1531

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 119/270 (44%), Gaps = 19/270 (7%)

Query: 443  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 501
              +  ++++ +  P +  ++ I  +++  + PG+   ++G SG GK+T+   L +    T
Sbjct: 864  EAIFHWRNLCYEIPIKKEIRHILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAQ--RVT 921

Query: 502  TGTIMIDNQDITKLNCKSLRRQIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAK 560
             GTI  D      L  +S  R IG  QQ+ + L + T+R+++ +   Y     ++    K
Sbjct: 922  VGTITGDVFVNGCLRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPFDVPVEEK 980

Query: 561  QCFCHNFITKFP-NTY-DTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALD 617
              +    I      TY D V+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD
Sbjct: 981  NKYVEEIIKTLEMETYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD 1040

Query: 618  VESEGAINYTFGQLMK---SKSMTIVSIAHRLSTI--RRSENVIVLGHDGSVVEMGKFKE 672
             ++  A      QLMK        I+   H+ S I  +  + ++ L   G  V  G    
Sbjct: 1041 SQTAWAT----CQLMKKLAQNGQAILCTIHQPSAILMQNFDRLLFLQKGGETVYFGDLGS 1096

Query: 673  LYANSTSALSQLLNERAAP--GPSDQQLQI 700
                      +   E+  P   P++  LQI
Sbjct: 1097 GCQTMIDYFEKEGAEKCPPEANPAEWMLQI 1126

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 86/201 (42%), Gaps = 27/201 (13%)

Query: 439 YQPERGVIEFKDVSFSY----PTRP--SVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIAL 492
           YQ     + +K +++ Y    PTR   + QI KS++  + PG  + ++G  G G +T   
Sbjct: 140 YQATILNMPWKIITYVYRKVTPTREIDTFQILKSMDGILNPGELLVVLGRPGSGCTT--- 196

Query: 493 LLLRYYNPTTGTIMIDNQDITKLNC---KSLRRQ-----IGIVQQEPVLMSGTIRDN-IT 543
            LL+  +  T    I    I   N    K +RR      +   + +  L   T+    +T
Sbjct: 197 -LLKSISSNTHGFDISKDSIISYNGLTPKDIRRHYRGEVVYNAESDIHLPHLTVYQTLLT 255

Query: 544 YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY------DTVIGPHGTL-LSGGQKQRIAI 596
                TP+   I+ V ++ + ++       TY      DT +G      +SGG+++R++I
Sbjct: 256 VARLKTPSN-RIKDVTREDYANHLTQVTMATYGLLHTRDTKVGDDLVKGVSGGERKRVSI 314

Query: 597 ARALIKKPTILILDEATSALD 617
           A   I    +   D AT  LD
Sbjct: 315 AEVSICGSKVQCWDNATRGLD 335

>YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}
           PDR18Putative transporter of the ATP-binding cassette
           (ABC) family, implicated in pleiotropic drug resistance;
           the authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 1333

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 123/248 (49%), Gaps = 21/248 (8%)

Query: 444 GVIEFKDVSFSYP-TRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNPT 501
           GV  +K+VSF+ P +    ++  S++    PG+   ++G SG GK+T +  L  R     
Sbjct: 727 GVFIWKNVSFTIPHSSGQRKLLDSVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVGTI 786

Query: 502 TGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSG-TIRDNITYGLTY-----TPTKEEI 555
           TG +++D   +      S +R+ G VQQ+ + ++  T+++++ +          P  E++
Sbjct: 787 TGDMLVDGLPMD----ASFKRRTGYVQQQDLHVAELTVKESLQFSARMRRPQSIPDAEKM 842

Query: 556 RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATS 614
             V K       I +     + ++G  G  L+  Q+++++I   L+ KP +L+ LDE TS
Sbjct: 843 EYVEKII----SILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPTS 898

Query: 615 ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMGKFKEL 673
            LD +S  A+     +L  +    + +I    +T+  + + +++LG  G  +  G   E+
Sbjct: 899 GLDSQSAWAVVKMLKRLALAGQSILCTIHQPSATLFEQFDRLLLLGKGGQTIYFG---EI 955

Query: 674 YANSTSAL 681
             NS+S +
Sbjct: 956 GKNSSSVI 963

>AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YPL058C
            (PDR12)
          Length = 1497

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 108/237 (45%), Gaps = 15/237 (6%)

Query: 445  VIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY--NPT 501
            +  ++DV +    +   + I  +++  + PG+   ++G SG GK+T+  +L         
Sbjct: 841  IFHWRDVCYDIQIKNETRRILTNVDGWVKPGTLTALMGYSGAGKTTLLDVLANRVRVGVV 900

Query: 502  TGTIMIDNQDITKLNCKSLRRQIGIVQQEPVL-MSGTIRDNITYGLTYTPTKEEIRSVAK 560
            TG I +D      L   S +R+ G  QQ+ +   + T+RD + +   Y    + I    K
Sbjct: 901  TGNIFVDGH----LRDTSFQRKTGYCQQQDLHGRTQTVRDALKFS-AYLRQPQSISRAEK 955

Query: 561  QCFCHNFIT--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALD 617
              +  + I         D V+G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD
Sbjct: 956  NAYVEDIIKLLGMEAYADAVVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLD 1015

Query: 618  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 672
             ++  +I     +L+      + +I H+ S I   E   +++L + G  V  G   E
Sbjct: 1016 SQTAWSICQLIKKLVNHGQAILCTI-HQPSAILMQEFDRLLLLSNGGRTVYFGPLGE 1071

>NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON}
           Anc_1.427
          Length = 1060

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 115/247 (46%), Gaps = 36/247 (14%)

Query: 446 IEFKDVSFSYPT---------RPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTI--ALLL 494
           + F+++++  P+           +V++ KS++  + PG    I+G SG GK+T+   L +
Sbjct: 390 LSFENITYEVPSLNKNHKSQPNSNVKVLKSIDGIVKPGQIFAIMGGSGAGKTTLLDILAM 449

Query: 495 LRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQ-----------EPVLMSGTIRDNIT 543
            R      G I ++   +++   KS  + IG V Q           E VL S  +R  + 
Sbjct: 450 KRKTGQVGGEIKVNGNIMSR---KSYSKLIGFVDQNDYLHPTLTVYETVLNSALLR--LP 504

Query: 544 YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIK 602
             +++   +  +  + ++        +  +  D +IG      +SGG+K+R++IA  L+ 
Sbjct: 505 RTMSFESKQSRVFQILEE-------LRIFDIKDRIIGNDFERGISGGEKRRVSIACELVT 557

Query: 603 KPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR-LSTIRRSENVIVLGHD 661
            P IL LDE TS LD  +   +  +  +L K+ + T++   H+  S I    N +VL   
Sbjct: 558 SPLILFLDEPTSGLDANNANNVITSLVRLAKNYNRTLILTIHQPRSNIFNQFNKLVLLSQ 617

Query: 662 GSVVEMG 668
           G +V  G
Sbjct: 618 GEMVFSG 624

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 100/237 (42%), Gaps = 40/237 (16%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y  +    + K +N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 530 IIQLQDVSFGYDEKN--LLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGY 587

Query: 505 IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTP--TKEEIRSVAKQC 562
           +             + R +IG   Q  V      +  + +     P  T EE R      
Sbjct: 588 V-----------SSNGRLRIGYFTQHHVDSMDLTKSAVDWMSVKYPGKTDEEYR------ 630

Query: 563 FCHNFITKFPNTYDTVIGPHG----TLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
                +  F      + G  G     LLSGGQK R+A A   +  P IL+LDE ++ LD 
Sbjct: 631 ---RHLGSF-----GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDN 682

Query: 619 ESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
               A+     N++ G LM S  ++++        I  SEN  V   DG++ +   +
Sbjct: 683 TGLDALVESLKNFSGGVLMVSHDISVIDSV--CKEIWVSENGTVRRFDGTIHDYKDY 737

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 367 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTLLVVSHD 422

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 423 RAFLNEVATDIIYQHN 438

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 106/234 (45%), Gaps = 23/234 (9%)

Query: 450  DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY--YNPTTGTIMI 507
            DV     TR   +I  +++  + PG+   ++G SG GK+T+   L         TG + I
Sbjct: 901  DVQIKTETR---RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFI 957

Query: 508  DNQDITKLNCKSLRRQIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
            D     K   +S  R IG  QQ+ + L + T+R+++ +   Y     E+    K  +  +
Sbjct: 958  DG----KPRDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVED 1012

Query: 567  FIT--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALDVESEGA 623
             I   +     D ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  A
Sbjct: 1013 IIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWA 1072

Query: 624  INYTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 672
            I     QLM+   ++   I+   H+ S I   E   ++ +   G     G+  E
Sbjct: 1073 I----CQLMRKLCNQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1122

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 107/239 (44%), Gaps = 15/239 (6%)

Query: 443  RGVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY--YN 499
              +  ++D+ +    +   + I  +++  + PG+   ++G SG GK+T+   L       
Sbjct: 866  EAIFHWRDLCYDVQIKDETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMG 925

Query: 500  PTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSV 558
              TG I +D         +S  R IG  QQ+ + L + T+R+++ +   Y    +E+   
Sbjct: 926  VITGDIFVDGLPRN----ESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPKEVSVE 980

Query: 559  AKQCFCHNFIT--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSA 615
             K  +    I   +     D ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS 
Sbjct: 981  EKNAYVEEIIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSG 1040

Query: 616  LDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 672
            LD ++  AI     +L K     + +I H+ S I   E   ++ +   G  V  G+  E
Sbjct: 1041 LDSQTAWAICQLMKKLCKHGQAILCTI-HQPSAILMQEFDRLLFMQKGGKTVYFGELGE 1098

>CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 aa]
           {ON} highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036c ARB1
          Length = 720

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/272 (22%), Positives = 112/272 (41%), Gaps = 56/272 (20%)

Query: 372 YGSYLVLQSQLSIGDLTAFMLYTEYTGN--AVFGLSTFYSEIMQGAGAASRLFELTDRKP 429
           Y SY+  +++L    +  +    E   +       +  Y+ +++ A +  ++ +  +   
Sbjct: 418 YDSYIKTRTELETNQMKQYNKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADG 477

Query: 430 SISPTV-----GHKYQP-ER---GVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 480
            I P V       ++ P ER    V+ F D+SF+Y   P   +++ LNF +   S   +V
Sbjct: 478 LIQPVVPDRVFSFRFPPVERLPPPVLAFDDISFAYDGNPENNLYEHLNFGVDMDSRTALV 537

Query: 481 GPSGRGKSTIALLLLRYYNPTTGTI--------------MIDNQDITKLNCKSLRRQIGI 526
           GP+G GKST+  ++     P +G +                D  D+TK   + +R +   
Sbjct: 538 GPNGVGKSTLLKIMTGELMPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSN 597

Query: 527 VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
           + Q+     G +     YGLT    K ++                           GT L
Sbjct: 598 ISQDFQYWRGQLG---RYGLTGDAQKVQM---------------------------GT-L 626

Query: 587 SGGQKQRIAIARALIKKPTILILDEATSALDV 618
           S GQ+ R+  A   ++ P +L+LDE T+ LD+
Sbjct: 627 SEGQRSRVVFALLALENPNVLLLDEPTNGLDI 658

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+   +     + +K    T+V ++H
Sbjct: 337 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 391

>KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] {ON} 
          Length = 1501

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 127/273 (46%), Gaps = 30/273 (10%)

Query: 444  GVIEFKDVSFSYPTRPSVQ-IFKSLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNPT 501
            GV  ++DV F+ P     + +  +++    PG+   ++G SG GK+T +  L  R     
Sbjct: 851  GVFIWRDVCFTIPYDGGQRRLLDNVSGYCIPGTMTALMGESGAGKTTLLNTLAQRNVGVI 910

Query: 502  TGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSG-TIRDNITYGL-----TYTPTKEEI 555
            TG ++++   I      S  R+ G VQQ+ + ++  T+R+++ +        + P  E++
Sbjct: 911  TGDMLVNGHPID----TSFERRTGYVQQQDIHIAEMTVRESLRFSARMRRPQHIPDAEKL 966

Query: 556  RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATS 614
              V K     N         + ++G  G+ L+  Q+++++I   L  KP +L+ LDE TS
Sbjct: 967  DYVEKIIQVLN----MEEYAEALVGALGSGLNVEQRKKLSIGVELAAKPDLLLFLDEPTS 1022

Query: 615  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMGKFKEL 673
             LD +S  AI     +L  S    + +I    +T+  +