Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.473na 1ON60660627890.0
YPL265W (DIP5)na 1ON60860626870.0
Skud_16.12na 1ON60760726020.0
Suva_16.40na 1ON60660625770.0
NCAS0D02260na 1ON59759120600.0
NDAI0I02660na 1ON59459020430.0
TPHA0M00130singletonON61157819670.0
Kpol_358.3na 1ON57553719450.0
TBLA0A07060na 1ON62552719270.0
SAKL0G14916gna 1ON58153519150.0
CAGL0A01199gna 1ON61353619100.0
Kwal_33.15545na 1ON57653518530.0
KAFR0B06430singletonON59353818530.0
KNAG0L02460singletonON58853518510.0
KLTH0B01166gna 1ON57753518110.0
KLLA0E16281gna 1ON60553418070.0
Ecym_2480na 1ON58653718000.0
KNAG0L02470singletonON63852317050.0
ACL135Wna 1ON58853816710.0
ZYRO0D17908gna 1ON5185178991e-113
Ecym_80357.44ON5634958811e-110
SAKL0B10956g7.44ON5725868741e-109
Ecym_10871.83ON5705198651e-108
YOR348C (PUT4)7.44ON6276098661e-107
SAKL0C02662g1.83ON5485358571e-107
SAKL0C02640gsingletonON5485178571e-107
Smik_5.241.83ON5905148581e-106
NCAS0E022607.44ON5935398581e-106
CAGL0J08184g1.83ON5725238561e-106
Kwal_26.69407.44ON5705428521e-106
TDEL0A08030singletonON5144908471e-106
NDAI0A006101.83ON5655088441e-105
KLLA0C02343g1.83ON5814898421e-104
Kpol_2000.641.84ON6105188441e-104
Suva_5.41.83ON5905188421e-104
YEL063C (CAN1)1.83ON5905148421e-104
KLTH0F02398g1.83ON5555208381e-104
Skud_5.261.83ON5905148401e-104
Smik_15.5327.44ON6315718431e-104
CAGL0J08162g1.84ON5975148401e-104
Skud_14.701.83ON5735698381e-104
NDAI0F041901.84ON5995148351e-103
NCAS0A006001.83ON5445298311e-103
CAGL0E05632g7.44ON5985188351e-103
TDEL0H040707.44ON5775278321e-103
TDEL0C061701.84ON5734918261e-102
KNAG0F004801.84ON5975278281e-102
KNAG0C05920singletonON5995108271e-102
TPHA0H028507.44ON6015328271e-102
Skud_15.5157.44ON6265578281e-102
TBLA0A054601.84ON6085098241e-101
Suva_8.4027.44ON6835318291e-101
KLTH0D01474g7.44ON6245318231e-101
Skud_14.711.84ON6125148191e-100
TBLA0A054501.83ON6064908171e-100
SAKL0F09790gsingletonON5585328131e-100
Ecym_10881.84ON5675188131e-100
TDEL0C061801.83ON5835208131e-100
Smik_14.681.84ON6115118141e-100
KAFR0D039401.83ON5975208121e-100
AFR156W7.44ON5585348071e-99
SAKL0C02728g1.84ON5624868072e-99
KNAG0E003907.44ON5995388083e-99
NDAI0E038007.44ON6215048103e-99
NDAI0F042001.83ON5665168063e-99
YNL270C (ALP1)1.83ON5735178064e-99
TPHA0B044701.84ON5995178066e-99
YNL268W (LYP1)1.84ON6115148077e-99
ZYRO0F16654g1.83ON5805178012e-98
Suva_14.751.84ON6115148042e-98
AFR668W1.83ON5564877983e-98
SAKL0C02684gsingletonON5884898013e-98
Smik_14.671.83ON5735167985e-98
Kwal_33.134011.83ON5595197941e-97
ZYRO0F16632g1.84ON6075377981e-97
NCAS0B085701.83ON5325097912e-97
KLLA0C02365g1.84ON5795197901e-96
Suva_14.731.83ON4974847821e-96
Kpol_2000.651.83ON5954917901e-96
KAFR0D007001.83ON5745007882e-96
Kpol_367.77.44ON5845377882e-96
Suva_13.517singletonON5475037852e-96
KLTH0F02420g1.84ON6215197861e-95
TPHA0B044801.83ON6035017823e-95
NCAS0A006101.84ON6075097814e-95
Kwal_23.4026singletonON5344947754e-95
KNAG0C007901.83ON5795137794e-95
Smik_6.482na 2ON5585097759e-95
Kwal_33.134111.84ON5605187697e-94
TDEL0E05750singletonON5485017625e-93
KLLA0F23419g7.44ON5735407551e-91
TBLA0C01240singletonON6295237582e-91
AFR667C1.84ON5635197453e-90
Kwal_8.590na 3ON6295287354e-88
KLTH0A00308gsingletonON5415017181e-86
Skud_16.2na 2ON4964577133e-86
NDAI0D021605.158ON5875397151e-85
ZYRO0D03762g1.244ON6005307116e-85
KAFR0C051607.44ON5845477098e-85
SAKL0F16544gsingletonON5675167035e-84
KLTH0B00154gna 3ON5565147017e-84
KAFR0E018505.158ON5605187001e-83
KLTH0F04048gsingletonON5835197021e-83
KLLA0B14685gna 4ON5715306913e-82
ZYRO0C18502g7.44ON5755616896e-82
CAGL0K05753g1.50ON6605276895e-81
Kpol_2000.921.50ON6375266876e-81
Smik_16.1155.158ON6035216846e-81
CAGL0B03773g5.158ON6055026831e-80
NCAS0B079001.244ON6195146822e-80
Skud_7.5255.158ON6035336812e-80
SAKL0G14014g5.158ON6055386803e-80
YGR191W (HIP1)5.158ON6035026803e-80
Kwal_23.2817na 4ON5805696783e-80
KAFR0C004003.284ON5825246775e-80
Kwal_27.126811.244ON5935306751e-79
KAFR0D00510na 5ON6175366742e-79
SAKL0D02970g3.284ON6015276732e-79
KNAG0C02140singletonON5985216732e-79
NDAI0B052201.244ON6115296733e-79
Ecym_26643.285ON5755296703e-79
TDEL0C00930singletonON5955086714e-79
Skud_11.2751.244ON6025136706e-79
Ecym_47895.158ON5885106698e-79
YBR068C (BAP2)3.284ON6095246691e-78
Suva_2.6881.50ON6615306721e-78
Suva_7.4855.158ON6035196681e-78
YCL025C (AGP1)1.50ON6335296702e-78
Smik_3.531.50ON6335256683e-78
Kpol_1010.325.158ON5995206653e-78
KLLA0A06886gsingletonON5875166643e-78
SAKL0D02926g3.285ON5835316644e-78
Suva_11.2731.244ON6015136644e-78
SAKL0C01232gsingletonON6135316648e-78
YDR508C (GNP1)1.50ON6635296669e-78
TPHA0B010901.244ON6065296621e-77
SAKL0D04664g1.244ON5935146611e-77
TPHA0A002405.158ON6035346611e-77
Skud_3.381.50ON6335256631e-77
NCAS0D018705.158ON5955156602e-77
TBLA0A051801.50ON6765276643e-77
NCAS0I015303.284ON5955276583e-77
KAFR0D005001.50ON6175316593e-77
Ecym_60211.244ON6005156584e-77
NDAI0C029505.158ON6095196594e-77
NCAS0A106803.284ON5935256565e-77
KLLA0A11770g5.158ON5815306549e-77
TPHA0A047005.158ON5695016539e-77
KNAG0G009005.158ON6135376561e-76
Kpol_543.791.244ON6055216551e-76
KAFR0D04120na 6ON6485296581e-76
NCAS0A071105.158ON5925046531e-76
Suva_3.1891.50ON6335216562e-76
TPHA0E036601.50ON6475266553e-76
KNAG0J022003.284ON6075346523e-76
KNAG0C005901.50ON6345106534e-76
Smik_4.7901.50ON6635306554e-76
KAFR0A011203.284ON5925336504e-76
Suva_4.3073.284ON6095216514e-76
CAGL0B01012g1.50ON6235696516e-76
Skud_2.1913.284ON6095306507e-76
KNAG0H011503.284ON6175186491e-75
Smik_11.3021.244ON5534796432e-75
Skud_4.7841.50ON6635276502e-75
KLTH0F01606gna 6ON6045276453e-75
NDAI0F043901.50ON6675056493e-75
TDEL0D00200singletonON5674886415e-75
Suva_2.716singletonON6035166428e-75
KLTH0E15642g1.244ON5965266402e-74
AGR040C3.285ON5735276363e-74
CAGL0H08393g3.284ON6125286375e-74
Kpol_1052.163.284ON6135256367e-74
TBLA0B077605.158ON6585456397e-74
KLTH0B02046g5.158ON5895226357e-74
TPHA0M012003.284ON6075206351e-73
Smik_2.2013.284ON6095326351e-73
YKR039W (GAP1)1.244ON6025176341e-73
Kpol_1065.133.284ON5965236331e-73
SAKL0D00836gna 7ON6015176304e-73
YDR046C (BAP3)3.284ON6045256304e-73
KNAG0F002701.50ON6345326325e-73
Kpol_526.103.397ON5805066285e-73
KLLA0A06930g1.244ON5875156278e-73
NDAI0A056203.284ON5715256268e-73
Kwal_33.13215na 6ON5985256271e-72
KAFR0D00520na 6ON5985236271e-72
SAKL0C01650g1.50ON6135266272e-72
CAGL0L07546g3.284ON6345326282e-72
Skud_4.3003.284ON6045246252e-72
AGR039Cna 8ON5865356225e-72
NDAI0A006401.50ON6415076255e-72
TBLA0I020103.285ON6285046246e-72
TPHA0B047501.50ON6395246248e-72
NDAI0A074903.284ON5965276218e-72
Smik_4.2843.284ON6045336201e-71
KAFR0D04130na 5ON6445076222e-71
Suva_2.2033.284ON6045246192e-71
KLLA0C01606g1.50ON6205226202e-71
Kwal_27.105383.284ON6025216182e-71
TDEL0C065101.50ON6425286203e-71
NDAI0G060301.368ON5995406173e-71
AFR698C1.50ON6095306165e-71
AGR319W5.158ON6265286175e-71
KAFR0D041401.50ON6375266176e-71
Kwal_33.154075.158ON5875196139e-71
Kpol_543.78singletonON6055186131e-70
KLTH0C05170g3.284ON5985396121e-70
SAKL0D02948gna 8ON5945286122e-70
CAGL0L03267g1.244ON5975326112e-70
NCAS0A089201.368ON5995406094e-70
AAR038W3.397ON5665046059e-70
TBLA0A05190na 6ON6675286091e-69
Kpol_1052.143.285ON6025106052e-69
Smik_2.2023.285ON6175306062e-69
NCAS0B085801.50ON6275356053e-69
Kwal_33.132041.50ON6075326043e-69
Suva_4.3813.397ON5905056023e-69
Skud_2.1923.285ON6195046026e-69
AFR230C1.244ON6045186001e-68
Kwal_26.9612singletonON5435295942e-68
KLLA0A10813g1.368ON5845295953e-68
YBR132C (AGP2)3.397ON5965185947e-68
SAKL0C13992gsingletonON5525265907e-68
AGR038C3.284ON5805315929e-68
KLTH0F01584g1.50ON5965245893e-67
Kwal_33.14276na 7ON5965135893e-67
KNAG0J022103.285ON5815215883e-67
Smik_15.1461.368ON5935455875e-67
Smik_2.2723.397ON5975085876e-67
ZYRO0G12342g3.284ON6205235896e-67
TDEL0F02830na 9ON5615275848e-67
YOL020W (TAT2)1.368ON5925305868e-67
TBLA0C012101.368ON6005305869e-67
ZYRO0F13838g8.342ON8365585962e-66
Suva_4.3083.285ON6185445842e-66
Ecym_26623.284ON5895805823e-66
Kpol_534.221.368ON5925295823e-66
Kpol_2002.441.50ON6275235835e-66
Skud_15.1381.368ON5925455805e-66
ZYRO0F17446g1.50ON6335235835e-66
TDEL0C053403.397ON5755625795e-66
TPHA0A039603.284ON6155265815e-66
TDEL0E05700singletonON5845245796e-66
SAKL0B08734g3.397ON5585185761e-65
CAGL0D02178g1.368ON5775445762e-65
AEL030W1.368ON5825325762e-65
Skud_2.2603.397ON5985065762e-65
YLL061W (MMP1)na 10ON5835185743e-65
TBLA0I020003.284ON6645325784e-65
NCAS0A004201.50ON6795345794e-65
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.473
         (606 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...  1078   0.0  
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...  1039   0.0  
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...  1006   0.0  
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   997   0.0  
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              798   0.0  
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   791   0.0  
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     762   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   753   0.0  
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   746   0.0  
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   742   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   740   0.0  
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   718   0.0  
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   718   0.0  
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             717   0.0  
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   702   0.0  
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   700   0.0  
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   697   0.0  
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             661   0.0  
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   648   0.0  
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   350   e-113
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   343   e-110
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   341   e-109
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   337   e-108
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   338   e-107
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   334   e-107
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   334   e-107
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   335   e-106
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     335   e-106
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   334   e-106
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   332   e-106
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            330   e-106
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   329   e-105
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   328   e-104
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   329   e-104
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   328   e-104
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   328   e-104
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   327   e-104
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   328   e-104
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   329   e-104
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   328   e-104
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   327   e-104
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   326   e-103
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   324   e-103
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   326   e-103
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   325   e-103
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   322   e-102
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                323   e-102
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            323   e-102
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   323   e-102
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   323   e-102
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   322   e-101
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   323   e-101
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   321   e-101
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   320   e-100
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   319   e-100
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   317   e-100
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   317   e-100
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   317   e-100
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   318   e-100
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   317   e-100
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   315   1e-99
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   315   2e-99
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   315   3e-99
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     316   3e-99
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            315   3e-99
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   315   4e-99
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   315   6e-99
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   315   7e-99
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   313   2e-98
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   314   2e-98
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   311   3e-98
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   313   3e-98
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   311   5e-98
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   310   1e-97
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   311   1e-97
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            309   2e-97
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   308   1e-96
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   305   1e-96
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   308   1e-96
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   308   2e-96
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   308   2e-96
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   306   2e-96
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   307   1e-95
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   305   3e-95
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              305   4e-95
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   303   4e-95
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              304   4e-95
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   303   9e-95
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   300   7e-94
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            298   5e-93
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   295   1e-91
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   296   2e-91
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   291   3e-90
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   287   4e-88
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   281   1e-86
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   279   3e-86
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    280   1e-85
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   278   6e-85
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   277   8e-85
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   275   5e-84
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   274   7e-84
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   274   1e-83
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   275   1e-83
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   270   3e-82
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   270   6e-82
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   270   5e-81
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   269   6e-81
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   268   6e-81
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   267   1e-80
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   267   2e-80
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   266   2e-80
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   266   3e-80
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   266   3e-80
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   265   3e-80
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                265   5e-80
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   264   1e-79
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      264   2e-79
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   263   2e-79
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   263   2e-79
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   263   3e-79
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   262   3e-79
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   263   4e-79
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   262   6e-79
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   262   8e-79
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   262   1e-78
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   263   1e-78
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   261   1e-78
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   262   2e-78
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   261   3e-78
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   260   3e-78
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   260   3e-78
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   260   4e-78
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   260   4e-78
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   260   8e-78
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   261   9e-78
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   259   1e-77
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   259   1e-77
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   259   1e-77
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   259   1e-77
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   258   2e-77
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   260   3e-77
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              258   3e-77
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      258   3e-77
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   258   4e-77
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    258   4e-77
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   257   5e-77
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   256   9e-77
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   256   9e-77
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   257   1e-76
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   256   1e-76
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   258   1e-76
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   256   1e-76
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   257   2e-76
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   256   3e-76
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   255   3e-76
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   256   4e-76
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   256   4e-76
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   254   4e-76
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   255   4e-76
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   255   6e-76
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   254   7e-76
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              254   1e-75
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   252   2e-75
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   254   2e-75
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   253   3e-75
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   254   3e-75
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                251   5e-75
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   251   8e-75
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   251   2e-74
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   249   3e-74
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   249   5e-74
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   249   7e-74
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   250   7e-74
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   249   7e-74
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   249   1e-73
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   249   1e-73
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   248   1e-73
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   248   1e-73
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   247   4e-73
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   247   4e-73
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   248   5e-73
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   246   5e-73
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   246   8e-73
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            245   8e-73
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   246   1e-72
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   246   1e-72
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   246   2e-72
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   246   2e-72
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   245   2e-72
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   244   5e-72
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   245   5e-72
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   244   6e-72
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   244   8e-72
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   243   8e-72
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   243   1e-71
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              244   2e-71
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   243   2e-71
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   243   2e-71
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   242   2e-71
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   243   3e-71
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   242   3e-71
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   241   5e-71
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   242   5e-71
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              242   6e-71
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   240   9e-71
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   240   1e-70
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   240   1e-70
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   240   2e-70
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   239   2e-70
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   239   4e-70
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   237   9e-70
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   239   1e-69
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   237   2e-69
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   238   2e-69
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   237   3e-69
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   237   3e-69
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   236   3e-69
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   236   6e-69
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   235   1e-68
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   233   2e-68
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   233   3e-68
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   233   7e-68
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   231   7e-68
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   232   9e-68
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   231   3e-67
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   231   3e-67
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   231   3e-67
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   230   5e-67
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   230   6e-67
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   231   6e-67
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   229   8e-67
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   230   8e-67
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   230   9e-67
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   234   2e-66
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   229   2e-66
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   228   3e-66
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   228   3e-66
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   229   5e-66
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   228   5e-66
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   229   5e-66
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   227   5e-66
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              228   5e-66
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   227   6e-66
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   226   1e-65
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   226   2e-65
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   226   2e-65
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   226   2e-65
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   225   3e-65
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   227   4e-65
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   227   4e-65
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   225   4e-65
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   224   8e-65
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              226   9e-65
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   223   1e-64
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   223   4e-64
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   222   5e-64
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   221   6e-64
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   221   9e-64
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   222   1e-63
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   221   1e-63
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    219   1e-63
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   220   1e-63
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   221   2e-63
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   221   2e-63
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    220   2e-63
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   223   1e-62
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   218   2e-62
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   223   2e-62
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   218   2e-62
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   222   2e-62
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   218   3e-62
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   221   5e-62
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   218   5e-62
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   217   5e-62
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      216   7e-62
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   215   1e-61
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   213   1e-61
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   213   2e-61
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   215   2e-61
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   214   3e-61
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   213   4e-61
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   213   7e-61
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   214   8e-61
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   212   3e-60
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   211   7e-60
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   211   9e-60
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   215   9e-60
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   214   2e-59
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   214   2e-59
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                209   4e-59
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   209   4e-59
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   213   4e-59
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   208   6e-59
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   207   8e-59
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   207   1e-58
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   207   1e-58
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   207   2e-58
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      206   2e-58
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   211   2e-58
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   205   4e-58
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   205   6e-58
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   204   6e-58
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   205   6e-58
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   205   7e-58
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   205   9e-58
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              204   2e-57
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              203   2e-57
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   208   3e-57
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   204   3e-57
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   207   4e-57
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   203   4e-57
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                203   5e-57
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              203   5e-57
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   201   2e-56
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   201   3e-56
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   205   3e-56
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   201   5e-56
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   199   6e-56
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   200   6e-56
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   200   1e-55
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   198   3e-55
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   200   2e-54
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   194   9e-54
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      190   2e-52
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              190   5e-52
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   189   8e-52
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   189   7e-51
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   189   2e-50
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   188   2e-50
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   187   7e-50
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   185   3e-49
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   172   4e-45
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   169   7e-45
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   168   1e-44
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     162   3e-44
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     162   4e-44
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   164   4e-43
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         120   3e-29
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   111   5e-27
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      97   1e-21
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          94   5e-21
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     95   2e-20
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      76   4e-16
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          75   7e-15
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    61   3e-10
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      49   3e-06
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              48   1e-05
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    47   6e-05
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    40   0.012
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    39   0.027
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    38   0.100
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    37   0.11 
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    37   0.13 
TBLA0G00720 Chr7 complement(163147..164988) [1842 bp, 613 aa] {O...    37   0.17 
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    37   0.23 
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    36   0.25 
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    36   0.27 
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    36   0.36 
ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {...    35   0.39 
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    35   0.52 
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              33   0.72 
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    34   1.1  
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    34   1.2  
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    33   2.2  
Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {...    33   2.7  
Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON...    32   3.9  
TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.2...    32   4.0  
NCAS0A04090 Chr1 (825742..827172) [1431 bp, 476 aa] {ON} Anc_2.407     32   5.0  
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    32   5.3  
NDAI0E01810 Chr5 (359926..361353) [1428 bp, 475 aa] {ON} Anc_2.407     32   5.6  
NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {O...    32   6.7  
YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}  ...    32   6.9  
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    32   7.4  
KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {O...    32   7.6  
YDR180W Chr4 (821295..825776) [4482 bp, 1493 aa] {ON}  SCC2Subun...    31   9.6  
CAGL0E04004g Chr5 complement(383622..385205) [1584 bp, 527 aa] {...    31   9.8  

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score = 1078 bits (2789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/606 (88%), Positives = 539/606 (88%)

Query: 1   MPLKKMFTXXXXXXXXXLENDHDAYYSKQDADNFPVKEQEIYNIDLEENNVXXXXXXXXX 60
           MPLKKMFT         LENDHDAYYSKQDADNFPVKEQEIYNIDLEENNV         
Sbjct: 1   MPLKKMFTSASSRNSSSLENDHDAYYSKQDADNFPVKEQEIYNIDLEENNVSSRSSTSTS 60

Query: 61  XXXXXXXFAIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLI 120
                  FAIADGKDENTRLKKELKARHISM                       PVAMLI
Sbjct: 61  PSARDDSFAIADGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLI 120

Query: 121 AYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL 180
           AYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL
Sbjct: 121 AYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL 180

Query: 181 TAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXX 240
           TAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFK         
Sbjct: 181 TAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLIL 240

Query: 241 XXXXXXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIEL 300
                     PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIEL
Sbjct: 241 LLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIEL 300

Query: 301 TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA 360
           TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA
Sbjct: 301 TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA 360

Query: 361 SPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSK 420
           SPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSK
Sbjct: 361 SPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSK 420

Query: 421 WGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR 480
           WGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR
Sbjct: 421 WGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR 480

Query: 481 AQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI 540
           AQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI
Sbjct: 481 AQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI 540

Query: 541 LSWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEK 600
           LSWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEK
Sbjct: 541 LSWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEK 600

Query: 601 FLGRIF 606
           FLGRIF
Sbjct: 601 FLGRIF 606

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score = 1039 bits (2687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/606 (84%), Positives = 530/606 (87%)

Query: 1   MPLKKMFTXXXXXXXXXLENDHDAYYSKQDADNFPVKEQEIYNIDLEENNVXXXXXXXXX 60
           MPLKKMFT         L++DHDAYYSKQ+ DNFPVKEQEIYNIDLEENNV         
Sbjct: 3   MPLKKMFTSTSPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVSSRSSTSTS 62

Query: 61  XXXXXXXFAIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLI 120
                  FA+ DGKDENTRL+K+LKARHISM                       PVAMLI
Sbjct: 63  PSARDDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLI 122

Query: 121 AYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL 180
           AYAFVGLLVF+TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL
Sbjct: 123 AYAFVGLLVFYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL 182

Query: 181 TAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXX 240
           TAAALVIQYWISRDRVNPGVWITIFLVVIVAIN+VGVKFFGEFEFWLSSFK         
Sbjct: 183 TAAALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLIL 242

Query: 241 XXXXXXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIEL 300
                     P+HDRLGFRYWRDPGAFKEYSTAITG  GKF SFVAVFVYSLFSYTGIEL
Sbjct: 243 LLFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIEL 302

Query: 301 TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA 360
           TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA
Sbjct: 303 TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA 362

Query: 361 SPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSK 420
           SPFVVAIQNSGI+VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTS+
Sbjct: 363 SPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSR 422

Query: 421 WGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR 480
           WGVPYNALILSVLFC LAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR
Sbjct: 423 WGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR 482

Query: 481 AQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI 540
           AQGIDKSKFAYVAPGQRYGAYFAL FCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI
Sbjct: 483 AQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI 542

Query: 541 LSWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEK 600
           +SWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGR+KDQE+EERL+ NGKNMEWFYEK
Sbjct: 543 ISWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEK 602

Query: 601 FLGRIF 606
           FLG IF
Sbjct: 603 FLGNIF 608

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score = 1006 bits (2602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/607 (81%), Positives = 521/607 (85%), Gaps = 1/607 (0%)

Query: 1   MPLKKMFTXXXX-XXXXXLENDHDAYYSKQDADNFPVKEQEIYNIDLEENNVXXXXXXXX 59
           M LK + T          L++D DAYYSKQ+ D+FPVKEQEIYNIDLEENNV        
Sbjct: 1   MSLKNVLTSAASPRNSSSLDSDRDAYYSKQNPDSFPVKEQEIYNIDLEENNVSSRSSTFT 60

Query: 60  XXXXXXXXFAIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAML 119
                   FA+ DGKDE TRL+K+LKARHISM                       PVAML
Sbjct: 61  SPSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAML 120

Query: 120 IAYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQ 179
           IAYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQ
Sbjct: 121 IAYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQ 180

Query: 180 LTAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXX 239
           LTAAALVIQYW+SRDRVNPGVWITIF+VVIVAIN++GVKFFGEFEFWLSSFK        
Sbjct: 181 LTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLI 240

Query: 240 XXXXXXXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIE 299
                      PDHDRLGFRYWRDPGAFKEYS AI G  GKF SF+AVFVYSLFSYTGIE
Sbjct: 241 LLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIE 300

Query: 300 LTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAA 359
           LTGIVCSEA+NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRL+STKGK++SAA
Sbjct: 301 LTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAA 360

Query: 360 ASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTS 419
           ASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIF+KT+
Sbjct: 361 ASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTN 420

Query: 420 KWGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC 479
           KWGVPYNALI SVLFCCLAYMNVS+GSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC
Sbjct: 421 KWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC 480

Query: 480 RAQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVY 539
           RAQGIDKSKFAYVAPGQRYGAYFAL FCI IALIKNFTVFLGHKFDYKTFITGYIGLPVY
Sbjct: 481 RAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVY 540

Query: 540 ILSWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYE 599
           + SW GYKLIYKTKVIKSTDVDLYTFKEIYDREEE+G+I+DQE+EERL++NGKNMEWFYE
Sbjct: 541 VFSWVGYKLIYKTKVIKSTDVDLYTFKEIYDREEEQGKIEDQEKEERLKKNGKNMEWFYE 600

Query: 600 KFLGRIF 606
           KFLG IF
Sbjct: 601 KFLGHIF 607

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/606 (80%), Positives = 514/606 (84%)

Query: 1   MPLKKMFTXXXXXXXXXLENDHDAYYSKQDADNFPVKEQEIYNIDLEENNVXXXXXXXXX 60
           M LKKM T         L+ND D Y  KQ+ D FPVKEQEIYNIDLEENNV         
Sbjct: 1   MSLKKMLTSASSRNSSSLDNDRDGYSMKQNPDKFPVKEQEIYNIDLEENNVSSRSSTSTS 60

Query: 61  XXXXXXXFAIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLI 120
                  FA+ DGKDE TRL+K+LKARHISM                       PV+MLI
Sbjct: 61  PSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLI 120

Query: 121 AYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL 180
           AY FVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL
Sbjct: 121 AYGFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL 180

Query: 181 TAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXX 240
           TAAALVIQYW+SRDRVNPGVWITIFLVVIVAINIVGV+FFGEFEFWLSSFK         
Sbjct: 181 TAAALVIQYWVSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLIL 240

Query: 241 XXXXXXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIEL 300
                     PDHDRLGFRYWRDPGAFKEYSTAITGS GKF +F +VFVYSLFSYTGIEL
Sbjct: 241 LLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIEL 300

Query: 301 TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA 360
           TGIVCSEA+NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGK+MSAAA
Sbjct: 301 TGIVCSEAKNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAA 360

Query: 361 SPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSK 420
           SPFVVAIQNSGIKVLPHIFN CVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSK
Sbjct: 361 SPFVVAIQNSGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSK 420

Query: 421 WGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR 480
           WGVPY AL++SVLFCCLAYMNVS+GSAKIFNYFVNVVSMFGILSWITILIVYIYFD+ACR
Sbjct: 421 WGVPYYALMVSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACR 480

Query: 481 AQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI 540
           AQG+DKSKFAYVAPGQRYGAYFAL FCILIALIKNFTVFLGH FDYKTFITGYIGLP+Y+
Sbjct: 481 AQGVDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYV 540

Query: 541 LSWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEK 600
            SW GYKLIYKTKV+K  D DLYT KEIYDREEE+G+++DQE+EERLQRNGKN+EWFYEK
Sbjct: 541 FSWVGYKLIYKTKVVKPADADLYTLKEIYDREEEQGKLQDQEKEERLQRNGKNLEWFYEK 600

Query: 601 FLGRIF 606
           FLG IF
Sbjct: 601 FLGNIF 606

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/591 (66%), Positives = 458/591 (77%), Gaps = 9/591 (1%)

Query: 19  ENDHDAYYSKQ---DADNFPVKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAIADGKD 75
            + ++ Y+  Q   D+  FP +E+E+ + DLE NN+                    DGK 
Sbjct: 13  SDRYEEYFDPQKKVDSKTFPTQERELLHDDLE-NNISLSTSAEDQNDSYN-----VDGKT 66

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           E TRLKK L+ R +SM                       PV+MLIAYAFVGLLVFFTMA 
Sbjct: 67  EGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMAS 126

Query: 136 LGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
           LGEMASYIPLDGFTSYA+RY DPALGFA+GY YLFKYFILPPNQLTAAALVIQYWI R++
Sbjct: 127 LGEMASYIPLDGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREK 186

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
           VNPGVWITIFLVVIVAIN +GV+FFGEFEFWLSSFK                   P+HDR
Sbjct: 187 VNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDR 246

Query: 256 LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 315
           LGFR+W+ PGAF  YS AITG TGKF +FV+VFVY+ F+Y G EL GIV  EA NPRKSV
Sbjct: 247 LGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSV 306

Query: 316 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVL 375
           PKAIKLT+YRII+FYL ++ LLGMCV Y+DP LL  K KS SAAASPFVVAI NSGIKVL
Sbjct: 307 PKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVL 366

Query: 376 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFC 435
           PHIFNACVLVFVFSACNSDLYV+SR+LY+LAID KAPKIFA+T++WG+PY +L LSVLFC
Sbjct: 367 PHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFC 426

Query: 436 CLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 495
            LAYM+VSSGSAKIFNYFVNVVS+FG+LSWI IL+ Y+ FD+A RAQGIDKS F+YVAPG
Sbjct: 427 LLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPG 486

Query: 496 QRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKVI 555
           QRYGAYFAL FC LIALIKNFTVFLGH+FDYKTFITGYIG+PV+ +S+ GYKLIYKTK+I
Sbjct: 487 QRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKLIYKTKII 546

Query: 556 KSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606
              +VDLYTFK   D+EEE+G+++D  R+ER++ NG+N EWFY+KFL  IF
Sbjct: 547 DPLEVDLYTFKAAIDQEEEDGKLEDIARKERIKANGRNFEWFYDKFLSNIF 597

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/590 (66%), Positives = 453/590 (76%), Gaps = 9/590 (1%)

Query: 19  ENDHDAYYSKQDADNF--PVKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAIADGKDE 76
            + ++ Y+ +     F  P++E+E+ N DLE N                  + I DGK E
Sbjct: 12  SDQYEEYFEQLPKKEFKLPIQEEELINDDLERN------ISSASSQDENDSYNI-DGKTE 64

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
            TRLKK LKARH+SM                       PV+ LIAYAFVGLLVFFTMACL
Sbjct: 65  GTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMACL 124

Query: 137 GEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRV 196
           GEMA+YIPLDGFTSYASRY DPALGFA+GY YLFKYFILPPNQLTAAALVIQYW+ +++V
Sbjct: 125 GEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKV 184

Query: 197 NPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRL 256
           NPGVW+TIFLVVIV+IN+ GV+FFGEFEFWLSSFK                   PDHDRL
Sbjct: 185 NPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHDRL 244

Query: 257 GFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVP 316
           GFRYWR PG+FKEYS  ITG TG+F +FV+VFVY+ ++Y GIELTGIV +EA+NPRKS+P
Sbjct: 245 GFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIP 304

Query: 317 KAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLP 376
           KAIKLT+YRI++FYL ++FLLGMCVAY+DP L+  K  S SAAASPFVVAI NSGI  LP
Sbjct: 305 KAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGINALP 364

Query: 377 HIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCC 436
           HI NACVLVFVFSACNSDLYVSSR+LY+LAID KAPKIFAKT++WG+PY AL +SVLFC 
Sbjct: 365 HIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCL 424

Query: 437 LAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQ 496
           LAYM VSS SAKIFNYFVNVVS+FGILSWI+ILI YI FD+A RAQG+DKS FAYVAP Q
Sbjct: 425 LAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQ 484

Query: 497 RYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKVIK 556
            YGA+F+L FC LIALIKNFTVFL H+FDYK FITGYIGLPV+   + GYK  YKTKVI 
Sbjct: 485 PYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVID 544

Query: 557 STDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606
              VDLYTFK   D+EEE+G++ D E+ ER+++NGKN EWFY+KFLG IF
Sbjct: 545 PLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/578 (65%), Positives = 447/578 (77%), Gaps = 3/578 (0%)

Query: 32  DNFPVKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAIADGKDENTRLKKELKARHISM 91
           D++  K+      DLE N+                 + + DGKD+ TRLKK+LKARHISM
Sbjct: 34  DSYFKKDNGTVAYDLEVNDQTRQNTLDDDASADSDGYNVMDGKDDGTRLKKDLKARHISM 93

Query: 92  XXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEMASYIPLDGFTSY 151
                                  P ++LIAY FVG LVFFTMA LGEMA+YIPLDGFTSY
Sbjct: 94  IAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAALGEMAAYIPLDGFTSY 153

Query: 152 ASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVVIVA 211
           ASRY DPALGFA+GY+YLFKYFI+ PNQLTAAALVIQYW+ RD VNPGVWITIFLVVI+A
Sbjct: 154 ASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRDTVNPGVWITIFLVVIIA 213

Query: 212 INIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRDPGAFKEYS 271
           IN +GVK+FGEFEFWLSSFK                   P+HDRLGFRYW+ PGAFK YS
Sbjct: 214 INTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLGFRYWKTPGAFKPYS 273

Query: 272 TA---ITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIV 328
           ++   I GSTGKF +FV VFVY+LF+Y GIELTGIV +EAENPR+++P+AIKLTV+RI+ 
Sbjct: 274 SSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTVWRILF 333

Query: 329 FYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHIFNACVLVFVF 388
           FY+ T+FLLGMCVAY+DP LL+      SAAASPFVVAIQNSG+ VLPHIFN CVL+FVF
Sbjct: 334 FYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSGVDVLPHIFNVCVLMFVF 393

Query: 389 SACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLAYMNVSSGSAK 448
           SACNSDLYV +R+LY+LA+DGKAPKIFAKT++WGVPYNA+   VLFC LAYMNVSSGSA+
Sbjct: 394 SACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGCVLFCLLAYMNVSSGSAE 453

Query: 449 IFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALSFCI 508
           IFNYFVNVVS+FG+LSW +ILI +IYFD+A RAQGID+S FAYVAP Q YG+YFAL FC+
Sbjct: 454 IFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAYVAPFQPYGSYFALFFCV 513

Query: 509 LIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKVIKSTDVDLYTFKEI 568
           L+ALIKNF+VFLG++FDYKTFITGYIGLPVY  S+ GYKL YKTK +K  + DL ++K  
Sbjct: 514 LLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKLYYKTKTVKPHEADLNSYKAA 573

Query: 569 YDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606
            DREEEEG+IK+ ER+ERL+   K++EWFYEK++  IF
Sbjct: 574 VDREEEEGKIKEAERKERLKHGKKDLEWFYEKYISSIF 611

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/537 (68%), Positives = 438/537 (81%), Gaps = 1/537 (0%)

Query: 70  IADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 129
           I+DGK++  RLKKELKARHISM                       P ++LIAY+FVG+LV
Sbjct: 40  ISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILV 99

Query: 130 FFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
           FF MACLGEMA+YIPLDGFTSYA+RY DPALGFA+GY YLFKYFI+ PNQLTA ALVIQY
Sbjct: 100 FFVMACLGEMATYIPLDGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQY 159

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           WI R+ VNPGVWITIFLVVIV IN VGV++FGEFEFWLSSFK                  
Sbjct: 160 WIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGG 219

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
            P+HDRLGFRYW++PGAFK YS +ITGS GKF SFVAVFVY+LF+Y GIELTGIV +EAE
Sbjct: 220 GPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAE 279

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPR+++P+AIKLT+YRII+FY+ T+FLLGMCVAYNDPRLL+    S SAAASPFVVAIQN
Sbjct: 280 NPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQN 339

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
           SG++ LPHIFN CVL+FVFSACNSDLYV +R+LY+LAIDGKAPK+FAKT++WGVPYNAL 
Sbjct: 340 SGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALF 399

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
              LFC LAYMNVSSGSA+IFNYFVNVVS+FGILSWI+ILI YI+F +AC AQ +D++ F
Sbjct: 400 GCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSF 459

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549
           AY AP Q YGAY  L FC+LIA IKNFTVF+G +FDYK+FITGYIGLP+Y++ + GYK+I
Sbjct: 460 AYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG-EFDYKSFITGYIGLPLYVIFYFGYKII 518

Query: 550 YKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606
           YKTK++K+ + DLY+FKE  DREE EG+IK+ E +ERL+ + K+++WFYEK+LG IF
Sbjct: 519 YKTKLVKAEEADLYSFKEAIDREEAEGKIKEAEAKERLKNSKKSLKWFYEKYLGYIF 575

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/527 (67%), Positives = 422/527 (80%)

Query: 80  LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEM 139
           LKK L+ARH+SM                       P +M IAY+FVG+LVFFTMA +GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 140 ASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPG 199
           ASYIP+DGFTSYASRYVDPALGFA+GY YLFKY IL PNQLTAA+LVIQYWI RD VNPG
Sbjct: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218

Query: 200 VWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 259
           VWITIFLVVIV IN+ GVKFFGEFEFWLSSFK                   PDHDRLGFR
Sbjct: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGFR 278

Query: 260 YWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAI 319
           YW+ PGAFK YS AI GS GKF +FV+VFVY+LF+Y GIELTGIV +EA NPRKSVP+A+
Sbjct: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338

Query: 320 KLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHIF 379
           KLTV+RI++FYL T+FLLGMCVAYNDPRLL+ KG   SAAASPFVVAIQNSGI+VLPHIF
Sbjct: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHIF 398

Query: 380 NACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLAY 439
           NACVL+FVFSACNSDLYV SR+LY+LA+DGKAP IF +T+ WG+P+ +L + VLF  LAY
Sbjct: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458

Query: 440 MNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYG 499
           MNVSSGSA++FNYFVNVVS+FG+LSWI I I YI F +A + QG+D+SKFAY AP Q YG
Sbjct: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518

Query: 500 AYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKVIKSTD 559
            YF+L++C+ IA IKNFTVFLGH FDYK FITGYIGLPV+++ + GYK I KTK++KS +
Sbjct: 519 TYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578

Query: 560 VDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606
           VDL+T KE++D++E EG+I DQE++ RL+ N  ++EW YEKFLG IF
Sbjct: 579 VDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/535 (68%), Positives = 429/535 (80%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DGK +  RLKKEL+ARH+SM                       PV++LIAY+FVG LV+ 
Sbjct: 47  DGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYI 106

Query: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
            M CLGEMA+YIPLDGFTSYASRY DPALGFA+GY+YLFKY I+ PNQLTAAALV+QYW+
Sbjct: 107 VMTCLGEMATYIPLDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWV 166

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
           SR++VNPGVWITIFLV+IV IN+VGVKFFGEFEFWLSSFK                   P
Sbjct: 167 SREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGP 226

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
            HDRLGFR+++DPGAF+ YS AI+GS GKF SFVAVFVY+LF+Y G EL GIV +E +NP
Sbjct: 227 SHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNP 286

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           R++VP+AIKLT+YRI+VFYL T+FLLGM VAYNDP LL  K KS SAAASPFVVAI+N+G
Sbjct: 287 RRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAG 346

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           I VLPHIFNACVL+FVFSACNSDLYV+SR+LY LAID KAPKIFAKT+KWGVPYN+LIL 
Sbjct: 347 IPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILC 406

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
           +LFC LAYMNVSSGSA++FNYFVNVVS+FG++SWI ILI YIYFD+A RAQG+DKS  AY
Sbjct: 407 ILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAY 466

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            AP    GAYFAL FC LIALIKNFTVFLGHKFDYK FITGYIG+PV+I+ + GYK I  
Sbjct: 467 AAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRG 526

Query: 552 TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606
           TK +K  + DLYTFKE+ D EEEEG++ D  ++E+++ + KN +WFYEKFLG IF
Sbjct: 527 TKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/536 (67%), Positives = 421/536 (78%), Gaps = 1/536 (0%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DGKDE+TRL+K+LKARHISM                       P++M IAYAFVG+LVFF
Sbjct: 78  DGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFF 137

Query: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
           TMA LGEMASYIPLDGFTSYASRY DPALGFA+GY YL KY ILPPNQLTAAALVIQYW+
Sbjct: 138 TMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
            R++VNPGVWITIFLV+IVA+N +GVKFFGEFEFWLS+FK                   P
Sbjct: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
            HDRLGFR++  PGAFK YS +I GS GKF +FVAV VY+LF+Y GIELTGIV +EA NP
Sbjct: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANP 317

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RKS+PKAIKLT+YRIIVFYL T+FLLGMCVAY+DP L   K     AAASP+VVAI NSG
Sbjct: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSG 377

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           IK LPHIFNACVL+FVFSACNSDLYV+SR LY LAID KAPKIFA T++WGVPY +L++S
Sbjct: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
             FC LAYM+VSSGSAKIFNYFVNVVS+FG+LSWI+ILI Y+ F +A +AQ +D+S+FAY
Sbjct: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            AP Q YG+YF L+FCILIA IKNFTVFL H FDYK FITGYIG+PV+++S+ GYK + K
Sbjct: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557

Query: 552 TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRN-GKNMEWFYEKFLGRIF 606
           TK+ K  +VDLYTFK   D EEE+G+I D ER ERL+ +  K  +WFYEK LG IF
Sbjct: 558 TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF 613

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/535 (66%), Positives = 421/535 (78%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DGK E  RLKKEL+ARH+SM                       PV++LI+Y+FVGLLV+ 
Sbjct: 42  DGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYT 101

Query: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
            M+CLGEMA++IPLDGFTSYASRYVDPA+GFA+GY+YLFKYFI+ PNQLTA A+V+Q+W+
Sbjct: 102 VMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
           SRDRVNPGVWITIFL +IV IN VGV+FFGEFEFWLSS K                   P
Sbjct: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 221

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
           +HDR GFR+WRDPGAFK YS AI+GS GKF SF +VF  +LF+YTG EL GIV +EA+NP
Sbjct: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 281

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           R+SVP+AIKLT+YRI+VFY+ T+ LLGM VAYNDPRLL  K  + SAAASPFVVAI+N+ 
Sbjct: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENAS 341

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           I VLPHIFN CVLVFVFSACNSDLYV+SR+LY LAIDGKAP+IFA T+KWGVPY +L LS
Sbjct: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
           VLFC LAYMNVSSGSA++FNYFVNVVS+FG+LSWITILI YI FDKA R Q  DKS  +Y
Sbjct: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            A  Q +  Y AL FC LI LIKN+TVFLGHKFDYKTFI+GYIG+PVY++ + GYK++Y+
Sbjct: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521

Query: 552 TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606
           TK+IK  DVDLYTFK+  D EEEE ++ ++ER E ++ + KN +WFYE FLG IF
Sbjct: 522 TKLIKPEDVDLYTFKDAIDAEEEEYKLLEKERLENMENSPKNFKWFYETFLGWIF 576

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/538 (63%), Positives = 415/538 (77%), Gaps = 3/538 (0%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DGK E  RLKK LKARH+SM                       P ++ I Y+FVG+LVFF
Sbjct: 56  DGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFF 115

Query: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
           TM+CLGEMA++IPLDGFTSYASRYVDPALGFA+GY+YL KY ILP NQLTA A+V+QYW+
Sbjct: 116 TMSCLGEMAAFIPLDGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWV 175

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
            RD +NPGV+ITIFL++IV INI GVK FGEFEFWLSSFK                   P
Sbjct: 176 DRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGP 235

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGS---TGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
           +HDRLGFRYWRDPG+FK YS++I      TGKF SF + FVY+LF Y GIELTGIV +EA
Sbjct: 236 NHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEA 295

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
           +NPRK++PKAIKLT+YRII+FY+ T+ LL MCVAYNDP LL   G+S SAAASPFVVAI+
Sbjct: 296 QNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIE 355

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
           NSGI +LPHIFN CVL FV SA NSDLYV+SR+LY+LAID KAPK F KT+KWG+PY +L
Sbjct: 356 NSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSL 415

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
             S  F CLAYMNVSS ++ +FNYFVN VS+FG++SWI IL+ YI+FDKAC+AQG+DKS 
Sbjct: 416 AFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSN 475

Query: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKL 548
           F YVAP Q YGAYFAL FC ++AL+KNFTVFLG +FDYK FITGYIG+PV+ + + GYK+
Sbjct: 476 FTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKI 535

Query: 549 IYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606
           +YKTK  +  +VDL T K + D+EEE+G+I+D EREERL+   K+  WFY++FLG+IF
Sbjct: 536 VYKTKTHRPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNGNKDWAWFYDRFLGKIF 593

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/535 (68%), Positives = 429/535 (80%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DGK  + RLKK+LKARH+SM                       PV+MLI+Y+FVG+LVFF
Sbjct: 54  DGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFF 113

Query: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
            M+C+GEMA+YIPLDGFTSYASRY DPALGFA+GY YL KYFILPPNQLTAAALVIQYWI
Sbjct: 114 VMSCIGEMAAYIPLDGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWI 173

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
            R++VNPGVWITI LVVIV IN  GVKFFGEFEFWLSSFK                   P
Sbjct: 174 PREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTP 233

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
            HDRLGFRYW+ PGAFKEYS +I G  G+F SFV+ FVY LF Y GIELTGIV +EAENP
Sbjct: 234 THDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENP 293

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RK++PKAIKLT++RII+FY+ T+FLLGMCV+ NDP LL  K KS SAAASPFVVAI NSG
Sbjct: 294 RKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSG 353

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           I+ LPHIFNACVL+FVFSACNSDLYV+SRNLY+LAID KAPKIFAKT+++G+PYN+L ++
Sbjct: 354 IEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVA 413

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
           VLFC LAYM+VSSGSAKIFNYFVNVVS+ G+L+WI+ILI YI FD+A RAQGIDKS FAY
Sbjct: 414 VLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAY 473

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
           VAP Q YGAYF+L FC L+ALIKNFTVFL HKFDY+ FITGYIGLP++ + + GYK + K
Sbjct: 474 VAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKK 533

Query: 552 TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606
           TK+ K  +VDL++FK   D+EEE+GRIKD    ER+++NGKN EWFYE +LG+IF
Sbjct: 534 TKIRKPEEVDLFSFKAAIDQEEEDGRIKDAATAERIKKNGKNWEWFYETYLGKIF 588

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/535 (65%), Positives = 418/535 (78%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DGK E  RLKK L+ARH+SM                       P ++LI+Y+FVGLLV+ 
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
            MACLGEMA++IPLDGFTSYASRYVDPALGFA+GY YLFKYFI+ PNQLTA A+V+QYW+
Sbjct: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
           SR++VNPGVWITIFLV+IV IN VGV+FFGEFEFWLSS K                   P
Sbjct: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 222

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
           +HDR GFRYWRDPGAFK YS AI+GS GKF SF +VF  +LF+YTG EL GIV +EA+NP
Sbjct: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 282

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           R+SVP+AIKLT+YRI++FY+ ++ LLGM VAYNDP L+  K  S SAAASPFVVAI+N+G
Sbjct: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAG 342

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           I VLPHIFNACVL+FVFSACNSDLYV+SR LY LAID KAPKIFAKT+ WGVPY +L +S
Sbjct: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
           VLFC LAYMNVSSGSA+IFNYFVNVVS+FG+LSWI+ILI Y+ F KA  AQ  DKS F+Y
Sbjct: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            AP Q +  + +L FC LI LIKN+TVFLGH FDYKTFI+GYIG+PVY + + GYKL+++
Sbjct: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522

Query: 552 TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606
           +K+IK  DVDLYTFK   D EEEEG++ + ER+E+L+ + KN+ WFY+ FLG IF
Sbjct: 523 SKLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSPKNLTWFYDTFLGWIF 577

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/534 (63%), Positives = 410/534 (76%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DGK +  RLKK L+ARH+SM                       P A+LIAYAFVGLLVFF
Sbjct: 71  DGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFF 130

Query: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
            M+CLGEMA+YIPLDGFTSY++RY DPALGFA+GY YLFKY+I+ PNQLTA ALVIQYW+
Sbjct: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
            RD+VNPGVWITI LV I+ IN +GV+FFGE E+++S+ K                   P
Sbjct: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGP 250

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
           +H+ LGF+YW++PGAFKEYSTAITG+ G+F SF +VFV +LF+Y G EL GIV SE +NP
Sbjct: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RK+VPKAIKLT+YRIIVFYL ++FLLGMCV +NDP L+S K    SA+ASPFVVAI N+G
Sbjct: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAG 370

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           I VLPHI NAC+L+FVFSA NSDLYV+SR+LY LAID KAP+IFAKT+K GVPY +L++ 
Sbjct: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
           VLF  LAYMNVSSGS+++F YFVN VS+FG+LSWI+ILI YI FDKA R QGIDKS  AY
Sbjct: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            +P Q YGA+F+L FCILI LIKNF  FLG  FDYK+FITGYIG+P YI+S+ GYKL YK
Sbjct: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYK 550

Query: 552 TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRI 605
           TK+I S +VDL +FKE  D EEEEG++ D+ER   L  +GK+++W YEK  G +
Sbjct: 551 TKIIPSEEVDLVSFKEAVDLEEEEGKMLDEERAAHLAAHGKDLKWCYEKIFGWV 604

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/537 (62%), Positives = 408/537 (75%), Gaps = 2/537 (0%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DGK +  RLKK+L+ARH+SM                       P+A+LIAY+ +G +VF 
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
            M+CLGEMA+YIPLDGFTSYA+RY DPALGFA+GYTYLFKY +L PNQLTAAALV+QYW+
Sbjct: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
            R +VNPGVWIT+FL VI+ INIVGVKFFGEFEFWLSSFK                   P
Sbjct: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGP 229

Query: 252 DHDRLGFRYWRDPGAFKEYSTAIT--GSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
            H+RLGFRYW+DPG FK YS A++  G  GKF SF +VFVY+LF+Y G EL GIV +E +
Sbjct: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPR++VP+AIKLT+YRI+VFYLCTVFLLG+ VAYNDP LL TK    SAAASP+VVAI+N
Sbjct: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKN 349

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
           +GI VLPHIFNACVL FVFSACNSDLYV SR+LY LAID KAPKIFAKT+ WGVPYN+L 
Sbjct: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           L  LFCCLAYMNVSS +  +F+YFVNV S+FG+LSWI+ILI YI FD+A R QGIDK+  
Sbjct: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549
           +Y AP Q   A+ AL FC+++AL+KNFTVFLG  FDYKTFITGYIG+PVYIL +  YK++
Sbjct: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529

Query: 550 YKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606
           +KTK IKS +VDL+T+K   D EEEEG+++    +E  +++G   + FY+   G IF
Sbjct: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/523 (61%), Positives = 392/523 (74%), Gaps = 3/523 (0%)

Query: 70  IADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 129
           I DGK E  RLKK+LK+RHISM                       PV+ LIAY FVG++V
Sbjct: 55  IGDGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMV 114

Query: 130 FFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
           FFTMACLGEMA++IPLDGFTSYASRY DPALGFA+GY YL KYFILPPNQLTAAA+V+QY
Sbjct: 115 FFTMACLGEMATFIPLDGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQY 174

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W+ RD VNPG+W+T+   VI  INI GV+FFGEFEFWLSS K                  
Sbjct: 175 WVPRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGG 234

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
              HDRLGFRYW+ PGAF +YS  I+GS GKF SFVAV V  +F+Y GIELTGIV +EA 
Sbjct: 235 AGSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEAS 294

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPR+SVPKAIKLT YRI+VFY+ ++FLLGMCV YND +L++T   S++A  SPF +AI N
Sbjct: 295 NPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTA--SPFSIAILN 352

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
           +GI VLP IFN C+L+FVFSA NSDLYV+SRNLY+LA+D KAPKIFA T++WG+PYN+L 
Sbjct: 353 AGITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLF 412

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           +S LFC LAYM VSS SA++F YFVNVVS+ G+L+WI+ILI YI FD+A RAQ +DKS F
Sbjct: 413 VSCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTF 472

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549
           AYVAP Q YGAY +L FC LIA+IKNFTVFLGH FDYKTFITGYIGLP+++L + GYK+ 
Sbjct: 473 AYVAPFQPYGAYVSLFFCCLIAIIKNFTVFLGH-FDYKTFITGYIGLPIFVLCYFGYKIT 531

Query: 550 YKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGK 592
            K+++  +  VDL + K + DRE+ E  + +Q + E +  N K
Sbjct: 532 CKSEIRSARYVDLVSQKSLVDREQVEYELIEQLKREEMIANTK 574

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/538 (60%), Positives = 393/538 (73%), Gaps = 3/538 (0%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DGK E  RLKK+L+ARH+SM                       P ++LIAY+ +G +VF 
Sbjct: 51  DGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFT 110

Query: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
            M+CLGEMA+YIPLDGFTSYA+RY DPALGFA+G+ YLFKY +L PNQLTA ALVIQ+WI
Sbjct: 111 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWI 170

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
              RV+PGVWIT+ L VIV IN VGV+FFGEFEFWLSSFK                   P
Sbjct: 171 PAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGP 230

Query: 252 DHDRLGFRYWRDPGAFKEYS---TAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
            HDRLGFRYW DPGAFKEYS   T I G  GKF +F++VFVY+LF+Y G EL GIV +E 
Sbjct: 231 THDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAEC 290

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
           ++PR++VP+AIKLT+YRI+VFYL T+FLLGMCVAYNDP L+      +SAAASP+VVAI+
Sbjct: 291 KDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIE 350

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
           N+ I VLP++FNACVL FVFSACNSDLYV SR+LY LAIDGKAPK+FA+T+KWGVPYNAL
Sbjct: 351 NAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNAL 410

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
               LFCCLAYM+VS  +   F YFVNV S+FG++SW++ILI YI FD+A RAQGI KS 
Sbjct: 411 ACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKST 470

Query: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKL 548
            +YVAP Q Y  + AL FCI +ALIKNF  F+G + D  TFITGYIGLP+YI  + GYK+
Sbjct: 471 LSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYKI 530

Query: 549 IYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606
           ++KTK I S +VDL+TFKE  D EEEE   +    +E+L + G + +  Y+  LG IF
Sbjct: 531 VHKTKWIPSKEVDLFTFKEAIDLEEEECIRERALMKEQLAKGGLSWKKIYDNVLGWIF 588

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  350 bits (899), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 206/517 (39%), Positives = 281/517 (54%), Gaps = 24/517 (4%)

Query: 71  ADGKDE---------NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIA 121
           A G+DE         N  L +ELK R +S+                       P+++ IA
Sbjct: 14  ASGEDECESEEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIA 73

Query: 122 YAFVGLLVFFTMACLGEMASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL 180
           Y F G L+   +  L EMAS+ P+D GF+ Y +RYVDPA GFA G+ Y  KY I+    L
Sbjct: 74  YLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANL 133

Query: 181 TAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXX 240
           TA  LVI YW  R  VN GVW+T+  V +  +N + VK+FGE E  L+ FK         
Sbjct: 134 TAFGLVIGYW--RPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYI 191

Query: 241 XXXXXXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIEL 300
                     P+H   GFRYWR+ GA       + G TGKF  + A  V S+F + G E+
Sbjct: 192 TCLIITCGGAPNHTTTGFRYWRESGALPYL---VGGGTGKFLGWWACVVQSIFGFMGSEM 248

Query: 301 TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA 360
            GIV  E  NP+K++PK+     +RI   Y+  VF+LG+ ++  + +L+     S  A A
Sbjct: 249 IGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLV--HAHSTDANA 306

Query: 361 SPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSK 420
           SPFV+AI +SGIKVLP+  NA +LVF+ S+ N+D+Y+ SR LY LA DG APKIF   ++
Sbjct: 307 SPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNR 366

Query: 421 WGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR 480
           + VP    +   L   LAYMN    +A +F+Y  + VS+FGIL+W  ILI YI +D+A +
Sbjct: 367 FKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIK 426

Query: 481 AQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI 540
           A+GI      +    Q Y AY  L F  +I     +  F+  KF YKTFIT YIG+   I
Sbjct: 427 AKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFI-IKFHYKTFITSYIGVFANI 485

Query: 541 LSWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGR 577
           L   GYKL +KTK +K +++   T      R E EG 
Sbjct: 486 LMVIGYKLYFKTKFVKPSEISFRT------RNEHEGE 516

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  343 bits (881), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/495 (38%), Positives = 278/495 (56%), Gaps = 9/495 (1%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
            D    LKK L  RHI +                       P  + +++  +  +V+  M
Sbjct: 45  SDYEHNLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIM 104

Query: 134 ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             L EM  Y+P  G      +RYVDP+LGFA G+ Y + Y +L   +LTAAA +++YW  
Sbjct: 105 CTLAEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYW-- 162

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
            D+V  GVWITIFL+V+V +N   V+F+GE EFW +S K                   P+
Sbjct: 163 TDQVPQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPN 222

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIVCSEAENP 311
           HDR+GFRYWR+PGAF  + T   G+ G+F       + S F++    EL G+ C EA++ 
Sbjct: 223 HDRVGFRYWRNPGAFGYHITG--GNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDT 280

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLL-STKGKSMSAAASPFVVAIQNS 370
           R+++ KA +  +YRII FYL +  ++G+ VA ND  LL + +     AA+SPFV  I NS
Sbjct: 281 RRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANS 340

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           GI VL H+ N  +L   +SA NS  Y SSR++ AL+  G APKIF+K +++GVPYNA+ L
Sbjct: 341 GIPVLNHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFL 400

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
             L  CLAY+NVSS S+K+F +  N+ ++ G + W  I + YI F KA     +   +  
Sbjct: 401 CSLVACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRIP 459

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           Y +P Q + AYF      +I L   + VF+  ++DYK F+T YI LP+++  + G+K IY
Sbjct: 460 YRSPLQPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIY 519

Query: 551 KTK-VIKSTDVDLYT 564
           KT+  I    +D+ T
Sbjct: 520 KTRFCIPVDQIDVIT 534

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  341 bits (874), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 207/586 (35%), Positives = 317/586 (54%), Gaps = 39/586 (6%)

Query: 29  QDADNFPVKEQE---IYNIDLEENNVXXXXXXXXXXXXXXXXFAIADGKDENTRLKKELK 85
           +DA    V +++   +Y ID+E  +                  + +D    +  LKK LK
Sbjct: 8   KDAGETTVTDKQTGQVYEIDIESYS-----------QISGPKVSSSDAPQGDHTLKKGLK 56

Query: 86  ARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEMASYIPL 145
           +RHI +                       P  +  +Y  + ++++  M  LGEM  Y+P 
Sbjct: 57  SRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVCYLPG 116

Query: 146 DGFT------SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPG 199
           DG +         +RYVDP+LGFA G+ Y + Y IL   + TAA+ V+QYW +   V  G
Sbjct: 117 DGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTTA--VPKG 174

Query: 200 VWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 259
            WITIFL V+V +N   VKF+GE EFW +S K                   P HDRLGFR
Sbjct: 175 AWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFR 234

Query: 260 YWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIVCSEAENPRKSVPKA 318
           YW+ PGAF  + T  +G+TG+F       +   F++  G EL  +  +EA++ R+++ KA
Sbjct: 235 YWQKPGAFAYHIT--SGNTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKA 292

Query: 319 IKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST---KGKSMSAAASPFVVAIQNSGIKVL 375
            +  VYR+I FY+ +   +G  VAYND + LST   +GK   A +SPFV+ IQN+GIKVL
Sbjct: 293 SRRFVYRLIFFYVSSSLAIGCIVAYND-KTLSTALDQGKP-GAGSSPFVIGIQNAGIKVL 350

Query: 376 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFC 435
           PHI N C+L   +S+ NS ++ +SR+L +++ +G APKI  + +++GVPY A+ L+ L  
Sbjct: 351 PHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLS 410

Query: 436 CLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 495
           C+AY+NVSS +A +F +F N+ ++ G + WI I I Y+ F KA   Q + + +  +  P 
Sbjct: 411 CIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNLYE-RVPFKTPF 469

Query: 496 QRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKL---IYKT 552
           Q YG +F +    +I L   + +F+   ++   FI  Y+ LP++++ W G+KL    +KT
Sbjct: 470 QPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKT 529

Query: 553 KVIKSTDVDLYT-FKEIYDREEEEGRIKDQEREERLQRNGKNMEWF 597
             I   ++D+ T  KEI    EEE +  D++R       GK MEW 
Sbjct: 530 WAIPVPEIDVTTGLKEI----EEESKECDEKRIVPTTAGGKFMEWL 571

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  337 bits (865), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/519 (35%), Positives = 296/519 (57%), Gaps = 15/519 (2%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           +++  +K++LK RH+SM                       PV  L+AY F+G + F    
Sbjct: 57  NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116

Query: 135 CLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            LGEMA++IP+   FT Y  R++ PALG A GY Y F + +    +L+    +IQYW   
Sbjct: 117 SLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA 176

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
             V   VWI +F +++ A N++ V+F+GE EFW+++ K                    + 
Sbjct: 177 --VPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSE- 233

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             LGFRYW++PG +     +      +F  +V+  + + F+Y G EL GI   E++NPRK
Sbjct: 234 GALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRK 293

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           +VPKAI    +RI+ FY+ ++F +G+ V Y DPRL +T    ++   SPFV+AIQNSG K
Sbjct: 294 TVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINT--SPFVMAIQNSGTK 351

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           VLP +FN  +LV + SA NS++Y+ SR LY L+  G AP +F KT+K GVP+ A++ S +
Sbjct: 352 VLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSI 411

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F CLAY+N+S  + K+F++ + + ++ G  +W+ I + +I F +  + +GI ++   + A
Sbjct: 412 FGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKA 471

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK 553
               +GAY+A  F  +I LI+ F  F   +F +  FI  YI + ++I+ W G+++++KT+
Sbjct: 472 KFMPWGAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTR 530

Query: 554 VI-KSTDVDLYTFKEIYDREEEEGRI--KDQEREERLQR 589
           +I +  DVD+ T     DR E +  +   D E +  LQ+
Sbjct: 531 LILRKEDVDIDT-----DRREIDALVWSDDDEPKTLLQK 564

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  338 bits (866), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 205/609 (33%), Positives = 313/609 (51%), Gaps = 61/609 (10%)

Query: 19  ENDHDAYYSKQDA-------------DNFPVKEQEIYNIDLEENNVXXXXXXXXXXXXXX 65
            N+H +   K DA              N  ++E  I ++DLE++                
Sbjct: 51  RNNHRSDNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKS---------------- 94

Query: 66  XXFAIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFV 125
                 DG  E  +LK+ L++RH+ +                       P  + I+Y  +
Sbjct: 95  ---PSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIII 151

Query: 126 GLLVFFTMACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQ 179
             +++  M  LGEM  ++P DG  S  S      RYVDP+LGFA G+ Y + Y IL   +
Sbjct: 152 SAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAE 211

Query: 180 LTAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXX 239
            TAA+ V++YW +   V  GVWITIFL V+V +N   VK +GE EFW +S K        
Sbjct: 212 CTAASGVVEYWTTA--VPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLI 269

Query: 240 XXXXXXXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GI 298
                      P+HDRLGFRYW+ PGAF  + T   GS G FT      +   F++  G 
Sbjct: 270 ILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTG--GSLGNFTDIYTGIIKGAFAFILGP 327

Query: 299 ELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSM 356
           EL  +  +E  + R+++ KA +  V+R+I FY+     + + V YNDP L++   +GK  
Sbjct: 328 ELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKP- 386

Query: 357 SAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFA 416
            A +SPFV+ IQN+GIKVLPHI N C+L   +SA N+ ++ S+R+L  +A  G+APK   
Sbjct: 387 GAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLG 446

Query: 417 KTSKWGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFD 476
           + +KWGVPY A+ +S L  CLAY+NVSS +A +FN+F N+ ++ G L W+   I Y+ F 
Sbjct: 447 RINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFR 506

Query: 477 KACRAQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGL 536
           KA    G+   +  +   GQ Y  +F+L    +I +   + +F+   +    FI  YI L
Sbjct: 507 KAIFYNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITL 565

Query: 537 PVYILSWAGYKL---IYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKN 593
           P++++ W G+KL    ++   +  +++D+ T   + + EE+   I+    E RL   G  
Sbjct: 566 PIFLVLWFGHKLYTRTWRQWWLPVSEIDVTT--GLVEIEEKSREIE----EMRLPPTG-- 617

Query: 594 MEWFYEKFL 602
              F +KFL
Sbjct: 618 ---FKDKFL 623

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  334 bits (857), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/535 (36%), Positives = 293/535 (54%), Gaps = 24/535 (4%)

Query: 73  GKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFT 132
           G  + T++K+ LK RHISM                       PV  LIAY F+G L +  
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94

Query: 133 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
              LGEMA++IP+   FT +  R++ PALG A GY Y   + I    +L+    +IQ+W 
Sbjct: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW- 153

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
             D V    WI IF V++   N+  VK++GE EFW++  K                    
Sbjct: 154 -TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
               +GFRYWR+PG +     +   + G+F  +V+  + + F+Y G EL GI   EA NP
Sbjct: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RK+VP+AI    +RI+ FY+ ++  +G+ V +NDP+L   K +    ++SPFV+AI+NSG
Sbjct: 272 RKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSG 328

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
            KVLPHIFNA +L  + SA NS++YV SR  Y++A++G APK    T+K G+PY A++ +
Sbjct: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            +   LAY+  SSG++ +FN+ +N+ ++ G  +WI I I +I F +A + QGI +    +
Sbjct: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            A    +GAY+A  F  +I +I+ FT F   KF    F T YI + ++ + W G+++ ++
Sbjct: 449 KAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFR 507

Query: 552 TKV-IKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRI 605
             + IK+ D+DL T     DR E    I D   EE+  RN       +EKF   I
Sbjct: 508 GPLFIKTEDIDLDT-----DRRE----IDDVVWEEQKPRN------LWEKFWAAI 547

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  334 bits (857), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 184/517 (35%), Positives = 287/517 (55%), Gaps = 14/517 (2%)

Query: 73  GKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFT 132
           G  + T++K+ LK RHISM                       PV  LIAY F+G L +  
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94

Query: 133 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
              LGEMA++IP+   F  +  R++ PALG A GY Y   + I    +L+    VIQ+W 
Sbjct: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW- 153

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
             D V    WI I  VV+V+ N+  VKF+GE EFW++  K                    
Sbjct: 154 -TDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
               +GFRYWR+PG +     +   + G+F  +V+  + + F+Y G EL GI   EA NP
Sbjct: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RK+VP+AI    +RI+ FY+ ++  +G+ V +NDP+L   K +    ++SPFV+AI+NSG
Sbjct: 272 RKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSG 328

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
            KVLPHIFNA +L  + SA NSD+Y+SSR LY++ ++G APK    T+K G+PY A++ +
Sbjct: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            L   LAY+  S G++ +F++ +N+ ++ G  +W+ I + +I F +A + QGI +    +
Sbjct: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            A    +GAY+A  F  +I +I+ FT F   KF+   F T Y+ + ++   W G+++ ++
Sbjct: 449 KAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507

Query: 552 TKVIKST-DVDLYTFKEIYDREEEEGRIKDQEREERL 587
             + K T D+DL T     DR E +  + +++  + L
Sbjct: 508 GPLFKKTEDIDLDT-----DRREIDNDVWEEDEPKNL 539

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  335 bits (858), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/514 (36%), Positives = 292/514 (56%), Gaps = 15/514 (2%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
            G+  N  +K+ELK RHI M                       PV  LI+Y F+G L + 
Sbjct: 76  QGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYS 135

Query: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VI++W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFW 195

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
              ++V    WI+IF V+I  +N+  VK++GEFEFW++S K                   
Sbjct: 196 --TNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAG 253

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
                +GFRYWR+PGA+     +   + G+F  +V+  + + F++ G EL GI   EA N
Sbjct: 254 VTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRK+VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L +    +   + SPF++AI+NS
Sbjct: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTA---TSYVSVSPFIIAIENS 369

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G KVLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  ++T+K GVPY A+ +
Sbjct: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFI 429

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + +F  LAYM  S+G  K+F + +N+  + G  +W+ I I +I F +A + +GI + +  
Sbjct: 430 TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELP 489

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           + A      AYFA +F I+I LI+ FT F   KFD   F+  YI + +++  W  +++I+
Sbjct: 490 FKAKLMPGLAYFAATFMIIIILIQGFTAF-APKFDGIDFLAAYISIFLFLAIWILFEIIF 548

Query: 551 KTKVI-KSTDVDLYTFKEIYDREEEEGRI-KDQE 582
           + + I K  DVD+ +     DR + E  + +D E
Sbjct: 549 RCRFIWKIEDVDIDS-----DRRDIEAIVWEDHE 577

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  335 bits (858), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/539 (35%), Positives = 294/539 (54%), Gaps = 25/539 (4%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           +EN +LK+ LK+RH+ +                       P  +  +Y  +   ++  M 
Sbjct: 65  EENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMN 124

Query: 135 CLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 188
             GEM  Y+P +G  S  S      +YVD +LGFA  + Y + + IL   + TAAA V++
Sbjct: 125 AFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVE 184

Query: 189 YWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 248
           YW    +V  G WITIFL  +VA+N++ V F+GE EFW +S K                 
Sbjct: 185 YWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWG 244

Query: 249 XXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIVCSE 307
             P HDRLGFRYW+ PGAF ++ T  TG  G F       +   F++  G EL  +  SE
Sbjct: 245 GGPSHDRLGFRYWQRPGAFADHITDGTG--GNFLDVYTGVIKGGFAFVLGPELVSLTSSE 302

Query: 308 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVA 366
             + R+++ KA +  V+R+++FY+     + + VAYNDP L +   +S   A +SPFV+ 
Sbjct: 303 CHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIG 362

Query: 367 IQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYN 426
           IQN+GIKVLPHI N C++   +SA N+ ++ SSR+L  +A  G APK F+K +++GVPY 
Sbjct: 363 IQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYV 422

Query: 427 ALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK 486
           A+  S LFCCLAY+NVSS +A +FN+F N+ ++ G + WI   + YI F KA     +  
Sbjct: 423 AVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-Y 481

Query: 487 SKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGY 546
            +  Y    Q+Y  +++L    LI L   + +F+   +DYK FI  YI LPV+I+ W G+
Sbjct: 482 DRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGH 541

Query: 547 KLI---YKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFL 602
           KL+   ++   I    +D++T  E    E EE  + ++  E+R+  N       ++KFL
Sbjct: 542 KLVTRSWRQWYIPVDKIDVFTGLE----EIEE--LTNELDEKRVPPNNA-----WDKFL 589

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  334 bits (856), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/523 (35%), Positives = 293/523 (56%), Gaps = 17/523 (3%)

Query: 70  IADGKDE---NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVG 126
           +A  KDE   +  +K+ LK RHI M                       PV  L+AY F+G
Sbjct: 53  LATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMG 112

Query: 127 LLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 185
            +VF     LGEMA++IP+   F+ +A R++ PALG A GY Y   +      +L+    
Sbjct: 113 TVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQ 172

Query: 186 VIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 245
           +IQ+W  +  V    WI+IF V++ A N+  VKF+GEFEFW++S K              
Sbjct: 173 IIQFWTFK--VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230

Query: 246 XXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVC 305
                     +GFRYWR+PGA      +      +F  +V+  + + F+Y G EL GI  
Sbjct: 231 VCGAG-KTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITA 289

Query: 306 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVV 365
            EA NPRK+VP+AI+  + RI++FY+ ++F +G+ V YNDP+L ST       ++SPF++
Sbjct: 290 GEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY---VSSSPFII 346

Query: 366 AIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPY 425
            IQN+G +VLPHIFNA +L  + SA NS++YV SR L+++A +G APK  AKT+  GVPY
Sbjct: 347 TIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPY 406

Query: 426 NALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 485
            +++    F  L+YM +S+G AK FN+ +N+  + G  +W+ I   ++ F +A + +GI 
Sbjct: 407 LSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGIS 466

Query: 486 KSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAG 545
           +    Y A    + AY+A+ F ++I LI+ FT F  H F  + F+  YI + ++++ W  
Sbjct: 467 RDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPH-FSGRDFVAAYISVGLFLVFWGF 525

Query: 546 YKLIYKTKVI-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           +++ ++ ++I K  DVD+ T     DR E E  + + +  + L
Sbjct: 526 FQIYFRCRIIWKLEDVDIDT-----DRREIESVVWEDDAPKTL 563

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  332 bits (852), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/542 (37%), Positives = 292/542 (53%), Gaps = 31/542 (5%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           K E   LK+ L++RHI +                       P  +L +Y  + L+++  M
Sbjct: 43  KREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVM 102

Query: 134 ACLGEMASYIPLDGFTS------YASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 187
             LGEM  Y+P  G  S        SRY DP+LGFA G+ Y + Y IL   + TAA+ V+
Sbjct: 103 NALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVV 162

Query: 188 QYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 247
            YW +   V    WITIFL V+  +N   VKF+GE EFW +  K                
Sbjct: 163 TYWTTV--VPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFW 220

Query: 248 XXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIVCS 306
              P HDRLGFRYW+ PGAF  + T  TG+TG+F       +   F++  G EL  +  S
Sbjct: 221 GGGPSHDRLGFRYWQKPGAFAYHIT--TGNTGRFLDVWTGVIKGGFAFILGPELVAVTSS 278

Query: 307 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASPFV 364
           EA + R+++ KA +   YR+I FY+ +   +G+ VA NDP L      GK+  AA+SPFV
Sbjct: 279 EAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKA-GAASSPFV 337

Query: 365 VAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVP 424
           +AIQN+ IK+LPHI NAC+L   +S+ NS ++ +SR+L ++A DG APK+F K ++ GVP
Sbjct: 338 IAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVP 397

Query: 425 YNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGI 484
           YNA+ +S  F CLAY+NVSSGSAK F +F N+ ++ G + WI I + Y+ F KA   +G+
Sbjct: 398 YNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL 457

Query: 485 -DKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSW 543
            D+  F   +P Q YG YF +    +I L   +  F+   +    F+  YI LPV+++ W
Sbjct: 458 YDRVPFK--SPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLW 515

Query: 544 AGYKLIYKTK---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEK 600
            G+K+  +T    VI   +VD+ T             I++  +E    R   N  W  EK
Sbjct: 516 VGHKIYTRTLSTWVIPVAEVDVTT---------GLAEIEELTKELDALRVPPNSAW--EK 564

Query: 601 FL 602
           F+
Sbjct: 565 FM 566

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  330 bits (847), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/490 (37%), Positives = 272/490 (55%), Gaps = 9/490 (1%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
            G      L +EL    +S+                       P+++ +AY F G ++  
Sbjct: 25  GGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFLAYLFTGSILAV 84

Query: 132 TMACLGEMASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
            +  L EMA++ P+D GF+ Y ++YVDPA GFA G+ Y  KY I+    LTA  LVI YW
Sbjct: 85  VIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW 144

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
             R  +N  VW+T+       +N + V++FG+ E +++  K                   
Sbjct: 145 --RPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIVCLVITCGGG 202

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           PDH  +GFRYWR+ G F  Y   + G+TGKF  + A  + S+F + G E+ GI+  E  N
Sbjct: 203 PDHTTIGFRYWRESG-FLPY--LVKGNTGKFLGWWACVIQSIFGFMGSEMIGIIYGETAN 259

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRK++PKA +  + RI VFY+  VF+LG+ V+ ++ +L+     S  A ASPFV+AI  S
Sbjct: 260 PRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLV--HAHSTDANASPFVIAISTS 317

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           GIKVLP   NA +LVF+ S+  +D+Y+ SR LY LA DG APKIF + +K  +P    ++
Sbjct: 318 GIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKHKIPMVGCVV 377

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
             L   LAYMN    +A +F Y  + VS+FGIL+W  IL+ YI++D+  ++ G+   +  
Sbjct: 378 GSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKSHGVRLDEIP 437

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           +  P Q Y AY AL F  +I     ++ F+  KF+YK FIT YIG+   +L   GYKL Y
Sbjct: 438 FRMPFQPYAAYIALFFVSVITFFNGYSAFI-LKFNYKLFITSYIGIFANVLLVLGYKLYY 496

Query: 551 KTKVIKSTDV 560
           KTK +K  ++
Sbjct: 497 KTKWVKPEEI 506

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  329 bits (844), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/508 (37%), Positives = 283/508 (55%), Gaps = 14/508 (2%)

Query: 70  IADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 129
           IA+G+     +K+ELK RHI M                       PV  LIAY F+G LV
Sbjct: 49  IANGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLV 108

Query: 130 FFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 188
           +     LGEMA++IP+   FT ++ R++ P+ G A GY Y F + I    +L+    +IQ
Sbjct: 109 YSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQ 168

Query: 189 YWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 248
           +W S   +    WI+IF V++VA+N+  V+F+GEFEFW++S K                 
Sbjct: 169 FWTSAVPIV--AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG 226

Query: 249 XXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
                  +GFRYWR+PG       A   +  KF  +V+  + + F+Y G EL GI   EA
Sbjct: 227 AGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEA 285

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
            NPRKSVP+AIK  V+RI+ FY+ ++F +G+ V YNDP+L S        AASPF+++IQ
Sbjct: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY---VAASPFIISIQ 342

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
           NSG  +LPHIFNA +L  + SA NS++YV SR ++ L+    AP+I ++T+K GVP+ ++
Sbjct: 343 NSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSV 402

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
           I + LF  LAYM  S+G    FN+ +N+  + G  SW+ I I ++ F +A   +GI +  
Sbjct: 403 IFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDD 462

Query: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKL 548
             + A      AY+A+ F  LI +I+ FT F    FD   F+  YI   ++I  W  ++L
Sbjct: 463 LPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQL 521

Query: 549 IYKTKVI-KSTDVDLYTFKEIYDREEEE 575
            ++ ++I K  DVD+ T     DR + E
Sbjct: 522 WFRCRLIWKIEDVDIDT-----DRRDIE 544

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  328 bits (842), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 177/489 (36%), Positives = 278/489 (56%), Gaps = 6/489 (1%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           +G      +K+ LK RH+SM                       PV  LIA+  +G L + 
Sbjct: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124

Query: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               LGEMA++IP+   FT ++ R++ PA+G A GY Y F + I    +L+    +IQYW
Sbjct: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
              D V    WI IF V++V+ N+  VK++GEFEFW++S K                   
Sbjct: 185 --TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAG 242

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           P+   +GFRYWR PG +     A   +  +F  +V+  + + F+Y G EL GI   E +N
Sbjct: 243 PE-GPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKN 301

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRK+VP+AI    +RI++FY+ ++F +G+ V YNDP+L  +   S   A SPF++AI N 
Sbjct: 302 PRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSY-IAQSPFLIAILNC 360

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
              VLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK F+KT+K GVP+ A+++
Sbjct: 361 RTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLI 420

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + +F  LAY+NVS+ + ++F++ +N+ ++ G ++W+ I I +I F +  + +GI +    
Sbjct: 421 TAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLP 480

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           Y A    Y AY+A  F  +I +I+ FT F  H F+   F   YI + ++ + WA ++ IY
Sbjct: 481 YKAKFMPYAAYYAAFFITVIIIIQGFTAFAPH-FNVSDFFAAYISVFLFFIVWAIFQTIY 539

Query: 551 KTKVIKSTD 559
           +TK+ ++ D
Sbjct: 540 RTKLFRTLD 548

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  329 bits (844), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/518 (36%), Positives = 287/518 (55%), Gaps = 14/518 (2%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           + + ++TR+K+ LK RHI M                       PV  LIAY F+G +V+F
Sbjct: 96  EAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYF 155

Query: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQYW
Sbjct: 156 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYW 215

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                V    WI IF V++  +N   VK +GEFEFW++S K                   
Sbjct: 216 --TKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGS 273

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
                +GFRYWR+PG +     +      +F  +V+  + + F+Y G EL GI   EA N
Sbjct: 274 -HQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 332

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRKSVP+AI   V+RI +FY+ ++F +G+ V +ND RL +    S   A+SPFV++IQN+
Sbjct: 333 PRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLAN---DSAVIASSPFVISIQNA 389

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G + LP IFNA VL+ + SA NS++YV SR LYALA+ G APKIF+  +K+GVPY  +I 
Sbjct: 390 GTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVIC 449

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           +     LA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A + +GI +    
Sbjct: 450 TAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLP 509

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           + A    +GAY+A  F  +I  I+ F  F   KFD  TF T YI L +  + ++G +L Y
Sbjct: 510 FKAKLMPWGAYYASFFVTVIIFIQGFQAFT-PKFDVSTFFTSYISLILLAVLFSGCQLYY 568

Query: 551 KTKVI-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           + + I K  D+D+ +     DR E E  I +++  + L
Sbjct: 569 RCRFIWKVEDIDIDS-----DRREIEAIIWEEDEPKNL 601

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  328 bits (842), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/518 (35%), Positives = 290/518 (55%), Gaps = 14/518 (2%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           +G+ +N  +K+ELK RHI M                       PV  LI+Y F+G L + 
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               LGEMA++IP+   FT ++ R++ PA G A GY Y F + +    +L+    VIQ+W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                V    WI+IF V+I A+N+  VK++GEFEFW++S K                   
Sbjct: 196 TYA--VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
                +GFRYWR+PGA+     +   +  +F  +V+  + + F++ G EL GI   EA N
Sbjct: 254 VTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAAN 312

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRK+VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L S    +   + SPF++AI+NS
Sbjct: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSA---TSYVSTSPFIIAIENS 369

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G KVLPHIFNA +L  + SA NS++YV SR L+ L+    APK F+KT+K GVPY A+  
Sbjct: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFA 429

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + +F  LAYM  S+G  K+F + +N+  + G  +W+ I + +I F +A + +GI + +  
Sbjct: 430 TSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELP 489

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           + A      AY+A  F ++I LI+ FT F    F+   F+  YI + +++  W  ++LI+
Sbjct: 490 FKAKLMPGLAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIF 548

Query: 551 KTK-VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           + + V K  DVD+ +     DR + E  + ++   + L
Sbjct: 549 RCRFVWKIEDVDIDS-----DRRDIEAIVWEEPEPKTL 581

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  328 bits (842), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/514 (36%), Positives = 290/514 (56%), Gaps = 15/514 (2%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           +G+ +N  +K+ELK RHI M                       PV  LI+Y F+G L + 
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
             +  V    WI+IF V+I  +N+  VK++GEFEFW++S K                   
Sbjct: 196 TYK--VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAG 253

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
                +GFRYWR+PGA+     +   + G+F  +V+  + + F++ G EL GI   EA N
Sbjct: 254 VTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRKSVP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L  +   +   + SPF++AI+NS
Sbjct: 313 PRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS---TSYVSTSPFIIAIENS 369

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G KVLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  ++T+K GVPY A+ +
Sbjct: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFV 429

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           +  F  LAYM  S+G  K+F + +N+  + G  +W+ I I +I F +A + +GI + +  
Sbjct: 430 TAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           + A      AY+A +F  +I +I+ FT F   KF+  +F   YI + +++  W  ++ I+
Sbjct: 490 FKAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIF 548

Query: 551 KTKVI-KSTDVDLYTFKEIYDREEEEGRI-KDQE 582
           + + I K  DVD+ +     DR + E  + +D E
Sbjct: 549 RCRFIWKIGDVDIDS-----DRRDIEAIVWEDHE 577

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  327 bits (838), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/520 (37%), Positives = 291/520 (55%), Gaps = 14/520 (2%)

Query: 70  IADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 129
           I     +   +++ LK RH+SM                       PV  LI+Y F+G L 
Sbjct: 39  IDTASSQERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLA 98

Query: 130 FFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 188
           FF    LGEMA++IP+   FT +  R++ PALG A GY Y F + I    +L+    +IQ
Sbjct: 99  FFVTQSLGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQ 158

Query: 189 YWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 248
           YW     V    WI IF V I   N+V VKF+GEF+FW++  K                 
Sbjct: 159 YWTLG--VPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCG 216

Query: 249 XXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
                  +GFRYWR+PG + +   + + S G+F  +V+  V + F+Y G EL G+   E+
Sbjct: 217 AG-KTGPVGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGES 275

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
            NPRK+VPKAI+    RI++FY+ ++F +G+ V +NDP+L ST   S   A+SPF++AIQ
Sbjct: 276 ANPRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYS---ASSPFIIAIQ 332

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
           NSG + LP IFNA +L  + SA NS++YV SR LY LA +G APKI  + ++ GVPY  +
Sbjct: 333 NSGTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICV 392

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
            +  LF  L Y++VSSGSAK F++ +N+ ++ G  +W+ I + +I F +A + QGI +  
Sbjct: 393 GIVSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDD 452

Query: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKL 548
             + A    +GAY+A  F +LI +I+ FT F   KF+   F   Y+ + ++I  W  +++
Sbjct: 453 LPFKAKLMPWGAYYAAFFILLIIIIQGFTAF-APKFNVSNFFAAYVSVFLFIAVWVIFQV 511

Query: 549 IYKTKVI-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           I+K+++I K  DVD+ +     DR E E  + + +    L
Sbjct: 512 IFKSRLIHKVEDVDIDS-----DRREIEAEVWEDDEPTNL 546

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  328 bits (840), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/514 (37%), Positives = 292/514 (56%), Gaps = 15/514 (2%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           +G+ +N  +K+ELK RHI M                       PV  LIAY F+G L F 
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFS 135

Query: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
               +V    WI+IF V+I  +N+  VK++GEFEFW++S K                   
Sbjct: 196 T--HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
                +GFRYWR+PGA+     +   + G+F  +V+  + + F++ G EL GI   EA N
Sbjct: 254 VTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRK+VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L  T+  S   + SPF+VAIQNS
Sbjct: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TEATSY-VSTSPFIVAIQNS 369

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G KVLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  ++TSK GVPY A+  
Sbjct: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFA 429

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + +F  LAYM  S+G  K+F + +N+  + G  +W+ I I +I F +A + +GI + +  
Sbjct: 430 TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           + A      AY++  F I+I +I+ FT F   KF+  +F+  YI + ++I  W  ++ I+
Sbjct: 490 FKAKLMPGLAYYSSFFMIIIIIIQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIF 548

Query: 551 KTKVI-KSTDVDLYTFKEIYDREEEEGRI-KDQE 582
           + + I K  DVD+ +     DR + E  + +D E
Sbjct: 549 RCRFIWKIEDVDIDS-----DRRDIEAIVWEDHE 577

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 193/571 (33%), Positives = 303/571 (53%), Gaps = 40/571 (7%)

Query: 31  ADNFPVKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAIADGKDENTRLKKELKARHIS 90
           + N  ++E  I ++D+E++                      +G +E  +LK+ L++RH+ 
Sbjct: 80  SSNGTIREDLIMDVDVEKS-------------------PSVEGDNEPHKLKQGLQSRHVQ 120

Query: 91  MXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEMASYIPLDGFTS 150
           +                       P  + I+Y  +  +++  M  LGEM  ++P DG  S
Sbjct: 121 LIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDS 180

Query: 151 YAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVWITI 204
             S      RYVD +LGFA G+ Y + Y IL   + TAA+ V++YW +   V  GVWITI
Sbjct: 181 AGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTA--VPKGVWITI 238

Query: 205 FLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRDP 264
           FL V+V +N+  VK +GE EFW +S K                   P+HDRLGFRYW+ P
Sbjct: 239 FLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHP 298

Query: 265 GAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIVCSEAENPRKSVPKAIKLTV 323
           GAF  + T   GS G FT      +   F++  G EL  +  +E  + R+++ KA +  V
Sbjct: 299 GAFAHHLTG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFV 356

Query: 324 YRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASPFVVAIQNSGIKVLPHIFNA 381
           +R+I FY+     + + V YNDP L++   +GK   A +SPFV+ IQN+GIKVLPHI N 
Sbjct: 357 WRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKP-GAGSSPFVIGIQNAGIKVLPHIING 415

Query: 382 CVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLAYMN 441
           C+L   +SA N+ ++ S+R+L  +A  G+APK   + ++WGVPY A+ +S L  CLAY+N
Sbjct: 416 CILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLN 475

Query: 442 VSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAY 501
           VSS +A +FN+F N+ ++ G L W+   I Y+ F KA    G+   +  +   GQ Y  +
Sbjct: 476 VSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-FDRLPFKTWGQPYTVW 534

Query: 502 FALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV---IKST 558
            +L    +I L   + +F+   +    FI  YI LP++++ W G+KL  +T     +  +
Sbjct: 535 ASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRTWSQWWLPVS 594

Query: 559 DVDLYT-FKEIYD--REEEEGRIKDQEREER 586
           ++D+ T   EI +  RE EE R+     +++
Sbjct: 595 EIDVTTGLIEIEEKSREIEEMRLPPSSFKDK 625

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  328 bits (840), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/514 (37%), Positives = 285/514 (55%), Gaps = 14/514 (2%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            +TR+K+ LK RHI M                       PV  LIAY F+G +++F    
Sbjct: 87  HDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQS 146

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQYW  + 
Sbjct: 147 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK- 205

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            V    WI IF V+I  +N   VK +GEFEFW++S K                       
Sbjct: 206 -VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQG 263

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +GFRYWR+PGA      +      +F  +V+  + + F+Y G EL GI   EA NPRKS
Sbjct: 264 PIGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 323

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           VP+AI   V+RI++FY+ ++F +G+ V YNDPRL ++   S   A+SPFV++IQN+G KV
Sbjct: 324 VPRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSAS---SAVIASSPFVISIQNAGTKV 380

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP IFNA VLV V SA NS++YV SR LYALA  G APK FA  ++ GVPY  +I + L 
Sbjct: 381 LPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALL 440

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             LA++ V+  +   FN+ +N+ ++ G+ +W+ I + +I F +A + +GI +    + A 
Sbjct: 441 GLLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAK 500

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554
              +GAY+A  F  +I  I+ F  F   KFD   F T YI L + ++ +AG +L Y+ + 
Sbjct: 501 FMPWGAYYASFFVTVIIFIQGFQAF-APKFDVSEFFTAYISLILLVVLFAGCQLYYRCRF 559

Query: 555 I-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           + K  D+D+ +     DR E +  + + +  + L
Sbjct: 560 LWKLEDIDIDS-----DRREIDAIVWEDDEPQNL 588

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  327 bits (838), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 196/569 (34%), Positives = 308/569 (54%), Gaps = 22/569 (3%)

Query: 28  KQDADNFP-VKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAIADGKDENTR----LKK 82
           K++A++ P +KE+E+ +   EE +                    A G + + R    +++
Sbjct: 14  KREANSAPTIKEKELVDAQYEEQDTSAAIAANSSIENDG-----AKGTETSPRSRGEVQR 68

Query: 83  ELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEMASY 142
           +LK RHI M                       PV  LI+Y F+G +++     LGEMA++
Sbjct: 69  KLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATF 128

Query: 143 IPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVW 201
           IP+   F+ +A R++ PALG   GY Y   +      +L+    +IQYW     V    W
Sbjct: 129 IPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWT--HAVPLAAW 186

Query: 202 ITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYW 261
           I IF  ++  +N+  VK++GEFEF ++S K                        +GFRYW
Sbjct: 187 IVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYW 246

Query: 262 RDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKL 321
           R+PGA+     +   + G+F  +V+  + + F+Y G EL GI   EA NPRK+VP+AIK 
Sbjct: 247 RNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKK 306

Query: 322 TVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHIFNA 381
            V RI+VFY+ ++F +G+ V YNDP+L  + G  +SA  SPF+++I+NSG KVLP IFNA
Sbjct: 307 VVIRILVFYILSLFFIGLLVPYNDPKL-DSDGTFVSA--SPFMISIENSGTKVLPDIFNA 363

Query: 382 CVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLAYMN 441
            VL+ +FSA NS++Y+ SR LY+L+ +  APK  +  ++ GVPY A++L+ LF  LA++ 
Sbjct: 364 VVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLE 423

Query: 442 VSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAY 501
            S+GS K FN+ +N+  + G  +W+ I   +I F +A + +GI +    Y A    + AY
Sbjct: 424 TSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAY 483

Query: 502 FALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKVI-KSTDV 560
           +A  F  LI LI+ FT F    F    F+  YI + ++ + W  ++L +K ++I K  D+
Sbjct: 484 YASFFIALIVLIQGFTAF-APTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDI 542

Query: 561 DLYTFKEIYDREEEEGRIKDQEREERLQR 589
           D+ + +    RE EE    + E + R QR
Sbjct: 543 DIDSDR----REIEEQVWIEPECKTRWQR 567

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  326 bits (835), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/514 (35%), Positives = 285/514 (55%), Gaps = 14/514 (2%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            +T++K+ LK RH+ M                       PV  LIAY F+G +++F    
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VI+YW   D
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYW--TD 206

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           +V    WI IF V+I  +N   VK +GE EFW++ F                        
Sbjct: 207 KVPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIA-FIKVLAIMGYLLYALIIVCGGSSQG 265

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +GFRYWR+PG +     +   +TG+F  +V+  + + F+Y G EL GI   EA NPRK+
Sbjct: 266 PIGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 325

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           VP+AI   V+RI +FY+ ++F +GM V YND RL ST   S   A+SPFV++IQN+G KV
Sbjct: 326 VPRAINKVVFRIALFYIMSLFFIGMLVPYNDERLAST---SAVIASSPFVISIQNAGTKV 382

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP IFNA V++ + SA NS++YV SR LYALA+ G APK FA  +++GVPY  +I++   
Sbjct: 383 LPDIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSAL 442

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             LA++ V++ +   FN+ +N+ ++ G+ +W+ I I +I F +A + +GI +    + A 
Sbjct: 443 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAK 502

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554
              +GAY+A  F  +I  I+ F  F  H +D   F T YI L +  + + G ++ Y+ + 
Sbjct: 503 LMPFGAYYATFFVTVIIFIQGFQAFSPH-WDTTAFFTSYISLIILAVLFIGCQIFYRCRF 561

Query: 555 I-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
             +  D+D+ +     DR E E  I + +  + L
Sbjct: 562 FWRVEDIDIDS-----DRREIEAVIWEDDEPKTL 590

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  324 bits (831), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/529 (34%), Positives = 290/529 (54%), Gaps = 15/529 (2%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           D +++   +K+ELK RHISM                       P+  LIAY F+G +VF 
Sbjct: 27  DDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFS 86

Query: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               LGEM ++IP+   FT +A R++ PA G A GY Y F + +    +L+    +IQ+W
Sbjct: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                V    WI+I  V++   N+  V+ +GE EFW++S K                   
Sbjct: 147 TMA--VPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAG 204

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
                +GFRYW++PG +     +   +  +F  +V+  + + F++ G EL GI   E + 
Sbjct: 205 VTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQE 263

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRK+VPKAIK  V+RI+VFY+ ++ ++G+ V YNDP+L S        ++SPF++ IQN+
Sbjct: 264 PRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY---VSSSPFIITIQNA 320

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G K+LPHIFNA +L+ + SA NS++Y+ SR LY LA +  APK F  TSK GVPY  ++ 
Sbjct: 321 GTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLF 380

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + +F  LAYM  ++G  K F + +N+V + G  +W+ I   +I F KA + +GI ++   
Sbjct: 381 TSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLP 440

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           Y A    + AY+A+ F ++I +I+ FT F   KF    F   YI + ++I+ W  +++ +
Sbjct: 441 YKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWVAFQIWF 499

Query: 551 KTKVI-KSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFY 598
           K +++ K  DVDL T     DR + E  +   + E++  +N  +  W Y
Sbjct: 500 KCRLVWKLQDVDLDT-----DRRDIEEEVWSDDVEDK-NKNWWDRFWNY 542

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  326 bits (835), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/518 (36%), Positives = 282/518 (54%), Gaps = 21/518 (4%)

Query: 79  RLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGE 138
            LK+ LK+RH+ +                       P  + I+Y  +  +++  M  +GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 139 MASYIP-----LDGFTSY-ASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
           M  Y+P      +GF +Y   +YVD +LGFA  + Y + Y IL   + TAA+ V++YW +
Sbjct: 134 MVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTT 193

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              V    WITIFL  +V +N   VKF+GE EFW +S K                   P+
Sbjct: 194 S--VPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPN 251

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIVCSEAENP 311
           HDRLGFRYW++PG F  +     GS G F       +   F++  G E+  +  SE E+ 
Sbjct: 252 HDRLGFRYWQNPGGFAHHIRG--GSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQ 309

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNS 370
           R+++ KA +  V+R++ FY+     + + VAYNDP L +   ++   A +SPFV+ IQN+
Sbjct: 310 RRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNA 369

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           GIKVLPHI NAC+L   +SA N+ ++ SSR+L  +A +G+AP+IFAK ++WGVPY A+ L
Sbjct: 370 GIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGL 429

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           S    CLAY+N SS +A +FN+F N+  + G + WI + I YI F KA    G+ +S+  
Sbjct: 430 SSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRLP 488

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKL-- 548
           Y A G  Y  Y+ L    +I L   + VF+   +D K F+  YI LPV+ + W G+++  
Sbjct: 489 YTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRVYR 548

Query: 549 --IYKTKVIKS-TDVDLYTFKEIYDREEEEGRIKDQER 583
             I+  K  KS  ++D+ T  E     EE+ R  D  R
Sbjct: 549 RKIFTLKWWKSIEEIDVVTGVE---EIEEKTRECDASR 583

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  325 bits (832), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/527 (35%), Positives = 288/527 (54%), Gaps = 24/527 (4%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           D K E  +L++ L ARHI +                       P  + I+Y  +  +++ 
Sbjct: 49  DAKLEG-KLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYP 107

Query: 132 TMACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 185
            M   GEM  Y+P +G  S  S      RYVDP+L FA G+ Y + Y IL   + TAA+ 
Sbjct: 108 IMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASG 167

Query: 186 VIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 245
           V++YW   D V    WITIFL ++V +N+  VK++GE EFW +S K              
Sbjct: 168 VVKYW--TDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFIL 225

Query: 246 XXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIV 304
                P+HDRLGFRYW++PG F  + T   G+ G F    +  +   F++  G EL  + 
Sbjct: 226 FWGGGPNHDRLGFRYWKNPGGFAHHITG--GNLGNFLDVYSGIIKGAFAFILGPELIALA 283

Query: 305 CSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASP 362
            SE ++ R+++ KA K  V+R++ FY+     + + VA NDP L S    GK   A +SP
Sbjct: 284 SSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKP-GAGSSP 342

Query: 363 FVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWG 422
           FV+ IQN+GIK+LPHI NAC+L   +SA N+ ++ SSR+L  +A +G+APKIF K +++G
Sbjct: 343 FVIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFG 402

Query: 423 VPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 482
           VP+ A+  S L  CLAY+NVSS +A +F +F N+ ++ G + W   L+ Y+ F KA +  
Sbjct: 403 VPWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYN 462

Query: 483 GIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILS 542
           G++ ++  Y    Q+Y  ++++    L+     + VF+   ++   FI  YI LP++++ 
Sbjct: 463 GLE-NRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVL 521

Query: 543 WAGYKLI---YKTKVIKSTDVDLYT-FKEIYDREEEEGRIKDQEREE 585
           W G+K+    +K       ++D+ T   EI    EE  RI D+ER E
Sbjct: 522 WIGHKIYTRDFKKWWYPVEEIDVVTGLTEI----EERTRILDEERVE 564

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  322 bits (826), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/491 (37%), Positives = 273/491 (55%), Gaps = 9/491 (1%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            +TR+K+ LK RHI M                       PV  LIAY F+G +V+F    
Sbjct: 63  HDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQS 122

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQ+W S  
Sbjct: 123 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTSA- 181

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            V    WI IF V +  +N   VK +GE EFW++S K                       
Sbjct: 182 -VPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGS-SQG 239

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +GFRYWR+PG +     +   + G+F  +V+  + + F+Y G EL GI   EA NPRKS
Sbjct: 240 PIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 299

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           VP+AI   V+RI++FY+ ++F +GM V +NDPRL S        A+SPFV++IQN+G +V
Sbjct: 300 VPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVA---VIASSPFVISIQNAGTRV 356

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LPHIFNA V++ + SA NS++YV SR LYAL+  G APK F   ++ GVPY  +I + L 
Sbjct: 357 LPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLL 416

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             LA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A + +GI +    + A 
Sbjct: 417 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAK 476

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554
              +GAY+A  F  +I  I+ F  F   KFD   F T YI L + ++   G +L Y+ + 
Sbjct: 477 LMPWGAYYAAFFVTVIIFIQGFEAF-SPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRF 535

Query: 555 I-KSTDVDLYT 564
           + K  D+D+ T
Sbjct: 536 LWKLEDIDIDT 546

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/527 (35%), Positives = 286/527 (54%), Gaps = 21/527 (3%)

Query: 69  AIADGKDE------NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAY 122
           A +DG DE       T++K+ LK RHI M                       PV  LIAY
Sbjct: 75  AESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAY 134

Query: 123 AFVGLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 181
            F+G +++F    LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++
Sbjct: 135 IFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIS 194

Query: 182 AAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXX 241
               VIQYW     V    WI IF V++  +N   VK +GE EFW++ F           
Sbjct: 195 VIGQVIQYW--TKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIA-FVKVLAIVGYLI 251

Query: 242 XXXXXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELT 301
                         +GFRYWR PGAF     +   +TGKF  +VA  + + F+Y G EL 
Sbjct: 252 YALVIVCGGSHQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELV 311

Query: 302 GIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAAS 361
           GI   EA NPRK+VP+AI   V+RI++FY+ ++F +GM + YND RL     +    A+S
Sbjct: 312 GITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRL---SAQDAVIASS 368

Query: 362 PFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKW 421
           PFV++I+N+  KVLP IFNA V+V V SA NS++YV SR LYALA+ G APK F+  +++
Sbjct: 369 PFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRY 428

Query: 422 GVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 481
           GVPY  ++ +     LA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A + 
Sbjct: 429 GVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKF 488

Query: 482 QGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIL 541
           +GI +    + A    +GAY+A  F  +I  I+ +  F    +D  TF T YI L +  +
Sbjct: 489 RGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFC--PWDVSTFFTSYISLILLAV 546

Query: 542 SWAGYKLIYKTK-VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
              G +L Y+ + ++K  D+D+ T     DR E E  + + +  + L
Sbjct: 547 LVVGCQLYYRGRFLLKLEDIDIDT-----DRREIESIVWEDDEPKTL 588

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  323 bits (827), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/510 (35%), Positives = 287/510 (56%), Gaps = 15/510 (2%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           ++  +K+ LK RHI+M                       PV  LIAY FVG ++F     
Sbjct: 89  KHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQS 148

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEM ++IP+   FT ++ R++ PA G A GY Y F + +    +L+    VIQ+W +  
Sbjct: 149 LGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTA- 207

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            V    WI IF  ++   N+  VK++GE EFW++  K                   P H 
Sbjct: 208 -VPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGP-HG 265

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
             GFRYWRDPGA+     A   S  +F  +V+  + + F+Y G EL GI   EA NPRK+
Sbjct: 266 PFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 325

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           VPKAIK  + RI+ FY+ ++F +GM V +NDP+L S    +   ++SPF++AIQNSG+ +
Sbjct: 326 VPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSA---TSFVSSSPFIIAIQNSGVSL 382

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP IFN  +L+ + SA NS++YV SR L+ LA    AP+ F +T+K GVP+ A++ + LF
Sbjct: 383 LPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLF 442

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             LA++ +++   K+FN+ +++V++ G  +W+ I + +I F KA   +GI ++   + A 
Sbjct: 443 GSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAI 502

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554
              + AY+A +F ILI LI+ FT F   +F+   F+  YI L ++++ W  ++ + K ++
Sbjct: 503 FMPWLAYYATAFIILIILIQGFTAF-APRFNVSDFVASYISLLLFVIIWGVFQAMKKCRI 561

Query: 555 I-KSTDVDLYTFKEIYDREE-EEGRIKDQE 582
             K  D+DL +     DR++ E+ R +D  
Sbjct: 562 FWKVEDIDLDS-----DRKDIEDIRWEDDS 586

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  323 bits (827), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/532 (35%), Positives = 280/532 (52%), Gaps = 24/532 (4%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           +D    LK+ LK+RH+ +                       P  + IAY  +  +++  M
Sbjct: 69  EDYTNTLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIM 128

Query: 134 ACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 187
             +GEM  Y+P DG  S  S      RYVD +L FA G+ Y + Y IL   + TAAA V+
Sbjct: 129 NAVGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVV 188

Query: 188 QYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 247
           +YW     V    WITIFL +I  +N+  VK+FGE EFW +S K                
Sbjct: 189 EYWTLA--VPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFW 246

Query: 248 XXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIVCS 306
              P HDRLGFRYW++PGAF  + T   GS G F    +  +   F++  G EL  +  S
Sbjct: 247 GGGPSHDRLGFRYWKNPGAFAHHVT--DGSLGNFLDIYSGIIKGAFAFILGPELVALTSS 304

Query: 307 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST-KGKSMSAAASPFVV 365
           E  + R+++ KA K  +YR++ FY+     +G+ VA+NDP L S     +  A +SPFV+
Sbjct: 305 ECSDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVI 364

Query: 366 AIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPY 425
            IQN+GI+VLPHI NAC+L   +S+ N+ ++ SSR+L+ +A +G APKIF + +K+GVPY
Sbjct: 365 GIQNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPY 424

Query: 426 NALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 485
            A+ILS L  CLAY+N SS +A++F +  N+ ++ G L WI   I Y+ F KA     + 
Sbjct: 425 MAVILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNL- 483

Query: 486 KSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAG 545
             +  +   GQ Y   ++L+   +I +   +  F+   ++   FI  YI LP+++  + G
Sbjct: 484 YDRMPFKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVG 543

Query: 546 YKLIYKTK--------VIKSTDVDLYT-FKEIYDR--EEEEGRIKDQEREER 586
           +K+    K             D+D+ T   EI  +  E +E RI    R ER
Sbjct: 544 HKVYNHFKNDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRILPTNRWER 595

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/557 (34%), Positives = 292/557 (52%), Gaps = 48/557 (8%)

Query: 19  ENDHDAYYSKQDAD--------------NFPVKEQEIYNIDLEENNVXXXXXXXXXXXXX 64
            N+H  Y +++D D              N  + E+ + ++DLE++               
Sbjct: 49  RNNHQRYDNEKDDDIRMEKISKDQSASSNGTIHEELVMDVDLEKS--------------- 93

Query: 65  XXXFAIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAF 124
                 ADG +E  +LK+ L++RH+ +                       P  + I+Y  
Sbjct: 94  ----PSADGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYII 149

Query: 125 VGLLVFFTMACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPN 178
           +  +++  M  LGEM  ++P DG  S  S      RYVD +LGFA G+ Y + Y IL   
Sbjct: 150 ISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAA 209

Query: 179 QLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXX 238
           + TAA+ V++YW +   V  GVWIT+FL+V+V +N   VK +GE EFW +S K       
Sbjct: 210 ECTAASGVVEYWTTA--VPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGL 267

Query: 239 XXXXXXXXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-G 297
                       P HDRLGFRYW+ PGAF  + T   GS G FT      +   F++  G
Sbjct: 268 IILSFILFWGGGPKHDRLGFRYWQHPGAFAHHLTG--GSLGNFTDIYTGIIKGAFAFILG 325

Query: 298 IELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKS 355
            EL  +  +E  + R+++ KA +  V+R+I FY+     + + V YNDP L++   +GK 
Sbjct: 326 PELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKP 385

Query: 356 MSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIF 415
             A +SPFV+ IQN+GIKVLPHI N C+L   +SA N+ ++ S+R+L  +A  G+APK  
Sbjct: 386 -GAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCL 444

Query: 416 AKTSKWGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYF 475
            K ++WGVPY A+  S L  CLAY+NVSS +A +FN+F N+ ++ G L WI   I Y+ F
Sbjct: 445 GKINRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRF 504

Query: 476 DKACRAQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIG 535
            KA    G+   +  +   GQ Y  +F+L    +I +   + +F+   +    FI  Y+ 
Sbjct: 505 RKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVT 563

Query: 536 LPVYILSWAGYKLIYKT 552
           LP++++ W G+KL  +T
Sbjct: 564 LPIFLVLWLGHKLYTRT 580

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  322 bits (824), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/509 (35%), Positives = 289/509 (56%), Gaps = 13/509 (2%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           ++T++K+ LK RHI M                       PV  LIAY F+G +V+F    
Sbjct: 98  KDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQA 157

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA++IP+    T ++SR++ PA G + GY Y F + I    +++    VI++W ++ 
Sbjct: 158 LGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTK- 216

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            V    WI+IF V++ A+N   V  +GE EFW++S K                       
Sbjct: 217 -VPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGS-KQG 274

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +GFRYWR   A      +   +  +F  +VA  + + F+Y G EL GI   EA NPRKS
Sbjct: 275 PIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKS 334

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           VP+AI   V+RI++FY+ ++F +G+ V YNDP+L S    +   A+SPFV++I+N+G + 
Sbjct: 335 VPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSA---TSYIASSPFVISIENAGTRA 391

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LPHIFNA +++ + SA NS++YVSSR LY+LA+ G APKIFA+ +  GVP+  +I++ L 
Sbjct: 392 LPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALM 451

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             LA++ V++ + + FN+ +N+ ++ G+ +W+ I + ++ F +A + +GI +    + A 
Sbjct: 452 GLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKAR 511

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554
              YG+Y+A  F  +I  I+ FT F   KFD  +F T YI L +  + + G +L Y+ + 
Sbjct: 512 FMPYGSYYACFFITVIIFIQGFTAF-SPKFDVASFFTAYISLILLAVLFIGCQLYYRCRF 570

Query: 555 I-KSTDVDLYTFKEIYDREEEEGRIKDQE 582
             K  D+D+ T +    RE +E   +D E
Sbjct: 571 FWKVEDIDIDTDR----REIDEIVWEDDE 595

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  323 bits (829), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/531 (35%), Positives = 284/531 (53%), Gaps = 21/531 (3%)

Query: 71  ADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 130
           ADG     RLK+ L++RH+ +                       P  + I+Y  +  +++
Sbjct: 153 ADGDAGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIY 212

Query: 131 FTMACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAA 184
             M  LGEM  ++P DG  S  S      RYVD +LGFA G+ Y + Y IL   + TAA+
Sbjct: 213 PIMCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAAS 272

Query: 185 LVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXX 244
            V++YW +   V  GVWITIFL V+V +N   VK +GE EFW +S K             
Sbjct: 273 GVVEYWTTA--VPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFI 330

Query: 245 XXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGI 303
                 P HDRLGFRYW+ PG+F  +     GS G FT      +   F++  G EL  +
Sbjct: 331 LFWGGGPKHDRLGFRYWQHPGSFAHHLAG--GSLGNFTDIYTGIIKGAFAFILGPELVCM 388

Query: 304 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAAS 361
             +E  + R+++ KA +  V+R+I FY+     + + V YNDP L++   +GK   A +S
Sbjct: 389 TSAECADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKP-GAGSS 447

Query: 362 PFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKW 421
           P+V+ IQN+GIKVLPHI N C+L   +SA N+ ++ S+R+L  +A  G+APK   K +++
Sbjct: 448 PYVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRF 507

Query: 422 GVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 481
           GVPY A+ +S L  CLAY+NVSS +A +FN+F N+ ++ G L WI   I Y+ F KA   
Sbjct: 508 GVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFF 567

Query: 482 QGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIL 541
            G+   +  +   GQ Y  +F+L+   +I +   + +F+   ++   FI  YI LP++++
Sbjct: 568 NGL-YDRLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLV 626

Query: 542 SWAGYKLIYKT-----KVIKSTDVDLYTFK-EIYDREEEEGRIKDQEREER 586
            W G+KL  +T       +   DV     + E   R+ EE R+     +E+
Sbjct: 627 LWLGHKLYTRTWNHWWHSVSEIDVTTGLVEIEEKSRDIEELRLPPATFKEK 677

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  321 bits (823), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/531 (36%), Positives = 288/531 (54%), Gaps = 25/531 (4%)

Query: 80  LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEM 139
           LKK L++RHI +                       P  +L +Y  + L+++  M  LGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 140 ASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
             ++P     S  S      RY DP+LGFA G+ Y + Y IL   + TAA+ V+ YW + 
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
             V  G WI IFL V+  +N   VK +GE EFW +  K                   P H
Sbjct: 225 --VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTH 282

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIVCSEAENPR 312
           DRLGFRYW+ PGAF  + T  TG+TG+F       +   F++  G EL  I  SEA + R
Sbjct: 283 DRLGFRYWQHPGAFAYHIT--TGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDAR 340

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASPFVVAIQNS 370
           +++ KA +   YR++ FY+ +   +G+ V+  DP L +   +GK+  A +SPFV+AIQN+
Sbjct: 341 RNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKA-GAGSSPFVIAIQNA 399

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            IKVLPHI NAC+L   +S+ NS ++ +SR+L ++A DG AP+I  + ++ GVPY A+ L
Sbjct: 400 HIKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVAL 459

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           S  F CLA++NVSSGSAK F +F N+ ++ G + WI I + Y+ F KA   +G+ + +  
Sbjct: 460 SAAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGLYE-RVP 518

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKL-- 548
           + +P Q YG YF +    LI L   +  F+   ++   F+  YI LP++++ W G+K+  
Sbjct: 519 FKSPLQPYGTYFFIVVVSLICLTNGYASFV--NWNASDFVAAYITLPIFVVLWVGHKIYT 576

Query: 549 -IYKTKVIKSTDVDLYT-FKEIYDREEEEGRIKDQEREERLQRNGKNMEWF 597
             + T ++   +VD+ T   EI    EEE +I D +R        K  +W 
Sbjct: 577 RTWSTWLLPVAEVDVTTGLAEI----EEETKILDAQRIPPANAWQKFEQWL 623

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  320 bits (819), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/514 (36%), Positives = 281/514 (54%), Gaps = 15/514 (2%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           E+  +K+ LK RHI M                       PV  LI+Y F+G +V+F    
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQYW   D
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYW--TD 220

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           +V   VWI IF V+I  +N   VK +GEFEFW++S K                       
Sbjct: 221 KVPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-HQG 279

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +GFRYWR+PGA+     +   + G+F  +V+  + + F+Y G EL GI   EA NPRK+
Sbjct: 280 PIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 339

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           VP+AI   V+RI++FY+ ++F +G+ V YN+PRL ++   S   A+SPFV++IQN+G   
Sbjct: 340 VPRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSAS---SAVIASSPFVISIQNAGTYA 396

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP IFNA VL+ V SA NS++YV SR LY+LA  G APK F   +K GVPY  ++ +   
Sbjct: 397 LPDIFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAAL 456

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             LA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A   +GI +    + A 
Sbjct: 457 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAK 516

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554
              YGAY+A  F  +I  I+ F  F    F    F T YI L +  + + G +L YK + 
Sbjct: 517 LMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSDFFTSYISLILLAVVFTGCQLYYKCRF 574

Query: 555 I-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           I K  D+D+ T     DR E E  I + +  + L
Sbjct: 575 IWKLEDIDIDT-----DRREIEAIIWEDDEPKNL 603

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  319 bits (817), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/490 (38%), Positives = 267/490 (54%), Gaps = 9/490 (1%)

Query: 71  ADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 130
           A G  E  ++K+ELK RHI M                       PV  LIAY F+G LVF
Sbjct: 93  ATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVF 152

Query: 131 FTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
                LGEMA++IP+   FT +ASR+V    G A GY Y F + I    +L+    VI++
Sbjct: 153 SVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEF 212

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W  +  V    WI+IF V+IV +N   VK +GEFEFW++S K                  
Sbjct: 213 WTFK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGA 270

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
                 +GFRYWR PG +     +   +  +F  +V+  + + F+Y G EL GI   EA 
Sbjct: 271 GITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAA 329

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRKSVP+AIK    RI++FY+ ++F +G+ V YNDP+L ST       +ASPF++AIQN
Sbjct: 330 NPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSY---VSASPFIIAIQN 386

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
           SG KVLPHIFNA +L  + SA NS++YV SR LY L+    APK F KT   GVP+ A++
Sbjct: 387 SGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVL 445

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
            +  F  LAYM  S+G    FN+ +N+  + G  +W++I I +I F +  + +G+ +   
Sbjct: 446 FTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDL 505

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549
            Y A      AY+   F  LI LI+ FT F   KFD   F+T YI   +++  +   +  
Sbjct: 506 PYKAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCY 564

Query: 550 YKTKVIKSTD 559
           ++T++ ++ D
Sbjct: 565 FRTRLWRTLD 574

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/532 (35%), Positives = 290/532 (54%), Gaps = 23/532 (4%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           DEN  L+K L +RHI +                       P+ + +++  +  +V+  M 
Sbjct: 42  DEN-NLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMN 100

Query: 135 CLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            L EM  Y+P  G      SRYVDP+LGFA G+ Y + Y IL   +L+AAA V+QYW   
Sbjct: 101 TLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYW--T 158

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D+V+  VWITIFLV++V +N   VKF+GE EFW +S K                   P H
Sbjct: 159 DKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSH 218

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIVCSEAENPR 312
           DRLGFRYW +PG F  + T   G+TG+F       + S F++    EL G+ C EA++ R
Sbjct: 219 DRLGFRYWNNPGPFAYHITG--GNTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTR 276

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST-KGKSMSAAASPFVVAIQNSG 371
           +++ KA +  ++RII FY+ +   +G  ++ +DP+L+      +  AA+SPFV  I N+G
Sbjct: 277 RNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAG 336

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           I VL HI NA +L   +S+ NS +Y SSR++ ALA  G APK+F + ++ GVPYNA+ LS
Sbjct: 337 IPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALS 396

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
               CL Y+N SS SA++F +  N+ ++ G + W  I I Y+ F KA     + + +  +
Sbjct: 397 TAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNLYE-RVPF 455

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            +  Q Y  YF + F +L+ L   +  F+   ++   F+  YI LP++ L + G+K+ +K
Sbjct: 456 KSALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFK 515

Query: 552 TK-VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFL 602
           T+  I   ++D+ T   + D EEE    +         R  KNM   +EKF+
Sbjct: 516 TRWYIPFREIDVIT--GLADAEEEAKMTQP--------RTPKNM---WEKFM 554

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/518 (34%), Positives = 285/518 (55%), Gaps = 13/518 (2%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           +G    T +K+ LKARHISM                       PV  LIAY F+G +V+ 
Sbjct: 52  EGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYS 111

Query: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +L+    +I YW
Sbjct: 112 ITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYW 171

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
            S   V  G WITIF +++  +N   V+F+GE EFW++S K                   
Sbjct: 172 TSV--VPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGS 229

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
                +GFR WR+PG +     +   +  +F  +V+  + + F+Y G EL GI   E++N
Sbjct: 230 -SQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKN 288

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRK+VPKAI    +RI+ FY+ ++F +G+ V YNDPR+ +T    ++A  SPFV++I+N+
Sbjct: 289 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNA--SPFVISIRNA 346

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G K+LP IFNA VLV V SA NS++Y+ SR +Y+LA  G APK F   ++ GVP   +++
Sbjct: 347 GTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMV 406

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + L   +A++ V++ +   FN+ VN+ ++ G+ +W+ I + +I F +  + +GI +    
Sbjct: 407 TALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALP 466

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           + A    + AY+A SF  +I  I+ +T F   KFD   F T YI L + ++ + G ++ Y
Sbjct: 467 FKAKFMPWAAYYAASFVFVIIFIQGYTAF-SPKFDVTQFFTAYISLMLMLVVFIGCQIYY 525

Query: 551 KTKVI-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           K + + K  D+D+ T     +R E +  + + +  + L
Sbjct: 526 KCRFLWKLEDIDIDT-----NRREIDAIVWEDDEPKNL 558

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/520 (35%), Positives = 279/520 (53%), Gaps = 14/520 (2%)

Query: 70  IADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 129
           + +G+     +K+ LK RHI M                       PV  LIAY F+  LV
Sbjct: 67  VKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLV 126

Query: 130 FFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 188
           +  +  LGEMA++IP+   FT ++SR++ PA G A GY Y F + I    +L+    +I+
Sbjct: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186

Query: 189 YWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 248
           +W +   V    WITIF V++   N+  VK++GEFEFW++  K                 
Sbjct: 187 FWTTA--VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG 244

Query: 249 XXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
                  +GFRYWR+PGA+     +   + G+F  +V+  + + F+Y G EL GI   EA
Sbjct: 245 AGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
            NPRKSVP+AIK  V+RI+VFY      +G+ V YNDP+L          ++SPF++AI+
Sbjct: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIE 360

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
           NSG KVLPHIFNA VL  + SA NS++YV SR +Y LA    AP  F +T+  GVPY A+
Sbjct: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
             +  F  LAYM +S+G A  FN+ +N+  + G  +W+ I   +I F +A + +GI +  
Sbjct: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480

Query: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKL 548
             + A    + AY+AL F ++I LI+ FT F    F    F   Y+ + ++I  W G ++
Sbjct: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQI 539

Query: 549 IYKTKVIKSTD-VDLYTFKEIYDREEEEGRIKDQEREERL 587
            ++ ++    D VD+ T     DR + E  + D E  + L
Sbjct: 540 WFRCRIFHRLDEVDIDT-----DRRDIEAVVWDDEPPKTL 574

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  318 bits (814), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/511 (36%), Positives = 277/511 (54%), Gaps = 15/511 (2%)

Query: 79  RLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGE 138
            +K+ LK RHI M                       PV  LIAY F+G +++F    LGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 139 MASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVN 197
           MA++IP+    T ++ R++ PA G + GY Y F + I    +++    VIQYW   D+V 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYW--TDKVP 222

Query: 198 PGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 257
              WI IF V+I  +N   VK +GEFEFW++S K                        +G
Sbjct: 223 LAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPIG 281

Query: 258 FRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPK 317
           FRYWR+PGA+     +   S G+F  +V+  + + F+Y G EL GI   EA NPRK+VP+
Sbjct: 282 FRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 318 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPH 377
           AI   V+RI++FY+ ++F +G+ V YN+PRL  +   S   A+SPFV++IQN+G   LP 
Sbjct: 342 AINKVVFRIVIFYIMSLFFIGLLVPYNEPRLSPS---SAVIASSPFVISIQNAGTYALPD 398

Query: 378 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCL 437
           IFNA VL+ V SA NS++YV SR LY+LA  G APK F   +K GVPY  ++ +     L
Sbjct: 399 IFNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLL 458

Query: 438 AYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQR 497
           A++ V++ +   FN+ +++ ++ G+ +W+ I + +I F +A + +GI +    + A    
Sbjct: 459 AFLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMP 518

Query: 498 YGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKVI-K 556
           YGAY+A  F  +I  I+ F  F    F    F T YI L +  + +   +L YK + I K
Sbjct: 519 YGAYYASFFVTIIIFIQGFQAFC--PFSVSEFFTSYISLILLAVVFISCQLYYKCRFIWK 576

Query: 557 STDVDLYTFKEIYDREEEEGRIKDQEREERL 587
             D+D+ +     DR E E  I + +  + L
Sbjct: 577 LEDIDIDS-----DRREIEAIIWEDDEPKNL 602

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  317 bits (812), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/520 (34%), Positives = 283/520 (54%), Gaps = 19/520 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           E+ ++K+ELK RHI M                       PV  LIAY F+G +V+F    
Sbjct: 80  EDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQA 139

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQYW   D
Sbjct: 140 LGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYW--TD 197

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            V    WI IF V++  +N   VK +GE EFW++  K                       
Sbjct: 198 AVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQG 257

Query: 255 RLGFRYWRDPGAFKEYSTA------ITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
            +GFRYWR+PGA+    T+       +   G+F  +VA  + + F+Y G EL GI   EA
Sbjct: 258 PIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEA 317

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
            NPRK+VP+AI   V+RI++FY+ ++F +G+ V + D RL      +   A+SPFV++I+
Sbjct: 318 ANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRL---SDDTTVIASSPFVISIE 374

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
           N+G K+LP IFNA V+V V SA NS++YV SR LY+LA    APKIFA+ ++ GVP+  +
Sbjct: 375 NAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGV 434

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
           I + L   LA++ V + +   FN+ V++ ++ G+ +W+ I + ++ F +  + +GI +  
Sbjct: 435 ICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDD 494

Query: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKL 548
             + A    +G+Y+A  +  +I  ++ F  F  H FD  TF T YI L +  + + G +L
Sbjct: 495 LPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPH-FDVTTFFTDYISLILLAVVFIGAQL 553

Query: 549 IYKTKVI-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
            Y+ + + K  DVD+ +     DR E E  I + +  + +
Sbjct: 554 YYRCRFLWKLEDVDIDS-----DRREIEDAIWEDDEPKTI 588

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  315 bits (807), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 185/534 (34%), Positives = 287/534 (53%), Gaps = 23/534 (4%)

Query: 73  GKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFT 132
           G + NT L K L++RHI +                          +L+++  +  +V+  
Sbjct: 40  GSEYNT-LHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPI 98

Query: 133 MACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
           M  L EM  Y+P  G      SRYVDP+LGFA G+ Y + Y IL   +L+AAA V+ YW 
Sbjct: 99  MCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYW- 157

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
             + V    WITIFLVV+V +N   VK++GE EFW +S K                   P
Sbjct: 158 -DNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAP 216

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIVCSEAEN 310
           +HDR GFRYW++PG F    +   GSTG+F       + S F++    EL GI C EA++
Sbjct: 217 NHDRTGFRYWKNPGPFAM--SLAPGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQD 274

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLL-STKGKSMSAAASPFVVAIQN 369
            R++  KA +  +YRII FY+    ++G+ ++  DP+L+ + +  +  AA+SPFV  I N
Sbjct: 275 TRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIAN 334

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
           +GI VL H+ N  +L   +SA NS +Y S+R + ALA +G APK   K +++GVPYNA+I
Sbjct: 335 AGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVI 394

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           +  L  CLAY+NV + SA +F +  N+ ++ G + W  + I +I F +      + +S+ 
Sbjct: 395 VCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNNL-QSRI 453

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549
            Y  P Q Y AY+     +++ L   F VFL  +++   F+  Y+ LP+Y++ + G+KL 
Sbjct: 454 PYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLW 513

Query: 550 YKTK-VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFL 602
           ++T+  I    +D+ T   + + EEE      +    R+ +N       +EKFL
Sbjct: 514 FRTRWYIPVEQIDVIT--GLVEAEEE-----SKMTPPRIPKN------LWEKFL 554

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  315 bits (807), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 178/486 (36%), Positives = 269/486 (55%), Gaps = 8/486 (1%)

Query: 71  ADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 130
            +G    T +K+ LK RHISM                       PV  LIAY F+G +V+
Sbjct: 47  GEGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVY 106

Query: 131 FTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
           F    LGEMA++IP+    T ++ R++ PA G A GY Y F + I    ++     VIQY
Sbjct: 107 FVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQY 166

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W   D V    WI IF V++   N   VKF+GE EFW++S K                  
Sbjct: 167 W--TDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGG 224

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
                 +GFRYWR+PG +     +   + G+F  +V+  + + F+Y G EL GI   EA 
Sbjct: 225 S-HQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 283

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRK+VP+AI    +RI+ FY+ ++F +G+ V Y+D RL +T   +   A+SPFV++IQN
Sbjct: 284 NPRKTVPRAINKVFFRILFFYILSLFFIGLLVPYDDLRLSNT---TAVIASSPFVISIQN 340

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
           +G KVLPHIFNA V++ + SA NS++YV SR LY+LA+ G APK F   +K GVPY  +I
Sbjct: 341 AGTKVLPHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVI 400

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           ++ L   LA++ V++ + + FN+ VN+ ++ G+ +W+ I + ++ F +  + +GI +   
Sbjct: 401 VTALLGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDL 460

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549
            + A    +GAY+A  F  +I +I+ F  F   KF    F T YI L +  + + G +L 
Sbjct: 461 PFKAKLMPWGAYYAAFFIGVIIIIQGFKAFT-PKFRVSDFFTSYISLILLAVLFLGCQLF 519

Query: 550 YKTKVI 555
           Y+ + I
Sbjct: 520 YRCRFI 525

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  315 bits (808), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 189/538 (35%), Positives = 289/538 (53%), Gaps = 22/538 (4%)

Query: 71  ADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 130
           AD       L++ LK+RHI M                       P  + I+Y  +  +V+
Sbjct: 68  ADPFANEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVY 127

Query: 131 FTMACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAA 184
             M   GEM  Y+P +G  +  S      RYVD +LGFA  + Y + Y IL   + TAA+
Sbjct: 128 PIMCGFGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAAS 187

Query: 185 LVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXX 244
            V++YW     V  GVWI IFL ++V +N   VK++GE EFW +S K             
Sbjct: 188 GVVEYWTVA--VPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFI 245

Query: 245 XXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGI 303
                 P+HDRLGFRYW+ PGAF E+   + G  G+F    +  +   F++  G EL  +
Sbjct: 246 LFWGGGPNHDRLGFRYWQRPGAFTEH--IMKGGFGRFLDIYSGVIKGGFAFILGPELVCL 303

Query: 304 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAAS 361
             +E E+ R+++ KA +  ++R++ FY+     + + VAYNDP L+S    GK   A +S
Sbjct: 304 TSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKP-GAGSS 362

Query: 362 PFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKW 421
           PFV+ IQN+GI+VLPHI NAC+L   +SA N+ ++ S+R+L  +A +G AP++F K +++
Sbjct: 363 PFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRF 422

Query: 422 GVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 481
           GVPY A+ LS    CLA++NVSS +A +FN+F N+ ++ G + WI   + YI F KA   
Sbjct: 423 GVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFF 482

Query: 482 QGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIL 541
            G+   +  +   GQ Y  Y++L    LI L   +  F+   +    F+  YI LP++++
Sbjct: 483 NGM-YDRLPFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVV 541

Query: 542 SWAGYKLIYKT---KVIKSTD-VDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNME 595
            W G+KL  +T   +  +  D +D+ T   + D EE   +I D+ R E   R  K M+
Sbjct: 542 LWVGHKLWTRTFTKRWWRRVDQIDVTT--GLVDIEERT-KILDETRVEPSTRWQKFMD 596

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  316 bits (810), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 179/504 (35%), Positives = 275/504 (54%), Gaps = 16/504 (3%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
              N  LK+ LK+RHI +                       P  + I+Y  +   V+  M
Sbjct: 90  SSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIM 149

Query: 134 ACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 187
             LGEM  ++P +G  S  S      +YVDP+LGFA  + Y + + IL   +++AA+ VI
Sbjct: 150 NALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVI 209

Query: 188 QYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 247
           +YW   + V  G WITIFL +IV +N + V  +GE EFW +S K                
Sbjct: 210 EYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFW 269

Query: 248 XXXPDHDR-LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIVC 305
              P  D  LGFRYW++PG+F  + T   G  G F       +   FS   G EL  +  
Sbjct: 270 GGGPKSDGILGFRYWKNPGSFAHHITG--GGGGNFLDIYTGIIKGGFSVILGPELVCLTS 327

Query: 306 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAA-ASPFV 364
           SE  + R+++ KA K  V+R++ FY+     +G+ VAYNDP L +   +S + A +SPFV
Sbjct: 328 SECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFV 387

Query: 365 VAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVP 424
           + IQN+GI+ +PHI N C+L   +SA N+ ++ SSR+L  +A +G APKIF + ++ GVP
Sbjct: 388 IGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVP 447

Query: 425 YNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGI 484
           Y A+  S+L  CLAY+NVSS +A +FN+F N+ ++ G + WI   + YI F KA     +
Sbjct: 448 YTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKL 507

Query: 485 DKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWA 544
              +  + A GQ+Y  +++L +  LI L   + +F+   ++ K FI  YI LP++I+ W 
Sbjct: 508 TH-RIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWI 566

Query: 545 GYKLIYKTKV---IKSTD-VDLYT 564
           G+K+  +T +   ++  D +D+YT
Sbjct: 567 GHKVFTRTLLKAWLRPIDKIDVYT 590

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  315 bits (806), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 180/516 (34%), Positives = 281/516 (54%), Gaps = 14/516 (2%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           KDE   +K++L  RHI+M                       PV  LIAY F+G +V+   
Sbjct: 54  KDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVT 113

Query: 134 ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             LGEMA++IP+   FT ++ R++ PALG A GY Y F + +    +L+    +IQ+W  
Sbjct: 114 QSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTF 173

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              V    WI+IF V++   N+  V+ +GE EFW++  K                     
Sbjct: 174 A--VPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-K 230

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +GFRYWR+PG +     +   +  +F  + +  + + F++ G EL GI   EA NPR
Sbjct: 231 TGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPR 290

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           ++VPKAI+  V+RI+VFY+ ++F +G+ V Y+D +L   K ++   ++SPF++AI+NSG 
Sbjct: 291 QTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL---KSENSYVSSSPFIIAIENSGT 347

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           K+LPHIFN  +LV + SA NS++Y+ SR L+ LA +G  PK+FAKT+K GVP  A++ + 
Sbjct: 348 KILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTS 407

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           LF  LA+M  S+G  + F + +NVV + G  SW+ I   +I F +  +++GI ++   + 
Sbjct: 408 LFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFK 467

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKT 552
           A    Y AY+A    I+I   + FT F   KFD   F   YI + ++ + W  ++L +K 
Sbjct: 468 AKFMPYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWFKC 526

Query: 553 K-VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           + V K  D+D+       DR E E R+        L
Sbjct: 527 RYVWKLVDIDIDK-----DRREIEDRVWQDTTPANL 557

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  315 bits (806), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 178/517 (34%), Positives = 286/517 (55%), Gaps = 12/517 (2%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
            E   +K++LK RHI M                       PV  LI+Y F+G +++    
Sbjct: 61  QERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQ 120

Query: 135 CLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            LGEM ++IP+   F+ +A R++ PALG   GY Y   +      +L+    VIQYW   
Sbjct: 121 SLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWT-- 178

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           + V    WI IF  ++ ++N+  VK++GEFEF ++S K                      
Sbjct: 179 EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSD 238

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +GFRYWR+PGA+     +   + G+F  +V+  + + F+Y G EL GI   EA NPRK
Sbjct: 239 GPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 298

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           ++P+AIK  V RI+VFY+ ++F +G+ V YNDP+L S     +  ++SPF+++I+NSG K
Sbjct: 299 ALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS---DGIFVSSSPFMISIENSGTK 355

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           VLP IFNA VL+ + SA NS++Y+ SR LY+L+ +  AP+  +  ++ GVPY +++ + +
Sbjct: 356 VLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSV 415

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  LA++ VS+GS K FN+ +N+  + G  +W+ I   +I F +A R +GI +    Y A
Sbjct: 416 FGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKA 475

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK 553
               + AY+A  F  LI LI+ FT F    F    F+  YI + +++  W  +++ +K +
Sbjct: 476 QMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSFQVWFKCR 534

Query: 554 VI-KSTDVDLYTFKEIYDREEEEGRIKDQEREERLQR 589
           ++ K  D+D+ + +    R+ EE    + E + R QR
Sbjct: 535 LLWKLQDIDIDSDR----RQIEELVWIEPECKTRWQR 567

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  315 bits (806), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 184/517 (35%), Positives = 281/517 (54%), Gaps = 15/517 (2%)

Query: 73  GKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFT 132
           G  ++TR+K+ LK RHI M                       PV  LIAY F+G +++F 
Sbjct: 87  GHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFI 146

Query: 133 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
              LGEMA++IP+    T ++ R++ PA G   GY Y F + I    +++    VIQYW 
Sbjct: 147 TQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYW- 205

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
             D V    WI IF V +  +N   VK +GE EFW++S K                    
Sbjct: 206 -TDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGS- 263

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
               +GFRYWR+PG +     +   + G+F  +V+  + + F+Y G EL GI   EA NP
Sbjct: 264 SQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 323

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RKSVP+AI   V+RI +FY+ ++F +G+ V YND  L  + G S   A+SPFV++IQN+G
Sbjct: 324 RKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTL--SSGDSY-IASSPFVISIQNAG 380

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
              LP IFNA V++ + SA NS++YV SR LYALA  G APK FA  +K GVP+  +I++
Sbjct: 381 TYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVT 440

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
                LA++ V++ +   FN+ +N+ ++ G+ +W  I + +I F +A + +GI +    +
Sbjct: 441 ASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPF 500

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            A    +GAY++  F  +I  I+ F  F    +D  TF T YI L + ++ + G +L Y+
Sbjct: 501 KAKLMPWGAYYSAFFVFVIIFIQGFEAF--TPWDTTTFFTSYISLILLVVVFIGCQLYYR 558

Query: 552 TK-VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
            + ++K  D+D+ T     DR E E  I + +  + L
Sbjct: 559 CRFLLKVEDIDIDT-----DRREIEAIIWEDDEPKNL 590

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  315 bits (807), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 185/514 (35%), Positives = 280/514 (54%), Gaps = 15/514 (2%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           E+  +K+ LK RHI M                       PV  LIAY F+G +V+F    
Sbjct: 102 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQS 161

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA++IP+    T ++ R++ PA G + GY Y F + I    +++    VI+YW   D
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYW--TD 219

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           +V    WI IF V+I  +N   VK +GEFEFW++S K                       
Sbjct: 220 KVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGS-HQG 278

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +GFRYWR+PGA+     +   S G+F  +V+  + + F+Y G EL GI   EA NPRK+
Sbjct: 279 PIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 338

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           VP+AI   V+RI++FY+ ++F +G+ V YND RL ++   S   A+SPFV++IQN+G   
Sbjct: 339 VPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSAS---SAVIASSPFVISIQNAGTYA 395

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP IFNA VL+ V SA NS++YV SR LY+LA  G APK F   ++ GVPY  ++ +   
Sbjct: 396 LPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAAL 455

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             LA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A + +GI +    + A 
Sbjct: 456 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAK 515

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554
              YGAY+A  F  +I  I+ F  F    F    F T YI L +  + + G ++ YK + 
Sbjct: 516 LMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSEFFTSYISLILLAVVFIGCQIYYKCRF 573

Query: 555 I-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           I K  D+D+ +     DR E E  I + +  + L
Sbjct: 574 IWKLEDIDIDS-----DRREIEAIIWEDDEPKNL 602

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  313 bits (801), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 180/517 (34%), Positives = 280/517 (54%), Gaps = 14/517 (2%)

Query: 73  GKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFT 132
           G+  +T +K+ LK RHI M                       PV MLIAY F+  + F  
Sbjct: 67  GEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSV 126

Query: 133 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
           M  LGEMA+YIP+   F+ ++ R++ PA G A GY Y F + I    +L+    ++QYW 
Sbjct: 127 MQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWT 186

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
            +  V    WI+IF V+I  +N   VKF+GEFEFW++  K                    
Sbjct: 187 FK--VPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAG- 243

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
               +GFRYWR   AF +   +   +  +F  +V+  + + F+Y G EL GI   EA NP
Sbjct: 244 KTGPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 303

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RK+VPK+IK T++RI++FY+ ++  +G+ V +ND  L  ++     AA+SPF++AI+NSG
Sbjct: 304 RKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSY---AASSPFILAIKNSG 360

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
            K LP IFNA +L  V SA NSD+YV SR +Y++A +  AP I AK SK GVPY A++ +
Sbjct: 361 TKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFT 420

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
                LAY+  SS  A +FN+ +N+  + G  SW  I   ++ F KA + +GI ++   +
Sbjct: 421 SAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPF 480

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            A    + A ++  F  LI L++ FT F  H F    F+  YI + ++ + WA +++ ++
Sbjct: 481 KASFMPWIAIYSFFFMTLIILVQGFTCFTPH-FQASDFVASYISVGLFFVIWAVFQIWFR 539

Query: 552 TK-VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
              ++   ++D+ T     DR + +  + + E  + L
Sbjct: 540 CPLLVPIAEIDIDT-----DRRDVDAEVWEDEPPKTL 571

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  314 bits (804), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 186/514 (36%), Positives = 281/514 (54%), Gaps = 15/514 (2%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           E+  +++ LK RHI M                       PV  LIAY F+G +V+F    
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA++IP+    T ++ R++ PA G + GY Y F + I    +++    VI+YW ++ 
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTK- 220

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            V  GVWI IF V+I  +N   VK +GEFEFW++S K                       
Sbjct: 221 -VPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQG 278

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +GFRYWR+PGA+     +   + G+F  +V+  + + F+Y G EL GI   EA NPRK+
Sbjct: 279 PIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 338

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           VP+AI   V+RI++FY+ ++F +G+ V Y DPRL ++   S   A+SPFV++IQN+G   
Sbjct: 339 VPRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSAS---SAVIASSPFVISIQNAGTYA 395

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP IFNA VL+ V SA NS++YV SR LY+LA  G APK F   +K GVPY  ++ +   
Sbjct: 396 LPDIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAAL 455

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             LA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A   +GI +    + A 
Sbjct: 456 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAK 515

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554
              YGAY+A  F  +I  I+ F  F    F    F T YI L +  + + G +L YK + 
Sbjct: 516 FMPYGAYYASFFVTVIIFIQGFQSFC--PFRVADFFTSYISLILLAVVFTGCQLYYKCRF 573

Query: 555 I-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           I K  D+D+ +     DR E E  I + +  + L
Sbjct: 574 IWKLEDIDIDS-----DRREIEAIIWEDDEPKNL 602

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  311 bits (798), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 170/487 (34%), Positives = 271/487 (55%), Gaps = 7/487 (1%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           K   + +K+ELK RH++M                       PV  L+AY FV  + +   
Sbjct: 43  KPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVT 102

Query: 134 ACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             LGEMA++IP+   FT +ASR+V PALG A GY Y   + I    +++    +I YW  
Sbjct: 103 QSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW-- 160

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
            D V    W+ IF V++ AIN++ VKF+GEFEFW++S K                     
Sbjct: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-K 219

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
             R+GFRYW+DPG +     +    T +F  +V+  + + F++ G EL G+   E +NPR
Sbjct: 220 LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           ++VPKAI    +RI++FY+ ++ ++G+ V Y+DP+L+   G + +A ASPFVVAI  +G 
Sbjct: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ-DGSTTNANASPFVVAINAAGT 338

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           KVLP I N  ++V + SA NS++YV SR LY L   G AP   ++T+  GVPY A++ + 
Sbjct: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           +F  L Y+NVSS S  +F++ +++ ++ G  +W+ I + +I F +  + +GI +    + 
Sbjct: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKT 552
           A    YGAY+A  F I+I L++ FT F    F    F+  YI   ++++ W  ++ ++K 
Sbjct: 459 AKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKG 516

Query: 553 KVIKSTD 559
           +   + D
Sbjct: 517 RWFHTVD 523

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  313 bits (801), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 168/489 (34%), Positives = 276/489 (56%), Gaps = 8/489 (1%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           +G  ++  +K+ LK RHISM                       PV  LIAY F+G + +F
Sbjct: 74  EGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYF 133

Query: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               LGEMA++IP+   FT +  R++ PA G A GY Y F + I    +L+    +IQ+W
Sbjct: 134 VTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFW 193

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                V  G WI IF V++   N+  VK++GE EFW++  K                   
Sbjct: 194 TFA--VPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG 251

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
                +GFRYWR+PG +     +   + G+F  +V+  + + F+Y G EL GI   E++N
Sbjct: 252 -KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKN 310

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PR++VP+AI    +RI+ FY+ ++  +G+ V +NDP+L   K +    ++SPFV+AI+NS
Sbjct: 311 PRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENS 367

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G KVLPHIFNA +L  + SA NS++YV SR LY LA +  APK+FA+ +K GVPY +++ 
Sbjct: 368 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLG 427

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           +  F  LAY+N+S+ + K+F++ +N+ ++ G  +W+ I + +I F +  + + + ++   
Sbjct: 428 TAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLP 487

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           + A    +GAY++  F  LI +I+ FT F   KF+   F   YI + +++  W  +++ +
Sbjct: 488 FKAKFMPWGAYYSAFFISLIIIIQGFTAF-APKFNVSNFFAAYISVFLFLAIWVVFQIRF 546

Query: 551 KTKVIKSTD 559
           +T+ I + +
Sbjct: 547 RTRFILTKN 555

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  311 bits (798), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 182/516 (35%), Positives = 286/516 (55%), Gaps = 12/516 (2%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           +   +K++LK RHI M                       PV  LI+Y F+G +++     
Sbjct: 62  KGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQS 121

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA++IP+   F+ +A R++ PALG   GY Y   +      +L+    +IQYW   D
Sbjct: 122 LGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWT--D 179

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            V    WI IF  ++  +N+  VK++GEFEF ++S K                       
Sbjct: 180 AVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGG 239

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +GFRYWR+PGA+     +   + G+F  +V+  + + F+Y G EL GI   EA NPR++
Sbjct: 240 PIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRA 299

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           VP+AIK  V RI+VFY+ ++F +G+ V YNDP+L  ++G  +S+  SPF+++I+NSG KV
Sbjct: 300 VPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSEGTFVSS--SPFMISIENSGTKV 356

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP IFNA VL+ + SA NS++Y+ SR LY+L+ +  AP+  +  +K GVPY A++ +  F
Sbjct: 357 LPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAF 416

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             LA++  S+GS K+FN+ +N+  + G  +W+ I + +I F +A + +GI +    Y A 
Sbjct: 417 GFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRAR 476

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK- 553
              + AY+A  F  LI LI+ FT F    F    FI  YI + ++I  W  +++ +K + 
Sbjct: 477 MMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRF 535

Query: 554 VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQR 589
           V K  DVD+ + +    R+ EE    + E + R Q 
Sbjct: 536 VWKLQDVDIDSDR----RDIEEQVWIEPECKTRWQH 567

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  310 bits (794), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 180/519 (34%), Positives = 284/519 (54%), Gaps = 15/519 (2%)

Query: 71  ADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 130
           + G   N  ++++LK RH+SM                       PV  LI+Y F+G + +
Sbjct: 45  SSGHGRNA-VQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAY 103

Query: 131 FTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
                LGEMA++IP+   FT +  R++   LG A GY Y F + +    +L+    +I+Y
Sbjct: 104 CVTQSLGEMATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEY 163

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W S   V    WI IF V I   N+V VKF+GEF+FW++  K                  
Sbjct: 164 WTSA--VPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGA 221

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
                 +GFRYWR+PG + +   +     G+F  +V+  V + F+Y G EL GI   E+ 
Sbjct: 222 G-KTGPVGFRYWRNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESA 280

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRK+VPKAI    +RI++FY+ ++F +G+ V +ND +L S+   S   A SPF++AIQN
Sbjct: 281 NPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSYS---AGSPFIIAIQN 337

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
           SG K+LP IFNA +L  + SA NS++YV SR LY LA +  AP+ FA+T++ GVP  A++
Sbjct: 338 SGTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVL 397

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
               F  L Y++VS+G++K F++ +N+ ++ G  SW+ I + ++ F +A + QGI +   
Sbjct: 398 FVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDL 457

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549
            + A    +GAY++  F  LI +I+ FT  L   F+   F   YI + ++++ WA ++  
Sbjct: 458 PFKAKLMPWGAYYSAFFITLIIIIQGFTS-LAPTFNVSNFFAAYISVFMFLVIWAVFQCW 516

Query: 550 YKTKVIKSTD-VDLYTFKEIYDREEEEGRIKDQEREERL 587
           Y+T++I   + VD+ +     DR E + +  D      L
Sbjct: 517 YRTRIIHRIEHVDIDS-----DRREVDAQQWDNTEPTTL 550

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  311 bits (798), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 188/537 (35%), Positives = 289/537 (53%), Gaps = 25/537 (4%)

Query: 71  ADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 130
           A GK  +T++K+ LK RH+ M                       PV  LIAY F+G +V+
Sbjct: 93  AKGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVY 152

Query: 131 FTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
           F    LGEMA++IP+    T +  R++ PALG + GY Y F + I    +L+    +IQY
Sbjct: 153 FVTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQY 212

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W  +  V    WI IF V++  +N   VK +GE EFW+SS K                  
Sbjct: 213 WTYK--VPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGG 270

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
                 +GFRYWR   AF +   +      +F  +V+  + + F+Y G EL GI   EA 
Sbjct: 271 S-RQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAA 329

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRK+VP+AI   ++RI +FY+ ++F +G+ V YND RL  + G ++  A+SPFV+++ N
Sbjct: 330 NPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRL--SDGSAI-IASSPFVISMLN 386

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
           +G   LP IFNA +L+ V SA NSD+Y++SR LYALA  G APK F   +++GVPY  + 
Sbjct: 387 AGTSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVF 446

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           ++ L   LA++ VS+ +   FN+ +N+ ++ G+ +W  I   +I F +A + +GI +   
Sbjct: 447 VTCLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDL 506

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549
            + A    +GAY+A  F  LI  I+ +  F    +D K+F T YI L ++ + + G  + 
Sbjct: 507 PFKARFMPWGAYYAAFFVGLIIFIQGYDAFT--PWDTKSFFTSYISLILFGVLYLGCLIY 564

Query: 550 YKTK-VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRI 605
           Y+ + +IK  D+D+ T     DR+E E  +     EE   RN      ++EKF   +
Sbjct: 565 YRGRLLIKIEDIDIDT-----DRKEVEAYV----WEEDAPRN------WWEKFWAAV 606

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  309 bits (791), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 180/509 (35%), Positives = 278/509 (54%), Gaps = 14/509 (2%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           E   +++ELK RH+ M                       PV  LIAY F+  L +     
Sbjct: 23  EAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA++IP+   FT ++ R+V PA G A GY Y F + I    +L+    VIQ+W    
Sbjct: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA- 141

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            V    WI+IF V++  +N+  VK++GEFEFW++  K                       
Sbjct: 142 -VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +GFRYWR PGAF     A   +  +F  +V+  + + F++ G EL GI   EA NPRK+
Sbjct: 201 -VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           VP+AIK  V+RI+ FY+ ++F +G+ V Y+D +L ST       +ASPF++AI+NSG  V
Sbjct: 260 VPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSY---VSASPFIIAIENSGTHV 316

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LPHIFNA ++  + SA NS++YV SR +Y L+    AP I ++T++ GVP+ A++++ LF
Sbjct: 317 LPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLF 376

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             LAYM  S+G  K FN+ +N+  + G  +W+ I + +I F +A   +GI +    + A 
Sbjct: 377 GALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAK 436

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554
                AY+ + F  LI +I+ FT F    ++   F+T YI + ++I  W  ++  ++ ++
Sbjct: 437 WMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRL 494

Query: 555 I-KSTDVDLYTFKEIYDREEEEGRIKDQE 582
           I +  DVD+ T +    R  EE    +QE
Sbjct: 495 IWRVEDVDIDTDR----RAVEEAVWIEQE 519

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  308 bits (790), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 188/519 (36%), Positives = 280/519 (53%), Gaps = 14/519 (2%)

Query: 71  ADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 130
            +G    T +K+ LK RH+SM                       PV  LIAY F+G +V+
Sbjct: 64  GEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVY 123

Query: 131 FTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
           F    LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +L+    +I Y
Sbjct: 124 FVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINY 183

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W   D V    WI IF V++ A N   VK++GEFEF ++S K                  
Sbjct: 184 W--TDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGG 241

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
                 +GFRYWR+PG +   + A   +  +F  +V   V + F+Y G EL GI   EA 
Sbjct: 242 S-SQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEAS 300

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRK+VPKAI    +RI+VFY+ ++F +G+ V YN P+L S    S   A+SPFV++IQN
Sbjct: 301 NPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLES---NSAVIASSPFVISIQN 357

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
           +G KVLP IFNA VLV + SA NS++YV SR LY+LA+ G APK F+  +K GVPY  +I
Sbjct: 358 AGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVI 417

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
            + L   LA++  +  +   FN+ +N+ ++ G+ +W  I + +I F +  + +GI +   
Sbjct: 418 CTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSL 477

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549
            + A    +GAY+A  F  LI  I+ FT F   +FD   F T YI L + ++ +   +L 
Sbjct: 478 PFKAKLMPWGAYYAAFFVGLIVFIQGFTAF-APRFDVSEFFTAYISLILLVVLFILCQLY 536

Query: 550 YKTK-VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           Y+ + + K  D+D+ +     DR E +  I + +  + L
Sbjct: 537 YRCRFLTKIEDIDIDS-----DRREIDAIIWEDDEPKNL 570

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  305 bits (782), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 179/484 (36%), Positives = 275/484 (56%), Gaps = 17/484 (3%)

Query: 115 PVAMLIAYAFVGLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYF 173
           PV  LI+Y F+G +++     LGEMA++IP+   F+ +A R++ PALG   GY Y   + 
Sbjct: 25  PVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 84

Query: 174 ILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXX 233
                +L+    +IQYW   D V    WI IF  ++  +N+  VK++GEFEF ++S K  
Sbjct: 85  FTFALELSVLGQIIQYW--TDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVI 142

Query: 234 XXXXXXXXXXXXXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLF 293
                                 +GFRYWR+PGA+     +   + G+F  +V+  + + F
Sbjct: 143 ALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 202

Query: 294 SYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKG 353
           +Y G EL GI   EA NPRK+VP+AIK  V RI+VFY+ ++F +G+ V YNDP+L  + G
Sbjct: 203 TYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKL-DSDG 261

Query: 354 KSMSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPK 413
             +SA  SPF+++I+NSG KVLP IFNA VL+ + SA NS++Y+ SR LY+L+ +  AP+
Sbjct: 262 SFVSA--SPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAPR 319

Query: 414 IFAKTSKWGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYI 473
             +  +K GVPY A++ + +F  LA++  S+GS K FN+ +N+  + G  +W+ I   +I
Sbjct: 320 FLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHI 379

Query: 474 YFDKACRAQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGY 533
            F +A   +GI ++   Y A    Y AY+A  F  LI LI+ FT F    F    F+  Y
Sbjct: 380 RFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAF-APSFQPVDFVAAY 438

Query: 534 IGLPVYILSWAGYKLIYKTKVI-KSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGK 592
           I + +++  W  ++L +K  +I K  DVD+ +     DR E    I++Q   E L++   
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDS-----DRRE----IEEQVWIEPLRKTKW 489

Query: 593 NMEW 596
              W
Sbjct: 490 QCVW 493

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  308 bits (790), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 177/491 (36%), Positives = 275/491 (56%), Gaps = 8/491 (1%)

Query: 70  IADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 129
           +  G  ++  +K+ELK RHI M                       PV  LIAY F+  +V
Sbjct: 79  VDQGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIV 138

Query: 130 FFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 188
           F     LGEMA++IP+   FT ++SR++ P++G A GY Y F + I    +L+    +IQ
Sbjct: 139 FSVTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQ 198

Query: 189 YWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 248
           +W   D V    WI I+  ++  +N+  VKF+GEFEFW++S K                 
Sbjct: 199 FW--TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG 256

Query: 249 XXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
                  +GFRYWR+PG +     +   + G+F  +V+  + + F+Y G EL GI   EA
Sbjct: 257 AGVT-GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEA 315

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
            NPRK+VP+AIK   +RI++FY+ ++F +G+ V ++DP+L S        ++SPF++AIQ
Sbjct: 316 ANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDD---SYVSSSPFIIAIQ 372

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
           NSG KVLPHIFNA +L  + SA NS++YV SR ++ LA    AP+ F  T+K GVPY A+
Sbjct: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
           + +  F  LA++ VSSG AK FN+ +N+V + G  +W+ I I ++ F +    +GI +  
Sbjct: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492

Query: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKL 548
             + A    + AY+A+ F I+I +I+ FT F    F+   F+  YI + ++   W  ++L
Sbjct: 493 LPFKAALMPWLAYYAIFFMIIIIIIQGFTAF-APTFNGSDFVAAYISVFLFFFLWVSFQL 551

Query: 549 IYKTKVIKSTD 559
            ++ K+  S D
Sbjct: 552 YFRCKLYWSLD 562

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  308 bits (788), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 180/500 (36%), Positives = 283/500 (56%), Gaps = 17/500 (3%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
            G   +  +K+ELK RHI M                       PV  LIAY FVG L + 
Sbjct: 54  SGSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYA 113

Query: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               LGEMA++IP+   FT +ASR++ P++G A+GY Y F + +    +L+    ++ YW
Sbjct: 114 VTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW 173

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                V    WI+IF V++ A+N+  VKF+GE EFW+++ K                   
Sbjct: 174 TFA--VPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAG 231

Query: 251 PDHDRLGFRYWRDPGAFKEYSTA------ITGSTGKFTSFVAVFVYSLFSYTGIELTGIV 304
                +GFRYWR+PG + +  T+         +TG+F  +    + + F+Y G EL GI 
Sbjct: 232 VTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGIT 290

Query: 305 CSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFV 364
             EA NPRK+VP+AIK  V+RI++FY+ ++F +G+ V ++DP+L S        ++SPF+
Sbjct: 291 AGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSD---DSYVSSSPFI 347

Query: 365 VAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVP 424
           +AI+NSG K+LP IFNA +L+ + SA NS++YV SR L++LA  G APKI ++T+K GVP
Sbjct: 348 IAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVP 407

Query: 425 YNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGI 484
           + +++ + +F  LAYM  + G   +F++ VN+ ++ G  +W+ ILI +I F +  + +GI
Sbjct: 408 WVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGI 467

Query: 485 DKSKFAYVAPGQRYGAYFALSFCILIALI-KNFTVFLGHKFDYKTFITGYIGLPVYILSW 543
            +    + A      AY+A+ FC++I +I + FT F    FD   F   YI + ++ L W
Sbjct: 468 SRDDLPFKANLMPGLAYYAV-FCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIW 525

Query: 544 AGYKLIYKTKVI-KSTDVDL 562
             ++L +K + I K  DVD+
Sbjct: 526 GAFQLWFKCRWIWKLEDVDI 545

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  308 bits (788), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 184/537 (34%), Positives = 282/537 (52%), Gaps = 18/537 (3%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           + N +LK+ L +RH+                         P  ++I+Y  +  +++  M 
Sbjct: 53  EGNGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMN 112

Query: 135 CLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 188
            LGEM  Y+P +G  S  S      RYVD +L FA G+ Y + + IL   + TAA+ V+ 
Sbjct: 113 ALGEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVT 172

Query: 189 YWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 248
           YW +   V   VWITIFL ++  +N   VK+FGE EFW +S K                 
Sbjct: 173 YWTTS--VPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWG 230

Query: 249 XXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIVCSE 307
             P H RLGF YW+DPG F  + T   GS G F       +   F++  G EL  +  SE
Sbjct: 231 GGPSHVRLGFHYWKDPGTFAHHITG--GSWGSFLDIYTGIIKGAFAFILGPELVALTSSE 288

Query: 308 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASPFVV 365
             + R+++ KA K  ++R++ FY+     + + VAYNDP LL+   +GK   AA+SPFV+
Sbjct: 289 CNDQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKE-GAASSPFVI 347

Query: 366 AIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPY 425
            IQN+GIKVLPHI NAC+L   +SA NS ++ SSR+L  +A +G APKIF K +++GVPY
Sbjct: 348 GIQNAGIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPY 407

Query: 426 NALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 485
            ++ LS +  CLA++NVSS +A++F++F N+ ++ G L WI  +I Y+ F KA     + 
Sbjct: 408 YSVGLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNM- 466

Query: 486 KSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAG 545
             +  +   GQ Y  +++L    +I L   +  F+   +    F+  YI LP++++ W G
Sbjct: 467 YDRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVG 526

Query: 546 YKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFL 602
           +K   + K         Y   EI   +   G  + +E  E+L  N      ++ KF+
Sbjct: 527 HKFWARYKHAVPLLKLYYPVDEI---DVITGLAEAEEVAEKLDMNRIPPSTYWGKFI 580

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  306 bits (785), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 185/503 (36%), Positives = 270/503 (53%), Gaps = 12/503 (2%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
            ++ T+LK+ LK RHI M                       PV +LIAY FVG++V    
Sbjct: 38  HNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQ 97

Query: 134 ACLGEMASYIPLDGFT-SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             + E+AS++P  G T  +A +++D ++GF  G+  +  Y  L P +L+A A++++YW  
Sbjct: 98  IAIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD 155

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              ++P V+ITIF V+ V  NI  ++F+GE E+     K                     
Sbjct: 156 ---ISPAVFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLGGVKG 212

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
            +RLGF YWRDPG F EY   + GS GKF  F +     ++SY+GI+   I+  E +N R
Sbjct: 213 QERLGFHYWRDPGPFAEY--IVGGSIGKFVGFWSALSSVVYSYSGIQNIAILAGETKNSR 270

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
            ++    K    RIIV YL TVF+L + V YND  + S  G   +A +SPFV+A+  +GI
Sbjct: 271 HAIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALIASGTG---TAKSSPFVIAMNRAGI 327

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           KVLPHI NA VL   +SA N  +   SRNL+ LA   +APKIF KTSK G+PY  +I   
Sbjct: 328 KVLPHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFIS 387

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
            F  LAYM+ S  S+ +F +F  +VS   +L WI I   +IY D+A +AQG  +S   Y 
Sbjct: 388 CFLPLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYS 447

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKT 552
            P   Y A+F+     +  L   F  F+   FD ++F T Y  +P+ I  +  +KL  KT
Sbjct: 448 TPIAPYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKT 507

Query: 553 KVIKSTDVDLYT-FKEIYDREEE 574
           + ++  +VDL + F +I +  E 
Sbjct: 508 RYLRPEEVDLASIFDDIRENPEH 530

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  307 bits (786), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 174/519 (33%), Positives = 278/519 (53%), Gaps = 14/519 (2%)

Query: 71  ADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 130
            +G  +  ++K+ LK RH+SM                       PV  LIAY F+G +V+
Sbjct: 106 GEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVY 165

Query: 131 FTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
           F    +GEMA++IP+    T ++SR++ PA G A GY Y F + I    +L+    VI+Y
Sbjct: 166 FVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEY 225

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W   + V    WI IF V++   N   V+F+GE EFW++S K                  
Sbjct: 226 WT--EAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGG 283

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
                 +GFRYWR+PG +     +     G+F  +VA  + + F+Y G EL GI   EA 
Sbjct: 284 S-KQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAA 342

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPR++VP+AI    +RI+ FY+ ++F +G+ V YN   L  T   +   A+SPFV++IQN
Sbjct: 343 NPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKT---TTVIASSPFVISIQN 399

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
           +G + LP IFNA VLV + SA NS++YV SR L++LA  G APK+F+  +  GVP+  +I
Sbjct: 400 AGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVI 459

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           ++ L   LA++ V+  + + FN+ +N+ ++ G+ +W+ I I +I F +  + +GI +   
Sbjct: 460 VTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDL 519

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549
            + +    YGAY+A  +  +I  ++ F  F  H F    F T YI L + ++ + G +L 
Sbjct: 520 PFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPH-FKVTEFFTSYISLMLLVVVFCGAQLF 578

Query: 550 YKTKVI-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           Y+ +   +  D+D+ +     DR E +  I + +    L
Sbjct: 579 YRCRFFNRLEDIDIDS-----DRREADALIWEDDEPTTL 612

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  305 bits (782), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 178/501 (35%), Positives = 283/501 (56%), Gaps = 9/501 (1%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           +G  +   +K++LK RHI M                       PV  LIAY F+  +VF 
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               LGEMA++IP+   FT ++SR++ PA+G A GY Y F + +    +L+    +IQ+W
Sbjct: 149 VTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFW 208

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                V    WI I+ V++  +N+  VKF+GEFEFW++S K                   
Sbjct: 209 T--HAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAG 266

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
                +GFRYWR+PG +     +   + G+F  +V+  + + F+Y G EL GI   EA N
Sbjct: 267 VTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 325

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRK+VP+AIK   +RI++FY+ ++F +G+ V Y+D +L ST       +ASPF++AI+NS
Sbjct: 326 PRKTVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSY---ISASPFIIAIENS 382

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G K+LPHIFNA +L  + SA NS++YV SR L+ LA    APK F  TS+ GVPY ++  
Sbjct: 383 GTKILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFF 442

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           +  F  LA++ VSSG AK FN+ +N++S+ G  +W+ I I ++ F +A + +GI +    
Sbjct: 443 TSSFGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLP 502

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           + A    + AY+++ F  +I +I+ FT F    F+   F+  YI + ++   W  ++L +
Sbjct: 503 FKARFMPHLAYYSIFFMTIIIIIQGFTAF-APTFNGSDFVAAYISIFLFFFLWLCFQLYF 561

Query: 551 KTKVIKST-DVDLYTFKEIYD 570
           ++K++ +  +VD+ T +   D
Sbjct: 562 RSKLLWTVEEVDIDTDRRDVD 582

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  305 bits (781), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 182/509 (35%), Positives = 275/509 (54%), Gaps = 13/509 (2%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            +T +K+ LK RHI M                       PV  LIAY F+G +++     
Sbjct: 97  HDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQS 156

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VI+YW    
Sbjct: 157 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYW--TK 214

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           +V    WI IF V +  +N   VK +GE EFW++ F                        
Sbjct: 215 KVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIA-FMKVLAIAGYLLYALIIVCGGSSQG 273

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +GFRYWR+PG +     +   +T +F  +V+  + + F+Y G EL GI   EA NPRKS
Sbjct: 274 PIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 333

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           VP+AI   V+RI +FY+ ++F +G+ V Y+DPRL S    S   A+SPFV++IQN+G K+
Sbjct: 334 VPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSD---SAVVASSPFVISIQNAGTKI 390

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP IFNA V++ V SA NS++YV SR LYALA  G APK FA  ++ GVPY  ++ +   
Sbjct: 391 LPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAAL 450

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             LA++ V++ +   FN+ +N+ ++ G+ +W+ I I +I F +A + +GI +    + A 
Sbjct: 451 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAK 510

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554
              + AY+A  F  +I  I+ F  F  H FD   F T YI L +  + + G ++ Y+ + 
Sbjct: 511 FMPWAAYYATFFVTVIIFIQGFQAFSPH-FDVTAFFTAYISLIILAVLFIGCQIYYRCRF 569

Query: 555 I-KSTDVDLYTFKEIYDREEEEGRIKDQE 582
             K  D+D+ T +    RE EE   +D E
Sbjct: 570 FWKLEDIDIDTDR----REIEEVIWEDDE 594

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  303 bits (775), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 179/494 (36%), Positives = 280/494 (56%), Gaps = 10/494 (2%)

Query: 68  FAIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGL 127
           F  A G+   T L++  K RH+ M                       P ++LIA+ F G 
Sbjct: 35  FQEAIGESSQT-LQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGS 93

Query: 128 LVFFTMACLGEMASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALV 186
           L+   +  L EMAS+ P+D  F+ YA+RYVDPALGFA G+ Y  KY I   ++L+A  L+
Sbjct: 94  LLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLL 153

Query: 187 IQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXX 246
           +QYW  R+ ++  ++I +FLVV++++N + +KF+GE EFW +  K               
Sbjct: 154 VQYW--REDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLT 211

Query: 247 XXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCS 306
               P  + +GFRYWR+  AF  Y   + G+TG+F  + A  + S ++Y G E  G+V  
Sbjct: 212 CGGGPSKETIGFRYWREY-AFVPY--LVKGTTGRFLGWWACVIQSCYAYIGSETIGVVFG 268

Query: 307 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVA 366
           EA NP+K++P A +  ++RI  FY+  V +LG+ ++ +D  L     K+  A+ SPFV+A
Sbjct: 269 EAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIISPHDKTL--ANAKTSDASGSPFVIA 326

Query: 367 IQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYN 426
             N+GIK LP   NA +++F+ SA N+ LYV SR  Y LA DG APKIF   +++GVP+N
Sbjct: 327 FTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFN 386

Query: 427 ALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK 486
             +L+ L   L++MN+S+ S+ IF Y  + V++FG L+W+++LI YI +++A     + +
Sbjct: 387 GCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPR 446

Query: 487 SKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGY 546
            +  +    Q Y AY  L F  LI     ++ F+   F YK+FI  YIG+ V+I +   +
Sbjct: 447 DRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAG-FKYKSFIVSYIGIAVFIGNTLFW 505

Query: 547 KLIYKTKVIKSTDV 560
           K   K+   +  D+
Sbjct: 506 KFWKKSAATRPEDL 519

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  304 bits (779), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 183/513 (35%), Positives = 279/513 (54%), Gaps = 15/513 (2%)

Query: 73  GKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFT 132
           G   +  +K+ELK RHI M                       PV  LI+Y F+G LV+  
Sbjct: 66  GYVHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSV 125

Query: 133 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
              LGEMA++IP+   FT +A R++ P++G A GY Y F + +    +L+    VIQYW 
Sbjct: 126 TQSLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWT 185

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
               V    WI+IF VVI A N+  VK++GE EFW++  K                    
Sbjct: 186 YA--VPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGV 243

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
               +GFRYWR+PG +     +   +  +F  +V+  +   F+Y G EL GI   EA NP
Sbjct: 244 TGP-VGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANP 302

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RK+VP+AIK  V+RI+ FY+ ++F +G+ V YND  L +T       A+SPF++AI+NSG
Sbjct: 303 RKAVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSY---VASSPFIIAIKNSG 359

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
             VLPHIFNA +   + SA NS++YV SR L+ L+ +  APKI ++T+K GVP+ A++++
Sbjct: 360 TPVLPHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVT 419

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            +   LAYM  S+G    FN+ +N+ ++ G  +W+ I + +I F +A + +GI +    +
Sbjct: 420 SVVGALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPF 479

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            A      AY+A     +I +I+ FT F   KF    F   YI + ++I  W  +++I++
Sbjct: 480 KAALMPGLAYYASFLMFVIIIIQGFTAF-APKFSGSDFAAAYISIFLFIGIWCLFQIIFR 538

Query: 552 TKVI-KSTDVDLYTFKEIYDREEEEGRI-KDQE 582
            + I K  DVD+ T     DR + E  + +D E
Sbjct: 539 CRFIHKVEDVDIDT-----DRRDIEAVVWEDAE 566

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  303 bits (775), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 180/509 (35%), Positives = 271/509 (53%), Gaps = 12/509 (2%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
            ++ T+LK+ LK RHI M                       PV +LIAY FVG++V    
Sbjct: 43  HNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQ 102

Query: 134 ACLGEMASYIPLDGFT-SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             + E+AS++P  G T  +A +++D ++GF  G+  +  Y  L P +L+A A++++YW  
Sbjct: 103 IAIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD 160

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              V+P V+IT+F ++ V  NI  ++F+GE E+     K                     
Sbjct: 161 ---VSPAVFITVFGILFVVTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKG 217

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
            +RLGF YWR+PG F  Y   + G  GKF  F A     ++SY+GI+   I+  E +N R
Sbjct: 218 QERLGFHYWREPGPFANY--LVGGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSR 275

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
            ++    K    RIIV YL TVF+L + V YND  + +  G   +A +SPFV+A+  +GI
Sbjct: 276 HAIFHGAKNVFLRIIVLYLVTVFILTLIVPYNDKLIATGTG---TARSSPFVIAMNRAGI 332

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           KVLPHI NA +L   +SA N  +   SRNL+ LA   +APKIF +TSK G+PY  +I   
Sbjct: 333 KVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFIS 392

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
            F  LAYM+ S  SA +F +F  +VS   +L WI I   +I+ D+A +AQG  +S   Y 
Sbjct: 393 SFLPLAYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYS 452

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKT 552
            P   + A+F+     +  L   F  F+   FD ++F T Y  +P+ I  +  +KL  KT
Sbjct: 453 TPMGPFAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKT 512

Query: 553 KVIKSTDVDLYT-FKEIYDREEEEGRIKD 580
           K ++  +VDL + F +I +  E   + K+
Sbjct: 513 KYLRPHEVDLESIFDDIKENPEHIVKTKN 541

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  300 bits (769), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 177/518 (34%), Positives = 275/518 (53%), Gaps = 14/518 (2%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           +G  +  ++K+ LK RH+SM                       PV  LIAY F+G +V+F
Sbjct: 46  EGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYF 105

Query: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               +GEMA++IP+    T +++R++ PA G A GY Y F + I    +++    VIQYW
Sbjct: 106 VTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYW 165

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                V    WI IF V I   N   V+F+GE EFW++S K                   
Sbjct: 166 --TKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS 223

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
                +GFRYWR+PG + +   +     G+F  +VA  + + F+Y G EL GI   EA N
Sbjct: 224 -KQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAAN 282

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRK+VPKAI    +RI+ FY+ ++F +G+ V YN P L      +   A+SPFV++IQ++
Sbjct: 283 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGL---DKHTSVIASSPFVISIQSA 339

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G ++LP IFNA VLV + SA NS++YV SR L++LA  G APK F+  +  GVPY  +I 
Sbjct: 340 GTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVIC 399

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + L   LA++ V   + + FN+ +N+ ++ G+ +W+ I I +I F +  + +GI +    
Sbjct: 400 TALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLP 459

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           + +    YGAY+A  +  +I  ++ F  F   KF    F TGYI L +  + +   +L Y
Sbjct: 460 FKSKLMPYGAYYAAFWVAVIIFVQGFQAFC-PKFKVAEFFTGYISLILLAVVFCLAQLYY 518

Query: 551 KTKVI-KSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           + +   +  D+D+ +     DR E +  I ++E    L
Sbjct: 519 RCRFFNRLEDIDIDS-----DRREIDALIWEEEEPTTL 551

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  298 bits (762), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 180/501 (35%), Positives = 274/501 (54%), Gaps = 13/501 (2%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           ++ T+LK+ LKARHI M                       PV MLIAY  VG++V     
Sbjct: 41  NDRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQI 100

Query: 135 CLGEMASYIPLDGFT-SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            + E+AS++P  G T  ++ +++D A+GF  G+  +  Y  L P +L+A A+V+ YW   
Sbjct: 101 AIAEVASFMPATGATIRHSEQFIDEAVGFTFGW--ISTYSSLMPGELSATAVVMTYWTD- 157

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
             ++P ++ITIF V+ +  NI  ++F+GE E++    K                      
Sbjct: 158 --LSPAIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGT-KQ 214

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
           +RLGF YWR+PG F EY   + G TGKF  F A     ++SY+GI+   I+  E +N R 
Sbjct: 215 ERLGFHYWRNPGPFAEY--LVGGDTGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRH 272

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           ++    K    RII+ YL TVF+L + V YND +L++T   S +A +SPFV+A++ +GIK
Sbjct: 273 AIFHGAKNVFVRIILLYLITVFVLTLIVPYND-KLIATG--SGNARSSPFVIAMERAGIK 329

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           VLPHI NA +L   +SA N  +   SRNL+ LA   +APKIF KTSK G+P+  ++    
Sbjct: 330 VLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISS 389

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  LAYM+ S  SA +F++F  +VS   +L WI I   +I+ D+A RAQG  +    Y  
Sbjct: 390 FLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYST 449

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK 553
               Y A+F+     +  L   F  F+   FD ++F + Y  +P+ I  +  +KL  KT+
Sbjct: 450 TIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKTR 509

Query: 554 VIKSTDVDLYT-FKEIYDREE 573
            ++  +VDL + F++I +  E
Sbjct: 510 YLRPHEVDLQSIFEDIRENPE 530

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  295 bits (755), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 181/540 (33%), Positives = 289/540 (53%), Gaps = 27/540 (5%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           +  +  LKK LK+ HI +                       P  + I+Y  +  +++  M
Sbjct: 46  QSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVM 105

Query: 134 ACLGEMASYIPL--------DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 185
             L EM  ++P            ++  +RYVD +LGFA+G+ Y++ Y IL   + TAA+ 
Sbjct: 106 NALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASG 165

Query: 186 VIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 245
           V+ YW +   V    WITIFL +IV +N   V+F+G  E    S K              
Sbjct: 166 VVTYWTTA--VPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVL 223

Query: 246 XXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGIV 304
                P+HDRLGFR+W+DPGA+  Y  A  G  G+ +  +   + + F++  G EL  + 
Sbjct: 224 FFGGGPNHDRLGFRFWKDPGAWA-YHLA-DGGAGRLSDIITGVIRAGFAFILGPELVVLT 281

Query: 305 CSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLS--TKGKSMSAAASP 362
            +EA++ R+++ KA +  V+R+I FY  +    G+ V+ NDP LL+  ++GK   A +SP
Sbjct: 282 STEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKP-GAGSSP 340

Query: 363 FVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWG 422
           FV+ IQN+GIKVLPHI N C+L   +S+ NS +Y ++R+L +L+ +G APKIF + ++WG
Sbjct: 341 FVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWG 400

Query: 423 VPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 482
           VPY  +  +  F CLAY+NVSS +A +FN+F N+ ++ G L WI   + Y+ F KA    
Sbjct: 401 VPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFN 460

Query: 483 GIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILS 542
            +   +  +  P Q Y  +F +    +I LI  +  F+   ++YK FI  YI LP++++ 
Sbjct: 461 NL-YDRLPFKTPFQPYFTWFYIILIAIICLINGYESFV--HWNYKDFIAAYITLPLFLIL 517

Query: 543 WAGYKLIYKT---KVIKSTDVDLYT-FKEIYDREEEEGRIKDQEREERLQRNGKNMEWFY 598
           W G+K   +T    +I  +++D+ T  +EI    EEE +  +  R        K +EW +
Sbjct: 518 WLGHKAYTRTWSQWMISVSEIDVTTGLREI----EEETKELNARRIPPRNLWEKILEWLF 573

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  296 bits (758), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 173/523 (33%), Positives = 277/523 (52%), Gaps = 28/523 (5%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DG+    +LK+ L ARHI +                       P  ++ +Y  +  +V+ 
Sbjct: 96  DGR--KNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYP 153

Query: 132 TMACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 185
            M  LGEM  Y+P DG  S  S      RY+D +L FA G+ Y + + +L   + TAA+ 
Sbjct: 154 IMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASG 213

Query: 186 VIQYWISRDRVNPG-VWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXX 244
           V++YW    +V P   WI +F ++I  +N+  V+ +GE EFW +  K             
Sbjct: 214 VVEYW---TKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFI 270

Query: 245 XXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-GIELTGI 303
                 P+HDRLGFRYW  PG+F   +T   GS G F       +   FS+  G EL  +
Sbjct: 271 LFWGGGPNHDRLGFRYWITPGSFA--NTITNGSFGNFLDVYKGIILGAFSFILGPELVVL 328

Query: 304 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTK--GKSMSAAAS 361
             SE  +PR+++ KA K  ++R++ FY+     + + V+YNDP +LST        A +S
Sbjct: 329 PSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDP-ILSTALIQDKPGAGSS 387

Query: 362 PFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKW 421
           PFV+ IQN+GI VLPHI N C+L+  +S+ N+ L+ SSR+L  +AI+ +APK   K +++
Sbjct: 388 PFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRF 447

Query: 422 GVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 481
           GVPY A+I+S++  C+AY+N S  ++ +F +F N+ ++ G L WI + + Y+ F KA   
Sbjct: 448 GVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEY 507

Query: 482 QGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIL 541
            G+ K +  Y   GQ Y   ++L   I+I +   F + +   ++   FI  Y+ LP++++
Sbjct: 508 HGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLM 566

Query: 542 SWAGYKLI-YKTKVI--------KSTDVDLYTFKEIYDREEEE 575
            W G+K   Y+ K+         +  D+D+ T  E  + E E+
Sbjct: 567 IWIGHKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIEMESEK 609

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  291 bits (745), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 172/519 (33%), Positives = 277/519 (53%), Gaps = 14/519 (2%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           +G  + T +K+ LKARHISM                       PV  L+AY F+G +V+ 
Sbjct: 47  EGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYS 106

Query: 132 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
               LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +L+    +IQYW
Sbjct: 107 ITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYW 166

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
              DRV    WI IF V++  +N   V+F+GE EFW++S K                   
Sbjct: 167 --TDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGS 224

Query: 251 PDHDRLGFRYWRD-PGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
                +G       P      S+  T     F  +V+  + + F+Y G EL GI   E+ 
Sbjct: 225 -KQGPIGLPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGEST 283

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRK+VPKAI    +RI+ FY+ ++  +G+ V Y+DPRL S    S    ASPFV++I+N
Sbjct: 284 NPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSES--STDVNASPFVISIKN 341

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
           +G K+LP IFNA VL+ V SA NS++Y+ SR  Y+LA+ G APK  A  +K GVPY  ++
Sbjct: 342 AGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVL 401

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           ++ L   ++++ ++  ++  F++ VN+ ++ G+ +W+ I + +I F +  + +GI +   
Sbjct: 402 ITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDL 461

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549
            + A    + AY+A  F  +I  I+ +T F   KFD  TF T YI L + +L + G ++ 
Sbjct: 462 PFKAKFMPWAAYYATFFVTVIIFIQGYTAFT-PKFDVTTFFTSYISLFLMLLVFIGCQIY 520

Query: 550 YKTKVIKST-DVDLYTFKEIYDREEEEGRIKDQEREERL 587
           YK + + +  D+D+ +     DR E +  + +++  + +
Sbjct: 521 YKCRFLWAVEDIDIDS-----DRREIDAIVWEEDEPKNI 554

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  287 bits (735), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 166/528 (31%), Positives = 278/528 (52%), Gaps = 17/528 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           E    +++L  R +SM                       P ++LIA+    ++      C
Sbjct: 113 EERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKC 172

Query: 136 LGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           +  M +Y+P+ G F  +  R+VD + GFA+G+TY          ++TA  LV++YW   D
Sbjct: 173 MCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYW--TD 230

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           ++     I++ +++  ++N+  V FFGE EF+LS  K                   P H 
Sbjct: 231 KIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHT 290

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            LGF+ W +PGAF EY +   GS G+F  F++  V++L+ + G++  G   SEA NPRK 
Sbjct: 291 VLGFKNWSNPGAFAEYIS--DGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKV 348

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLL-STKGKSMSAAASPFVVAIQNSGIK 373
           +P + +    R+I+FY+     +G+ + YNDP ++ + K  ++ A ASP+V A++  GI+
Sbjct: 349 IPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIR 408

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           VLPHI N  +L  + SA NS LY +SR L+ LA+D +AP+IF  T+K GVP    I  ++
Sbjct: 409 VLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLV 468

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
            C LAY++VS+ +  +  +F+NV +    + +I I + Y+ F K C AQ +D     Y +
Sbjct: 469 ICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYS 528

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK 553
               Y A+ +L + +L+ L+  +TVFL   +D ++F+  Y  +P +++   G+KL   TK
Sbjct: 529 SSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTK 588

Query: 554 VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKF 601
            ++  ++DL+T  E          + D++R      N   + WF   F
Sbjct: 589 SVRPLEMDLFTGIE---------ELADEDR--YWAENPPTLNWFDRAF 625

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  281 bits (718), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 175/501 (34%), Positives = 268/501 (53%), Gaps = 13/501 (2%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           ++ TRLK+ LK RHI M                       P  M +AY  VG++V     
Sbjct: 45  NDRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQI 104

Query: 135 CLGEMASYIPLDGFT-SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            + E+AS++P  G T  +A +++D ++GF  G+  +  Y  L P +L+A A+V++YW   
Sbjct: 105 AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVVMRYWTD- 161

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
             +NP VWITIF ++ V  NI  ++F+GE E++    K                      
Sbjct: 162 --INPAVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGA-KQ 218

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
           +RLGF YWR+PG F EY   + G  GKF  F A     ++SY+GI+   I+  E +N R 
Sbjct: 219 ERLGFHYWREPGPFAEY--IVKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRH 276

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           ++    +    RIIV YL  V +L + V YND  + +  G   +A +SP+V+AIQ + IK
Sbjct: 277 AIFHGARNVFLRIIVLYLIAVLVLTLIVPYNDKLIATGTG---TAKSSPYVIAIQRANIK 333

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           +LPHI NA +L   +SA N  +   SRNL+ALA   +APKIF  T+K G+PY  +     
Sbjct: 334 ILPHIINAIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISA 393

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  L+YM+VSS SA +F++F  +VS   +L WI I   +I+ D+A +AQG  +S   +  
Sbjct: 394 FLPLSYMSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHST 453

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK 553
               + A+F+    ++  L   F  F+   FD ++F T Y  +P+ I+ +  +KL  KTK
Sbjct: 454 CLGPFAAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTK 513

Query: 554 VIKSTDVDLYT-FKEIYDREE 573
            ++  +VDL + F++I    E
Sbjct: 514 YLRPAEVDLESIFEDIRQNPE 534

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  279 bits (713), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 166/457 (36%), Positives = 243/457 (53%), Gaps = 11/457 (2%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           ++ TRLK+ LK RHI M                       PV +LIAY FVG++V     
Sbjct: 43  NDRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQI 102

Query: 135 CLGEMASYIPLDGFT-SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            + E+AS++P  G T  +A +++D ++GF  G+  +  Y  L P +L+A A++++YW   
Sbjct: 103 AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMKYWTD- 159

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
             V+P V+IT+F V+ VA NI  ++F+GE E+     K                      
Sbjct: 160 --VSPAVFITVFGVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQ 217

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
           +RLGF YWRDPG F  Y  A  G  GKF  F A     ++SY+GI+   I+  E +N R 
Sbjct: 218 ERLGFHYWRDPGPFANYLVA--GHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRY 275

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           ++    K    RIIV YL TVF+L + V YND  + +  G   +A +SPFV+A+  +GIK
Sbjct: 276 AIFHGAKNVFLRIIVLYLVTVFVLTLIVPYNDKLIATGTG---TAKSSPFVIAMNRAGIK 332

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           VLPHI NA +L   +SA N  +   SRNL+ LA   +AP+IF KTSK G+PY  +I    
Sbjct: 333 VLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISS 392

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  LAYM+ S  SA +F +F  +VS   +L WI I   +I+ D+A +AQG  +S      
Sbjct: 393 FLPLAYMSCSESSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCST 452

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFI 530
               + A+F+    ++      F  F+   FD ++F+
Sbjct: 453 RIAPFAAWFSGIMSVIFLFTGGFYNFMHGHFDIESFL 489

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  280 bits (715), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 166/539 (30%), Positives = 279/539 (51%), Gaps = 21/539 (3%)

Query: 70  IADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 129
           +++    N  L K L  RH+                         P +++I +  +   +
Sbjct: 60  VSNASVTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCL 119

Query: 130 FFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 188
           F  +  LGEMA+  P+  GF  Y +R+VDP++GFA+   YL ++ +L P +L AA++ I+
Sbjct: 120 FTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIK 179

Query: 189 YWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 248
           YW   D +N   W+ IF  VI   N++ VK FGE EF LS  K                 
Sbjct: 180 YW--NDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCG 237

Query: 249 XXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
             P    LG +YW +PG+F  +++       KF    +VFV + FSY+GIE+T +  +E+
Sbjct: 238 GGPQGGYLGGKYWHNPGSFVGHTSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAES 292

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
           ++PR+++PKA K T + I   Y+  + L+G  V Y++PRLLS    S+ AA+SP V+AI+
Sbjct: 293 KDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGS-SSVDAASSPLVIAIE 351

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
           N GIK LP + NA +L+ + S  NS +Y  SR + A+A  G  P++     K G P NA+
Sbjct: 352 NGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAI 411

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
           + ++ F  L+++  S   A++F +   +  +  I  W+ I I +I F +A + Q     +
Sbjct: 412 LFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDE 471

Query: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAG 545
             Y++    +G+++ +    L+ ++  +T      G   D ++F  GY+  P+ I  + G
Sbjct: 472 LPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVG 531

Query: 546 YKLIYKTK--VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFL 602
           +KL+Y+ K  V+   D+D+ T      R + +  I+ QE +E  +   K+   F+ +FL
Sbjct: 532 HKLVYRKKQIVVALEDMDIDT-----GRRQVDLTIRRQEMKEEQEHLAKSS--FFARFL 583

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  278 bits (711), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 172/530 (32%), Positives = 270/530 (50%), Gaps = 17/530 (3%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
            + L+ +LK RH+ M                       P  +LI +   G +++  +  +
Sbjct: 81  RSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSV 140

Query: 137 GEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
            E+A   P+  GFT+YA+R++D + GFA  + Y+ ++ +  P ++ AA++ + YW +  +
Sbjct: 141 AELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKK 200

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
              G ++ +F VVIV IN+ GV+ +GE EF  S  K                   P    
Sbjct: 201 YRDG-FVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGY 259

Query: 256 LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 315
           +G RYW  PGAF     A   S  KF  F +VFV + FS+ G EL G+  +EA NPRK V
Sbjct: 260 IGARYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDV 314

Query: 316 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVL 375
           P A K   +RI +FY+  + L+GM V Y DPRL+   G S+ AAASPFV+AI+N GI  L
Sbjct: 315 PGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIG--GSSVDAAASPFVIAIKNQGISGL 372

Query: 376 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFC 435
           P + N  +L+ V S  NS +Y  SR L ALA  G  PK F+   + G P   + ++  F 
Sbjct: 373 PTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFG 432

Query: 436 CLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 495
            +A++  S    ++F++ + +  +  + +W TI + +I F +A  AQG   ++ A+ +P 
Sbjct: 433 LIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPA 492

Query: 496 QRYGAYFALSFCILIALIKNFTVF--LGHKFDYKTFITGYIGLPVYILSWAGYKLIYKT- 552
             +GA + L  CI++   + +     LG       F  GY+ LP+ +  W G+K+  K  
Sbjct: 493 GVWGAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNW 552

Query: 553 -KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKF 601
              IK+ D+D+ T +    RE +   ++ Q  EER     K M +   KF
Sbjct: 553 KLFIKAEDMDIDTGR----RELDLDLLRQQVEEERAALAAKPMWYRIYKF 598

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  277 bits (709), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 173/547 (31%), Positives = 288/547 (52%), Gaps = 31/547 (5%)

Query: 71  ADGKDENTR-LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 129
           +  K+ ++R LK  L++RHI +                       P A++I+Y  +  +V
Sbjct: 46  SGAKESSSRNLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIV 105

Query: 130 FFTMACLGEMASYIPLD-------GFTSY-ASRYVDPALGFAIGYTYLFKYFILPPNQLT 181
           +  M   GEM  Y+P +       G+ +Y  S+YVD +LGFA  + Y + + +L   + T
Sbjct: 106 YPIMNMFGEMVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECT 165

Query: 182 AAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXX 241
           AA+ +++YW S+  +   V I +FL VI  +N + VKF+GE EFW +  K          
Sbjct: 166 AASSIVEYWTSK--IPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIV 223

Query: 242 XXXXXXXXXP---DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYT-G 297
                    P   D+  +GF YW++P +F++Y T   GS G F       +   F++  G
Sbjct: 224 AFVIFCGGAPNNEDNSFVGFHYWKNPSSFRDYVT--NGSLGNFLDVYNALIKGAFAFILG 281

Query: 298 IELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKG-KSM 356
            EL  +  SE  + R+++ KA +  VYR++ FY+     + + V YNDP LL+       
Sbjct: 282 PELVSLTSSECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKP 341

Query: 357 SAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFA 416
            A +SPFV+ IQN+GI +LPHI N C+L    SA N+ L+ S+R L  +  +G AP+IF+
Sbjct: 342 GAGSSPFVIGIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFS 401

Query: 417 KTSKWGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFD 476
           + ++ GVPY AL LS++  CLA++N S+ SAK+F +F N+ ++ G + W T  I Y+ F 
Sbjct: 402 RINRHGVPYVALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFR 461

Query: 477 KACRAQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGL 536
           +     G+   +  +   GQ Y  +++  F  ++ L   +   +   ++Y+ FI  YI L
Sbjct: 462 RTIDYNGL-YDRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITL 520

Query: 537 PVYILSWAGYKLIY-----KTKVIKSTD-VDLYT-FKEIYDREEEEGRIKDQEREERLQR 589
           PV+++ + G+ +IY     + K  K  D +D+ T  +EI    E + +I D+ER+    R
Sbjct: 521 PVFLVLYFGH-IIYSGRWRQRKWWKPVDEIDVVTGLEEI----ELKTKIADEERQGHSGR 575

Query: 590 NGKNMEW 596
             K +++
Sbjct: 576 FAKCLDY 582

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  275 bits (703), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 169/516 (32%), Positives = 272/516 (52%), Gaps = 15/516 (2%)

Query: 69  AIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 128
           ++ D + +   + + LK+RH+ +                       P  +LIAYA + L 
Sbjct: 40  SVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAVMSLF 99

Query: 129 VFFTMACLGEMASYIPLDGFTSYASR---YVDPALGFAIGYTYLFKYFILPPNQLTAAAL 185
           V+  M  + EM + IPL G ++  S    YV+  L F  G+   +   ++ P ++TA AL
Sbjct: 100 VWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVTACAL 159

Query: 186 VIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 245
           ++QYW      NP ++I+IFLV+ VAI ++ VK FGE EFW+SS K              
Sbjct: 160 LVQYW---TDANPAIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGVVI 216

Query: 246 XXXXXPDHDR-LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGI-ELTGI 303
                P  +  LGF YW+ PGAFK Y   + G TGKF +F    + S FS+  + E+   
Sbjct: 217 FFGGGPAQEHVLGFHYWKKPGAFKPY--LVEGGTGKFLAFWTAIIKSGFSFVLVPEIVSS 274

Query: 304 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAAS-P 362
             +EA  PR+++P+A K  +YR+ +FY+  + ++G+ V Y++ RLL+      S+AA+ P
Sbjct: 275 CAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAASP 334

Query: 363 FVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWG 422
           FV+ I+ +GI+VLPHI NA +L   +S     LY +SR L+++A  G AP+I    +K+G
Sbjct: 335 FVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNKYG 394

Query: 423 VPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 482
           VPY    ++ LFC LAY+N S+ S+ +FN+  N+ ++ G +SW+ + I YI F       
Sbjct: 395 VPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVIDVL 454

Query: 483 GIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILS 542
            ++  +  +  P Q+  AY A+ F  ++ L   F VF+   +D   F   YI L   ++ 
Sbjct: 455 KLND-RIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVLVL 513

Query: 543 WAGYKLIYK---TKVIKSTDVDLYTFKEIYDREEEE 575
           + G  + YK    + I   + D+     + + EE E
Sbjct: 514 FVGSTIYYKEWRCRDIAEIEQDILPKITLAEAEEYE 549

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  274 bits (701), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 162/514 (31%), Positives = 272/514 (52%), Gaps = 9/514 (1%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           E    +++L  R +SM                       P ++LIA+    ++      C
Sbjct: 41  EERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQC 100

Query: 136 LGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           +  M +Y+P+ G F  +  R+VD + GF++G+TY          ++TA  LV+++W   D
Sbjct: 101 MCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFW--TD 158

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           ++     I+I + +  ++N+  V  FGE EF+LS  K                   P H 
Sbjct: 159 KIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHK 218

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            LGF+ W +PGAF EY +   GS GKF  F++  +++L+ + G++  G   SEA NPRK 
Sbjct: 219 VLGFKNWSNPGAFAEYIS--KGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKV 276

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGK-SMSAAASPFVVAIQNSGIK 373
           +P + +    R+I+FY+     +G+ V +ND  ++    + ++ A ASP+V A++  GI 
Sbjct: 277 IPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIG 336

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           VLPHI N  +L  + SA NS LY +SR L+ LA++G+APK+F K +K GVP    +  +L
Sbjct: 337 VLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLF-KITKRGVPIYCCVAVLL 395

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
            C LAY++VS+ +  +  +F+NV +    + +I I I Y+ F K C+AQ ID     Y +
Sbjct: 396 VCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSS 455

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK 553
               Y  + +L + +L+  +  + VFL   +D ++FI  Y  +P +I+ +AG+KL  KT+
Sbjct: 456 SFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTR 515

Query: 554 VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERL 587
            +K  ++DL  F  I +  EE+   ++   +  L
Sbjct: 516 FVKPVEMDL--FSGIAELAEEDAYWEENPPKMNL 547

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  274 bits (700), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 166/518 (32%), Positives = 272/518 (52%), Gaps = 18/518 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            NT L K L  RH+                         P ++++ +  +   +F  +  
Sbjct: 39  NNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINS 98

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGE+A+  P+  GF  Y +R+VDP++GFA+   YL ++ +L P +L AA+L I+YW   D
Sbjct: 99  LGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYW--ND 156

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           ++N   W+ IF V IV  N++ VK FGE EF LS  K                   P   
Sbjct: 157 KINSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGG 216

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            LGF+YW +PGAF   + A      KF    +VFV + FS++GIE+  +  +E++NPRK 
Sbjct: 217 YLGFKYWNNPGAFVGGTNA-----SKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKV 271

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +PKA K T + +   Y+  + L+G  V YND RLL+    S+ AAASP V+AI+N GIK 
Sbjct: 272 IPKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNA-ATSVDAAASPLVIAIENGGIKG 330

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP + NA +L+ + S  NS +Y  SR + ++A  G  PK+ +K  K G P NALI++++F
Sbjct: 331 LPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIF 390

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             L+++  S    ++F +   +  +  I  W+ I    I F +A + Q     +  Y++ 
Sbjct: 391 GLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQ 450

Query: 495 GQRYGAYFALSFCILIALIKNFTVF--LGHKF-DYKTFITGYIGLPVYILSWAGYKLIYK 551
              +GA++ +    L+ +   +T    LG    D ++F   ++ LP+ ++ + G+KL + 
Sbjct: 451 TGIWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFA 510

Query: 552 TK---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
                 I + ++D+ + ++I D   EEG  +++E EE+
Sbjct: 511 RNWRLQIGAEEMDIDSGRKIID---EEGLKQEREEEEK 545

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  275 bits (702), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 168/519 (32%), Positives = 273/519 (52%), Gaps = 26/519 (5%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           + +  ++ ++LK+RHI +                       P  +LI+Y  +   V+  M
Sbjct: 61  EGQEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIM 120

Query: 134 ACLGEMASYIPLDGFTSY---ASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
             L EM   +P+ G TS       Y++  L F  G    +   ++ P+++TA A++IQYW
Sbjct: 121 NFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYW 180

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                 N  ++I+IF+VV V++ ++ V FFGE EFW+S  K                   
Sbjct: 181 TD---ANSAIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGA 237

Query: 251 PDHDR-LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCS-EA 308
           P+ D+ LGF YW+ PGAF  +   + G+TGKF +     + S FSY  +    + C+ EA
Sbjct: 238 PNQDKVLGFHYWKHPGAFNPH--LVPGNTGKFLACWTAIIKSGFSYVLVPEVVVSCAAEA 295

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMS-AAASPFVVAI 367
           ++PR+++P+  +  VYR+ +FY+C    +G+ V Y++ RLL+      S AAASPFV+ I
Sbjct: 296 KDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGI 355

Query: 368 QNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNA 427
           Q  GI+VLPHI NAC+L   +S   S LY +SR L+++A++G  PKIFA T+++G PY +
Sbjct: 356 QEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYS 415

Query: 428 LILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC-RAQGIDK 486
              + +FC LAY+N S  S+ +F +  N+ ++ G + W+ + +VY+ F K    A   DK
Sbjct: 416 TAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLTDK 475

Query: 487 SKF--AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWA 544
             F   ++ P     AY +  F  +++L   + VF+   ++   F   Y  L +  + + 
Sbjct: 476 MPFRKRFMKP----LAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYI 531

Query: 545 GYKLIYKTKVIKSTDVDLYTFKEIYDR-----EEEEGRI 578
           G  + YKT  IK  D+D     EI  +     EEE+G +
Sbjct: 532 GAAIYYKT--IKLRDLDEVA-AEIIPKIAMADEEEKGEV 567

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  270 bits (691), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 170/530 (32%), Positives = 268/530 (50%), Gaps = 24/530 (4%)

Query: 79  RLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGE 138
           ++ + LK RHI +                       P  +LIAY  +   V+  M  + E
Sbjct: 54  KIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTE 113

Query: 139 MASYIPLDG---FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
           M   IPL G     S A  Y++  + F  G+   +   ++ P ++TA AL++QYW     
Sbjct: 114 MVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWTD--- 170

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
            N  ++I+IF+VV + + ++ VK FGE EFW+SS K                   P  D 
Sbjct: 171 ANSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDH 230

Query: 256 -LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCS-EAENPRK 313
            LGF YW++PGAF  +     G+TG+F +     + S FS+  +  T   CS E   PR+
Sbjct: 231 VLGFHYWKNPGAFNPHLA--EGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRR 288

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASPFVVAIQNSG 371
           ++PKA +  +YR+ +FY+    ++G+ V +N+ RL++    GKS  AAASPFV+ IQ +G
Sbjct: 289 NMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKS-DAAASPFVIGIQEAG 347

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           IK+LPHI NAC+L   +S     LY SSR LY++A+ G APKIFAK +++G PY +  L+
Sbjct: 348 IKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLA 407

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            LF  LAY+N S  ++ +FN+  N+ ++ G +SWI + + YI F K   A  ++  +  +
Sbjct: 408 SLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLND-RVPF 466

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
             P Q   AY    F  +++L   + VF+   ++   F   Y+ +   I  +      YK
Sbjct: 467 RRPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYK 526

Query: 552 T---KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFY 598
               +  K  +V++    +I D EE    I        + RN     W++
Sbjct: 527 QWTFRDFKEIEVEILPKIDIADEEERNDVIP-------VPRNFMEKVWYF 569

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  270 bits (689), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 169/561 (30%), Positives = 289/561 (51%), Gaps = 38/561 (6%)

Query: 29  QDADNFPVKE----QEIYNIDLEENNVXXXXXXXXXXXXXXXXFAIADGKDENTRLKKEL 84
           Q A +  VKE    + I   DLE  ++                  + D K  + ++++ L
Sbjct: 21  QGASDMKVKENFVTESIQEDDLERGSID----------------VLIDEKPSH-QMQRGL 63

Query: 85  KARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEMASYIP 144
           K+RH+ +                       P  +LI+Y  +   V+  M  L EM    P
Sbjct: 64  KSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTEMVVLTP 123

Query: 145 LDGFTSY---ASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVW 201
           + G  S    A  Y++  L F  G+   +   ++ P+++TA+ L+IQYW      N  ++
Sbjct: 124 IPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWTD---ANSAIF 180

Query: 202 ITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD-HDRLGFRY 260
           ++IF+V+ +A+  + VK FGE EFW+S  K                   P+ H  LGF Y
Sbjct: 181 VSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVLGFHY 240

Query: 261 WRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCS-EAENPRKSVPKAI 319
           W+ PGAFK + +  TG+TGKF +     + S F++     T   CS EA+ PR+++P+A 
Sbjct: 241 WKHPGAFKPHIS--TGNTGKFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNMPRAA 298

Query: 320 KLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMS-AAASPFVVAIQNSGIKVLPHI 378
              V+R+++FY+    ++G+ V Y++  LLS      S AAASPFV+ I+  GIKVLPHI
Sbjct: 299 NRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKVLPHI 358

Query: 379 FNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLA 438
            NA +L   +SA  +++Y +SR L+++A+ G APKIFA+ +++GVPY ++I+   FC LA
Sbjct: 359 INAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCFCFLA 418

Query: 439 YMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRY 498
           Y+N S+ ++++F +  N+ ++ G +SW+ + I Y+ F +      ++  +  +  P QR 
Sbjct: 419 YLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLND-RIKFRKPFQRI 477

Query: 499 GAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLP----VYILSWAGYKLIYKTKV 554
            AYF+  F ++++L   + VF    +    F   YI +     ++I+  A YK  ++ + 
Sbjct: 478 FAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYKE-WRFRD 536

Query: 555 IKSTDVDLYTFKEIYDREEEE 575
           ++    +L    ++ D EE  
Sbjct: 537 MEEIRSELIPKIDMADEEESN 557

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  270 bits (689), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 163/527 (30%), Positives = 264/527 (50%), Gaps = 22/527 (4%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           K E   LKK +K RH+ M                       P  ++I YA +G  ++  +
Sbjct: 136 KFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCII 195

Query: 134 ACLGEMASYIP--LDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
              GEMA      L GF +Y S  VDP  GFA+ + Y  ++  + P +L   +L I+YW 
Sbjct: 196 QAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWT 255

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
           +   VNP  ++ IF VVI+ I I G + + E EF+ +  K                    
Sbjct: 256 TT--VNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAG 313

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
           +   LG +YW DPGAF+      T    +F   +A FV + F++   E   +  +E  NP
Sbjct: 314 NDGYLGAKYWHDPGAFRG-----TNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNP 368

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RK++P A K  +YR+I  ++ T+ LLG  V ++  +L+   G +  A  SP+V+AI   G
Sbjct: 369 RKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKA--SPYVLAISIHG 426

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           ++V+PH  NA +L+ VFS  NS  Y SSR L  LA  G APK F    + G P+ A+  +
Sbjct: 427 VRVVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCA 486

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            LF  +A+   S    ++F + + +  +  + +WI I + +I F +A   QG    +  +
Sbjct: 487 ALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGF 546

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGY 546
            A    YG+Y+A +  +++ALI  F V +         D + F   Y+ +P+ I  + GY
Sbjct: 547 KAQLGVYGSYYA-TIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGY 605

Query: 547 KLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           KL  +     I++ D+DL ++++++D  EE  + +D+E +E+L +NG
Sbjct: 606 KLWKRDWRLFIRAKDIDLDSYRQVFD--EELLKQEDEEYKEKL-KNG 649

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  269 bits (687), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 165/526 (31%), Positives = 277/526 (52%), Gaps = 21/526 (3%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
            +++  LKK +K RH+ M                       P A++I YA +G  ++  +
Sbjct: 114 NEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCII 173

Query: 134 ACLGEMAS-YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
              GE+A  Y  L+G F +Y S  VDPALGF++ + Y  ++  + P +L  A++ I+YW 
Sbjct: 174 QAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWT 233

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
           ++  V+P V++ IF V+I+AIN  G + + E EF+ +  K                    
Sbjct: 234 TK--VDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAG 291

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
           +   LG +YW DPGAF         S  +F   +  FV + F++   E   +  +E  NP
Sbjct: 292 NDGYLGAKYWHDPGAFNG-----DKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNP 346

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RK++P A K  +YRI+  +L ++ L+G  V YN  +LL + G  + A  SP+V+A+ + G
Sbjct: 347 RKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKA--SPYVIAVSSHG 404

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           ++V+PH  NA +L+ V S  NS  Y SSR L +LA  G APK F    + G P+ A+++S
Sbjct: 405 VRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMS 464

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            LF  +A+   S    ++F++ + +  +  + +WITI + +I F +A + QG    +  Y
Sbjct: 465 ALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGY 524

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYK 547
           ++    YG+ +A +  + +ALI  F V +      K D + F   Y+ +P+ I  + GY+
Sbjct: 525 LSQSGVYGSAYA-AIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYR 583

Query: 548 LIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           +  +     I++ D+DL T ++I+D  E   R +D+E +E+L RNG
Sbjct: 584 VWKRDWKLFIRAKDIDLDTHRQIFD--ENILRQEDEEYKEKL-RNG 626

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  268 bits (684), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 164/521 (31%), Positives = 269/521 (51%), Gaps = 15/521 (2%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            NT L K+L  RH+                         P +++I +  +   +F  +  
Sbjct: 82  NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGE+++  P+  GF  Y+ R+V+P+  FA+   YL ++ +L P +L AA++ I+YW   D
Sbjct: 142 LGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--ND 199

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           ++N   W+ IF   I   N++ VK FGE EF LS  K                   P   
Sbjct: 200 KINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGG 259

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G +YW DPGAF  +S+       +F    +VFV + FSY+GIE+T +  +E++NPR++
Sbjct: 260 YIGGKYWHDPGAFVGHSSGT-----QFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +PKA K T + I   Y+  + L+G  V  NDPRLL+    S+ AA+SP V+AI+N GIK 
Sbjct: 315 IPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLN-GSSSVDAASSPLVIAIENGGIKG 373

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP + NA +L+ V S  NS +Y  SR + A+A  G  PK   +  K G P NA++L++ F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFF 433

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             L+++  S   A++F +   +  +  I  W+ I + +I F +A + Q     +  +++ 
Sbjct: 434 GLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQ 493

Query: 495 GQRYGAY--FALSFCILIALIKNFTVFLGHK-FDYKTFITGYIGLPVYILSWAGYKLIYK 551
               G++  F + F +LIA        LG    + ++F  GY+  P+ I+ + G+K+  +
Sbjct: 494 TGVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTR 553

Query: 552 --TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRN 590
             T ++K  D+DL T ++  D       +K  ERE   +R+
Sbjct: 554 NWTLMVKLEDIDLDTGRKQVDLALRREEMK-VERETLAKRS 593

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  267 bits (683), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 158/502 (31%), Positives = 259/502 (51%), Gaps = 16/502 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            NT L K+L  RH+                         P +++I +  V   +F  +  
Sbjct: 84  NNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINS 143

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGE+A+  P+  GF  Y +R+++P+  FAI   YL ++ +L P +L AA++ I+YW   D
Sbjct: 144 LGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYW--ND 201

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           ++N   W+ IF   I   N++ VK FGE EF LS  K                   P   
Sbjct: 202 KINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGG 261

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G +YW +PGAF  +S        +F    +VFV + FSY+GIE+T +  +E+ NP+++
Sbjct: 262 YIGGKYWHNPGAFVGHSAG-----SQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKET 316

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +PKA K T + I V Y+  + L+G  V YNDPRLL+    S+ AAASP V+AI+N GIK 
Sbjct: 317 IPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGS-SSVDAAASPLVIAIENGGIKG 375

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP + NA +L+ + S  NS +Y  SR + ++A  G  PK  +K  K G P NA++L++ F
Sbjct: 376 LPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFF 435

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             L+++  S    ++F +   +  +  I  W+ I +  I F  A +AQG    +  +++ 
Sbjct: 436 GLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQ 495

Query: 495 GQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
              +GA++ +   + + L+ +F   L          K+F  GY+ LP+ I  + G+KL  
Sbjct: 496 SGTWGAWYGV-IVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWK 554

Query: 551 KT--KVIKSTDVDLYTFKEIYD 570
           +    ++   ++DL + + + D
Sbjct: 555 RDWRLLVPLMEMDLDSGRRVLD 576

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  267 bits (682), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 167/514 (32%), Positives = 267/514 (51%), Gaps = 21/514 (4%)

Query: 80  LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEM 139
           L+  LK R  +M                       P  ++I +     +++  +  LGE+
Sbjct: 103 LQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGEL 162

Query: 140 ASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNP 198
           A   P+  GFT+YA+R+VD + G+A  + Y  ++ ++ P ++ +A++ + YW +  R   
Sbjct: 163 AVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRD 222

Query: 199 GVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 258
           G ++ +F +VIV IN+ GVK FGE EF  S  K                   P    +G 
Sbjct: 223 G-FVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGA 281

Query: 259 RYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKA 318
           +YW DPGAF  +     GS  +F    +VFV + FS+ G EL GI  +EA NPRKS+P A
Sbjct: 282 KYWHDPGAFVGH-----GSGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGA 336

Query: 319 IKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHI 378
            K  V+RI++FY+ T+ ++G+ V YND RL+     S+ AAASPFV+AI   GIK LP +
Sbjct: 337 AKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGAS--SVDAAASPFVIAIVTHGIKGLPSV 394

Query: 379 FNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLA 438
            N  +L+ V S  NS ++  SR + AL+  G  PK+F    + G P   + ++  F  LA
Sbjct: 395 INVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLA 454

Query: 439 YMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRY 498
           ++  S    ++FN+ + +  +  + +W  I + +I F  A +AQG D ++  +V+P    
Sbjct: 455 FVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVA 514

Query: 499 GAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK-- 553
           G+Y+ L F I++  I  F V L   G K D + F   Y+  P+ + ++ G+K IYK    
Sbjct: 515 GSYWGL-FMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHK-IYKRNWK 572

Query: 554 -VIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
             I   D+D+ T +    RE +   +K +  EE+
Sbjct: 573 LFIPLEDMDIDTGR----RETDMELLKQEIMEEK 602

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  266 bits (681), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 164/533 (30%), Positives = 273/533 (51%), Gaps = 21/533 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            NT L K+L  RH+                         P +++I +  +G  +F  +  
Sbjct: 82  NNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINS 141

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGE+++  P+  GF  Y  R+V+P+  FA+   YL ++ +L P +L AA++ I+YW   D
Sbjct: 142 LGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--ND 199

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           ++N   W+ IF   I   N++ VK FGE EF LS  K                   P   
Sbjct: 200 KINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGG 259

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G +YWR+PGAF  +++       KF    +VFV + FSY+GIE+T +  +E++NPR++
Sbjct: 260 YIGGKYWRNPGAFVGHNSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +PKA K T + I   Y+  + L+G  V  NDPRLL+    S+ AA+SP V+AI+N  IK 
Sbjct: 315 IPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLN-GSSSVDAASSPLVIAIENGRIKG 373

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP + NA +L+ V S  NS +Y  SR + A+A  G  PK   +  K G P NA++L++ F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFF 433

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             L+++  S+  A++F +   +  +  I  W+ I + +I F KA + Q     +  +++ 
Sbjct: 434 GLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQ 493

Query: 495 GQRYGAY--FALSFCILIALIKNFTVFLGHK-FDYKTFITGYIGLPVYILSWAGYKLIYK 551
               G++  F + F +LIA        +G      ++F  GY+  P+ I+ + G+K+  +
Sbjct: 494 TGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIVCYFGHKIYTR 553

Query: 552 --TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFL 602
             T ++K  D+DL T ++  D       +  +  E +++R     + F  +FL
Sbjct: 554 NWTLMVKIEDIDLDTGRKQVD-------LTLRREEMKIERENLAKKSFITRFL 599

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  266 bits (680), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 172/538 (31%), Positives = 277/538 (51%), Gaps = 31/538 (5%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            +++L K+L  RH+                         P ++++A+  V   +F  +  
Sbjct: 84  NDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNA 143

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGE+A+  P+  GF  Y +R+V+P+ GFA+   YL ++ +L P +L AA++ I+YW   +
Sbjct: 144 LGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYW--NN 201

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            +N   W+ IF   I   N++ VK FGE EF LS  K                   P  +
Sbjct: 202 TINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGE 261

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGK-FTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
            +G RYW DPGAF      +  + G+ F    AVFV + FSY+G EL  +  +E+ NPR 
Sbjct: 262 YIGGRYWNDPGAF------VGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRV 315

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           ++PKA K T + I + Y+  + ++G  V YND RLL+    S+ AAASP V+AI+N GIK
Sbjct: 316 TLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGN-SSVDAAASPLVIAIENGGIK 374

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
            LP + NA +L+ + S  NS +Y  SR + A+A  G  PK      K G P  A+  +++
Sbjct: 375 GLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLI 434

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  L+++  S    ++F +   +  +  +  W +I + +I F +A +AQ    ++  +V+
Sbjct: 435 FGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVS 494

Query: 494 PGQRYGAYFALSFCILI--ALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYK 547
               YG+++    CI+I   LI +F   L        D ++F  GY+ LP++I+ + G+K
Sbjct: 495 ITGVYGSWYG---CIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHK 551

Query: 548 LIYKTK---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFL 602
            +YK      +K+ D+DL T +    RE +   +K + R ER Q   K    FY +FL
Sbjct: 552 -VYKKDWRLYVKTKDMDLDTGR----REIDLDILKQEIRLEREQMAQKP---FYIRFL 601

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  266 bits (680), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 157/502 (31%), Positives = 260/502 (51%), Gaps = 16/502 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            NT L K+L  RH+                         P +++I +  +   +F  +  
Sbjct: 82  NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGE+++  P+  GF  Y+ R+++P+  FA+   YL ++ +L P +L AA++ I+YW   D
Sbjct: 142 LGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--ND 199

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           ++N   W+ IF   I   N++ VK FGE EF LS  K                   P   
Sbjct: 200 KINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGG 259

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G +YW DPGAF  +S+       +F    +VFV + FSY+GIE+T +  +E++NPR++
Sbjct: 260 YIGGKYWHDPGAFVGHSSGT-----QFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +PKA K T + I   Y+  + L+G  V  NDPRLL+    S+ AA+SP V+AI+N GIK 
Sbjct: 315 IPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLN-GSSSVDAASSPLVIAIENGGIKG 373

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP + NA +L+ V S  NS +Y  SR + A+A  G  PK   +  K G P NA++L++ F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFF 433

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             L+++  S   A++F +   +  +  I  W+ I + +I F +A + Q     +  +++ 
Sbjct: 434 GLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQ 493

Query: 495 GQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
               G+++     + + LI +F   L    G     ++F  GY+  P+ I+ + G+KL  
Sbjct: 494 TGVKGSWYGF-IVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYT 552

Query: 551 K--TKVIKSTDVDLYTFKEIYD 570
           +  T ++K  D+DL T ++  D
Sbjct: 553 RNWTLMVKLEDMDLDTGRKQVD 574

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  265 bits (678), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 175/569 (30%), Positives = 281/569 (49%), Gaps = 21/569 (3%)

Query: 32  DNFPVKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAIADGKDENTRLKKELKARHISM 91
            NF + +  + + D   N                   +  D    +T + + LK+RH+  
Sbjct: 16  SNFEMTDASLTSRDHSTNQKKDAIITAVEQDIERGSLSDIDTIKPSTEVSRGLKSRHVQF 75

Query: 92  XXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEMASYIPLDGFTSY 151
                                  P  +LI+Y+ +   V+  M  + EM   IPL G +S 
Sbjct: 76  IALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSM 135

Query: 152 AS---RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVV 208
           AS    Y++    F  G+   +   ++ P ++TA AL+I+YW      N  +++TIF+++
Sbjct: 136 ASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWTD---ANAAIFVTIFMIL 192

Query: 209 IVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP-DHDRLGFRYWRDPGAF 267
              ++++ VK FGE EF +S  K                   P  H  LGF YW  PGAF
Sbjct: 193 ATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAF 252

Query: 268 KEYSTAITGSTGKFTSFVAVFVYSLFSYTGI-ELTGIVCSEAENPRKSVPKAIKLTVYRI 326
             Y   + GSTG F +     + S F++  I E+T    +EA  PRK++P+A +  VYR+
Sbjct: 253 NSY--LVKGSTGAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYRL 310

Query: 327 IVFYLCTVFLLGMCVAYNDPRLLS--TKGKSMSAAASPFVVAIQNSGIKVLPHIFNACVL 384
            VFY+    ++G+ V Y++  L    + GK+ +AAASPFV+ IQ +GI++LPHI NAC+L
Sbjct: 311 AVFYVLGCLVIGVIVGYDNKTLNEAISSGKA-NAAASPFVIGIQEAGIRILPHIINACIL 369

Query: 385 VFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLAYMNVSS 444
              +S   S+LY +SR L++LA+ G APK F+K +K+GVPY ++  + LF  LAY+N S 
Sbjct: 370 TSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSK 429

Query: 445 GSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFAL 504
            S  +FN+  N+ ++ G ++W+ + I Y+ F K      I+  +  Y   GQR  AY + 
Sbjct: 430 SSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKIND-RVPYRRRGQRALAYASA 488

Query: 505 SFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKVIKSTDVDLYT 564
            F  L+A+   F VF+   ++   F T Y+ +    + + G  + YK    +  DV    
Sbjct: 489 IFFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYKEWTFRDMDV---V 545

Query: 565 FKEIYDREEEEGRIKDQEREERLQRNGKN 593
            +EI  + ++     DQE +E      KN
Sbjct: 546 GREIMPKIDQ----ADQEEKEEYLPPPKN 570

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  265 bits (677), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 164/524 (31%), Positives = 264/524 (50%), Gaps = 19/524 (3%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           +  +  LKK +K+RH+ M                       P A++I Y  V  + +F +
Sbjct: 60  ESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMI 119

Query: 134 ACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
              GEMA +Y  L G F +Y S ++   +GFA  + +L ++  + P +L    + IQYW 
Sbjct: 120 QAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYW- 178

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
             D +N  VWI IF V ++ +++ GVK +GE EF  ++ K                    
Sbjct: 179 -NDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAG 237

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
               +G +YW++PG+F     A + S G+F     V V + FSY G EL  +  +E  NP
Sbjct: 238 TDGYIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANP 292

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           R+S PKA K ++YRI++ YL T+ L+G  V +++ +L+   G S  A  SP+V+A    G
Sbjct: 293 RRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHA--SPYVLAASIHG 350

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           +KV+PHI NA +L+ V S  NS LY + R   +LA  G APK  A   + G P  AL   
Sbjct: 351 VKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAAC 410

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            +   +A+   SS   ++F +   + ++  + +W TIL+ +I F  A + QG D ++  Y
Sbjct: 411 AVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGY 470

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKL 548
            A    +G+ +   FC+L+  I  F V L   G     + F   Y+  P+++  +  Y L
Sbjct: 471 KALTGVWGSMWGFGFCVLV-FIAQFWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYML 529

Query: 549 IYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRN 590
             +  T + K  D+DL   + IYD E    R +D+ER+E+++ +
Sbjct: 530 WKRDFTFLTKLEDIDLDAHRRIYDPEFL--RQEDEERKEKIRNS 571

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  264 bits (675), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 166/530 (31%), Positives = 279/530 (52%), Gaps = 23/530 (4%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
            + L++ LK RH+ M                       P  +LI +  +GL+++  +  +
Sbjct: 74  QSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSM 133

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
           GE+A   P+ G FT+YA+R+VD + GFAI Y Y+ ++ ++ P ++ AA++ + +W +  +
Sbjct: 134 GELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPK 193

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
              G ++ +F +VIV IN  GV+ +GE EF  S  K                   P    
Sbjct: 194 YRDG-FVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGY 252

Query: 256 LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 315
           +G +YW +PGAF   S    GS  +F    +VFV + FS+ G EL G+  +E  NPRK++
Sbjct: 253 IGGKYWHNPGAF---SGDDAGS--RFKGVCSVFVTAAFSFAGTELVGLASAETANPRKAL 307

Query: 316 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVL 375
           P+A K   +RI++FY+ ++ L+G+ V +   RL+ T   S+ AAASPFV+AIQ  GIK L
Sbjct: 308 PRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTS--SVDAAASPFVLAIQTHGIKGL 365

Query: 376 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFC 435
           P + N  +L+ V S  NS +Y  SR++ ALA  G  P IFA   + G P  A+I + +F 
Sbjct: 366 PSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFG 425

Query: 436 CLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 495
            L+++  S     +FN+ + +  +  + SW  I I +I F +A  AQG    + A+V+  
Sbjct: 426 LLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYA 485

Query: 496 QRYGAYFALSFCILIALIKNFTVF---LGHKFDYKTFITGYIGLPVYILSWAGYKLIYKT 552
              G+YF +   +L+ LI  F V    +G   + + F + Y+  PV +L++  +  I+K 
Sbjct: 486 GIAGSYFGV-ILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPV-LLAFYIFHKIWKR 543

Query: 553 K---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYE 599
                 ++ D+D+ T +    RE +   ++ +  EE++  + +   W+Y 
Sbjct: 544 NWKLFTRAKDIDIDTGR----REMDTEALRQEIAEEKMLLSTR--PWWYR 587

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  264 bits (674), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 168/536 (31%), Positives = 275/536 (51%), Gaps = 31/536 (5%)

Query: 70  IADGKDE-NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 128
           I+   DE N +LKK ++ RH+ M                       P  ++I YA +   
Sbjct: 88  ISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASC 147

Query: 129 VFFTMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALV 186
           ++  +  +GEMA +Y+ L  GF +Y    VDPAL F+I + Y  ++F + P +L  A++ 
Sbjct: 148 IYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMT 207

Query: 187 IQYWISRDRVNPGVWITIFLVVIVAINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXX 245
           IQYW ++  VN  +++ IF ++++AINI G  + + E EF  +S K              
Sbjct: 208 IQYWTTK--VNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVI 265

Query: 246 XXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGI 303
                 +   +G +YWRDPGAF+       GS G  +F   V+  V + FS+   E   I
Sbjct: 266 ICGGAGNDGFIGGKYWRDPGAFR-------GSDGPNRFKGVVSTLVTAAFSFGQTEFLAI 318

Query: 304 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPF 363
             SE  NPRK++P A K  +YR ++ YL ++ ++G+ V Y+   LL +   S +  ASP+
Sbjct: 319 TASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSS--SAATKASPY 376

Query: 364 VVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGV 423
           V+A+   G++V+PH  NA +L+ VFS  +S  Y SSR L  LA  G APK+F    + G 
Sbjct: 377 VLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGR 436

Query: 424 PYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQG 483
           P    ++  +   +A+   SS   ++FN+ + +  +  + +W  I + +I F +A + QG
Sbjct: 437 PSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQG 496

Query: 484 IDKSKFAYVAPGQRYGAYFALSFCILIALIKNFT--VFLGH-KFDYKTFITGYIGLPVYI 540
               +  Y +    +G+ +A    ILI + + +   V +G    D + F   Y+ +PV+I
Sbjct: 497 RSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFI 556

Query: 541 LSWAGYKLIYKTK---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ--RNG 591
           + + GYK I+K      I++ D+DL + + I+D E     I  QEREE  +  RNG
Sbjct: 557 VLYLGYK-IWKRDWRLFIRAKDIDLISHRHIHDPE-----ILRQEREEYQEKLRNG 606

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  263 bits (673), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 165/527 (31%), Positives = 267/527 (50%), Gaps = 24/527 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            N++ K+ +K+RH+ M                       P  +LI Y+ V ++ +  M  
Sbjct: 78  SNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQA 137

Query: 136 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEMA +Y  L G F  Y+S ++  + GFA  + Y  ++  + P +L  A+L I+YW S 
Sbjct: 138 AGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYWNSS 197

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
             +NP  +I IF  VIV I+  G   +GE EF  S+ K                      
Sbjct: 198 --INPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTG 255

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G  YWR+PGAF   S       G F     V V + FSY G+EL  +  +E  NPRK
Sbjct: 256 GYIGGEYWRNPGAFAGGSP-----IGHFKGIAYVLVTAYFSYGGMELFALTVNEQANPRK 310

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           +VP A K  +YRI++ Y+ T+ L+G  V YN   L+ + GKS +  ASP+V+A+ + G+K
Sbjct: 311 AVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKS-ATHASPYVIAVASHGVK 369

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           V+PHI NA +L+ V S  NS +Y + R L +LA  G APKIF+   + G P  AL+   +
Sbjct: 370 VVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCSI 429

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  L+++  S    ++F +   +  +  + +W  I + ++ F  A + QG   S+  Y +
Sbjct: 430 FGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYKS 489

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAGYKL 548
               +G+ +A+ F I++  +  F V L     G K D + F   Y+  P++I  + GYK+
Sbjct: 490 KTGYWGSIYAIFFNIIV-FVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCYVGYKI 548

Query: 549 IYKT--KVIKSTDVDLYTFKEIYDRE--EEEGRIKDQEREERLQRNG 591
             K    ++   ++DL + + I+D+   ++E    D E +E+L+ +G
Sbjct: 549 YSKEWKLLVPLDEIDLNSHRHIFDKHILQQE----DDEHKEKLKNSG 591

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  263 bits (673), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 166/521 (31%), Positives = 265/521 (50%), Gaps = 22/521 (4%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           +  N+ L+  LK RH+ M                       P  +LI +   G +++  +
Sbjct: 75  RTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMV 134

Query: 134 ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             LGE+A   P+ G FT+YA+R++D + GFA    Y+ ++ ++ P ++ AA++ + YW +
Sbjct: 135 MALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGT 194

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
             R   G ++ +F + I  IN+ GVK +GE EF  S  K                   P 
Sbjct: 195 NPRYRDG-FVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPV 253

Query: 253 HDRLGFRYWRDP-GAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
              +G RYW  P GAF   S        +F    +VFV + FS+ G EL G+  +E  NP
Sbjct: 254 KGYIGGRYWHHPYGAFVGDSAG-----ARFKGVCSVFVTAAFSFAGSELVGLASAETANP 308

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RKSVPKA K   +RI +FYL  + ++G+ V Y + RL+     S+ AAASPFV+AI   G
Sbjct: 309 RKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGAS--SVDAAASPFVIAITTHG 366

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           I+ LP + N  +L+ V S  NS +Y  SR L ALA     PK F    + G P  +++++
Sbjct: 367 IRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVT 426

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
             F  +A++  S    ++FN+ + +  +  + +W  I + +I F KA  AQG    + ++
Sbjct: 427 SGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSF 486

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKL 548
           V+P   YG+Y+ L F I++  I  F V L   G K + K F   Y+  P+ I  + G+K 
Sbjct: 487 VSPAGVYGSYWGL-FMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHK- 544

Query: 549 IYKTK---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
           IYK      IK+ D+D+ T +    ++++   ++ +  EER
Sbjct: 545 IYKKNWKIFIKAEDMDIDTGR----KDDDLDLLRQEVAEER 581

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  263 bits (673), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 164/529 (31%), Positives = 271/529 (51%), Gaps = 23/529 (4%)

Query: 80  LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEM 139
           LK  LK RH+ M                       P  ++I +     +++  +  LGE+
Sbjct: 95  LKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGEL 154

Query: 140 ASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNP 198
           A   P+ G FT+YA+R++D + GFA  + Y  ++    P ++ +A++ + YW + +R   
Sbjct: 155 AVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRD 214

Query: 199 GVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 258
           G ++ +F +VIV IN+ GV+ FGE EF  S+ K                   P+   +G 
Sbjct: 215 G-FVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGG 273

Query: 259 RYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKA 318
           RYW +PGAF   +        +F    +VFV + FS+ G EL GI  +EA NPRKSVP+A
Sbjct: 274 RYWHNPGAFVGDNAGT-----QFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRA 328

Query: 319 IKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHI 378
            K  V+RI++FY+ ++ ++G+ V Y DPRL+     S+ A+ASPFV+AI   GI+ LP +
Sbjct: 329 AKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGAS--SVDASASPFVIAIVTHGIRGLPSV 386

Query: 379 FNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLA 438
            N  +L+ V S  NS ++  SR + AL+  G  P+IF    + G P   +I+   F  +A
Sbjct: 387 INVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIA 446

Query: 439 YMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRY 498
           ++  S    ++F + + +  +  + +W  I + +I F  A +AQG   ++  +V+P    
Sbjct: 447 FIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGII 506

Query: 499 GAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK-- 553
           G+ + L F +L+  I  F V L   G K   + F   Y+  P+ +  + G+K IYK    
Sbjct: 507 GSSWGL-FMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHK-IYKKNWK 564

Query: 554 -VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKF 601
             IK+ D+D+ T +    RE +   +K +  EE+     K   W+Y ++
Sbjct: 565 LFIKAEDMDIDTGR----RETDLELLKQEIEEEKAILATKG--WWYRQY 607

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  262 bits (670), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 168/529 (31%), Positives = 268/529 (50%), Gaps = 32/529 (6%)

Query: 73  GKDENT----RLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 128
           G DE T    ++KK +K+RH+ M                       P  ++I Y     +
Sbjct: 53  GYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAM 112

Query: 129 VFFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALV 186
           ++  +   GE+   Y  + G +T+Y+S  VDPALGF++ + Y  ++  + P QL  AA+ 
Sbjct: 113 LYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAIT 172

Query: 187 IQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXX 246
           I+YW      NP +++ I   +IV IN+ G K + E EF  ++ K               
Sbjct: 173 IKYWTD---TNPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIIN 229

Query: 247 XXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCS 306
                +   +G RYW  PGAF         STG F     VF Y+ F+Y GIE+  +  S
Sbjct: 230 CGGAGNDGYIGARYWHTPGAF---------STG-FKGVCYVFCYAAFAYGGIEVMVLTAS 279

Query: 307 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVA 366
           E ENPRKS+P A K  +YRI++ Y+ T  ++   V Y+ P L ST   S    ASPFV+A
Sbjct: 280 EQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASR---ASPFVIA 336

Query: 367 IQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYN 426
           I + GI V+PHI NA +LV V S  NS LY + R L +L+  G APK+F    + G P  
Sbjct: 337 IASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLL 396

Query: 427 ALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK 486
             ++++    LA++  S     +F++ + +  +  +  WI+I + ++ F  A +AQG   
Sbjct: 397 CFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSL 456

Query: 487 SKFAYVAPGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIL 541
            +  Y +    +G++FA+   + + L+  F V +     G K   K F   Y+  PV I 
Sbjct: 457 GEVGYKSQTGYWGSWFAIIVSLFV-LVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIF 515

Query: 542 SWAGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ 588
            + GYK+ YK     I +T+VDL + ++I+D  E+E + +D + +E+++
Sbjct: 516 IYFGYKIYYKDWRLCIPATEVDLNSHRKIFD--EDELKQEDLDWKEKMR 562

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  263 bits (671), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 167/508 (32%), Positives = 253/508 (49%), Gaps = 21/508 (4%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           K   + LK  LK RH+ M                       P  +LI +   G +++  +
Sbjct: 73  KTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMV 132

Query: 134 ACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             +GE+A   P+  GFT+YA+R+VD + GFA  + Y+ ++ ++ P ++ AA++ + YW +
Sbjct: 133 MAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGT 192

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
             +   G ++ +F VVIV IN+ GVK +GE EF  S  K                    D
Sbjct: 193 DPKYRDG-FVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKD 251

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           H  +G +YW +PGAF        G T   +F  F  VFV + FS+ G EL G+  SEAE 
Sbjct: 252 HKYIGAQYWYNPGAF-------VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEE 304

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRKSVP A K   +RI +FY+  + L+GM V  + PRL+     S+ AAASPFV+AI N 
Sbjct: 305 PRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGAS--SVDAAASPFVIAIVNH 362

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           GIK LP + N  +L+ V S  NS +Y  SR L ALA  G  P I     + G P   + +
Sbjct: 363 GIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAI 422

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           S  F  +A++  S     +FN+ + +  +  + +W  I + +I +  A  AQG    +  
Sbjct: 423 SAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELP 482

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYK 547
           + AP   +G+Y+    CIL+  I  F V L   G K +   F   Y+   ++I  +A +K
Sbjct: 483 FQAPAGVWGSYWGFFMCILM-FIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHK 541

Query: 548 LIYKTK---VIKSTDVDLYTFKEIYDRE 572
            I+K      I   D+D+ T +   D +
Sbjct: 542 -IWKRNWKLFIPLKDLDIDTGRREVDLD 568

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  262 bits (670), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 164/513 (31%), Positives = 266/513 (51%), Gaps = 17/513 (3%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
            T LK  LK RH+ M                       P ++LI +   G +++  +  L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMAL 142

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
           GE+A   P+ G FT+YA+R++D + G+A  + Y+ ++ ++ P ++ +A++ + +W +  +
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
              G ++ +F +VIV IN+ GVK +GE EF  S  K                   P+   
Sbjct: 203 YRDG-FVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGY 261

Query: 256 LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 315
           +G +YW DPGAF   +        KF    +VFV S FS+ G EL G+  SE+ +PRKSV
Sbjct: 262 IGGKYWHDPGAFAGDTPG-----AKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSV 316

Query: 316 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVL 375
           PKA K   +RI +FY+ ++ ++G+ V YNDP L+     S+ AAASPFV+AI+  GIK L
Sbjct: 317 PKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGAS--SVDAAASPFVIAIKTHGIKGL 374

Query: 376 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFC 435
           P + N  +L+ V S  NS +Y  SR + ALA     P+IFA   + G P   + ++  F 
Sbjct: 375 PTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFG 434

Query: 436 CLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 495
            +A++  S     +FN+ + +  +  + +W  I I +I F KA  AQG D  + ++ +P 
Sbjct: 435 LIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPT 494

Query: 496 QRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKLIYKT 552
             +G+Y+ L F ++I  I  F V L   G     + F   Y+  P+ +  + G+K IYK 
Sbjct: 495 GVWGSYWGL-FMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHK-IYKR 552

Query: 553 K---VIKSTDVDLYTFKEIYDREEEEGRIKDQE 582
                I + D+D+ T +   D E  +  I +++
Sbjct: 553 NWKLFIPAEDMDIDTGRREVDLELLKQEIAEEK 585

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  262 bits (669), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 159/510 (31%), Positives = 263/510 (51%), Gaps = 18/510 (3%)

Query: 69  AIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 128
           AI +    +  L ++L  RH+                         P +++IA+  +   
Sbjct: 60  AIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTC 119

Query: 129 VFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 187
           +F  +  LGE+A+  P+  GF  Y +R VDP+LGFA+   YL ++ +L P +L AA++ I
Sbjct: 120 LFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITI 179

Query: 188 QYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 247
           +YW   + VN   W+ +F V I   +++ VK FGE EF LS  K                
Sbjct: 180 RYW--NNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLIC 237

Query: 248 XXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSE 307
              P +  +G +YW DPG+F   S        +F    +VFV + FSY+G EL G+  +E
Sbjct: 238 GGGPKNGYIGAKYWNDPGSFVGASPG-----SQFKGLCSVFVTAAFSYSGTELVGVSAAE 292

Query: 308 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 367
           + NPR ++PKA K T + I + YL  + ++G  V ++DP+LLS    S+  AASP V+AI
Sbjct: 293 SANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSAS-SSVDVAASPLVIAI 351

Query: 368 QNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNA 427
           +N GI+ LP + NA +L+ + S  NS +Y  SR + ++A  G  P+IF      G P  A
Sbjct: 352 ENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVA 411

Query: 428 LILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 487
           +I +++F  L+++  S+   +IF +   +  +  +  W+ I I +I F +A   QG    
Sbjct: 412 IIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLD 471

Query: 488 KFAYVAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSW 543
           +  Y++     G+++     IL+ LI +F   L        D+++F  GY+ LP+++  +
Sbjct: 472 ELPYLSMTGVIGSWYGCVVIILV-LIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCF 530

Query: 544 AGYKLIYKTK---VIKSTDVDLYTFKEIYD 570
            G+KL YK     +I+S  +D+ T + + D
Sbjct: 531 VGHKL-YKRNWSWMIRSNKIDVNTGRRMID 559

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  262 bits (669), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 162/524 (30%), Positives = 264/524 (50%), Gaps = 23/524 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            +++LKK +K+RH+ M                       P A++I Y  V  + +F +  
Sbjct: 87  SDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQA 146

Query: 136 LGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEMA   P     F +Y+S ++  + GFA  + Y F++  + P +L  A++ IQ+W   
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFW--N 204

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D++NP ++I IF V +V I+  GVK +GE EF  +  K                    + 
Sbjct: 205 DKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGND 264

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G  YW +PGAF     A   S G+F +   + V + FS+ G+EL  +   E  NPRK
Sbjct: 265 GYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRK 319

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           S P A K ++YRI+V YL T+ L+G  V YND +L+   G +  A  SP+V+A    G+K
Sbjct: 320 STPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHA--SPYVLAASIHGVK 377

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           ++PHI NA +L+ V S  NS LY   R + +LA  G APK      + G P  ALI+  +
Sbjct: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCV 437

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  +A++  SS    +F +   +  +  + +W +I++ ++ F +A + QG    +  Y A
Sbjct: 438 FGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAGYKL 548
               +G+ + + F IL+  +  F V L     G K D ++F   Y+  P+++  + GY +
Sbjct: 498 TTGIWGSIYGVFFNILV-FVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGY-M 555

Query: 549 IYK---TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQR 589
           +Y    T +     +DL   + IYD E    R +D+E +E+L+ 
Sbjct: 556 VYNRDFTLLNPLDKIDLDFHRRIYDPELM--RQEDEENKEKLRN 597

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  263 bits (672), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 166/530 (31%), Positives = 271/530 (51%), Gaps = 27/530 (5%)

Query: 74  KDENTR-LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFT 132
           +D+N   LKK +K RHI M                       P  ++I YA +G  ++  
Sbjct: 136 QDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCI 195

Query: 133 MACLGEMASYIP--LDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           +   GE+A      + GF +Y S  VDPALGF++ + Y  ++  + P +L  A++ I+YW
Sbjct: 196 IQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYW 255

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
             +  V+P V++ IF V+I+ IN+ G K + E +F+ +  K                   
Sbjct: 256 TVK--VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGA 313

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
                +G RYW +PGAF+       G+TG  +F   VA FV + F++   E   +  SE 
Sbjct: 314 GTDGYIGSRYWHNPGAFR-------GNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQ 366

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
            NPRK++P A K  +YRI+  +L ++ L+G  V Y   +LL   G +    ASP+V+A+ 
Sbjct: 367 SNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSA--TKASPYVIAVA 424

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
           + G++V+PH  NA +L+ V S  N   Y SSR L +LA  G APK F    + G P  A+
Sbjct: 425 SHGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAM 484

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
           ++S +F  +A+   S     +F + + +  +  + +WITI + +I F +A + QG    +
Sbjct: 485 LVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGE 544

Query: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSW 543
             Y +    +G+ +A+   +L ALI  F V +     G K   ++F   Y+ +P+ I  +
Sbjct: 545 VGYKSQVGIWGSMYAIVMMVL-ALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALY 603

Query: 544 AGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
             YK+  K  T  I +  +DL T ++I+D  EE  + +D+E +E+L RNG
Sbjct: 604 VFYKVWKKDWTLFIPADKIDLVTDRQIFD--EELLKQEDEEYQEKL-RNG 650

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  261 bits (668), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 160/519 (30%), Positives = 267/519 (51%), Gaps = 16/519 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            NT L KEL  RH+                         P +++I +  +   +F  +  
Sbjct: 82  NNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGE+++  P+  GF  Y+ R+V+P+  FA+   YL ++ +L P +L AA++ I+YW   D
Sbjct: 142 LGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--ND 199

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           ++N   W+ IF   I   N++ VK FGE EF LS  K                   P   
Sbjct: 200 KINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGGPHGG 259

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G +YW DPGAF  + +       KF    +VFV + FSY+GIE+T +  +E++NPR++
Sbjct: 260 YIGGKYWNDPGAFVGHDSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +PKA K T + I + Y+  + L+G  V  NDPRLL+    S+ AA+SP V+AI+N  IK 
Sbjct: 315 IPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLN-GSSSVDAASSPLVIAIENGRIKG 373

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP + NA +L+ V S  NS +Y  SR + A+A  G  PK   +  K G P NA++L++ F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFF 433

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             L+++  S   A++F +   +  +  I  W+ I + +I F +A + Q     +  +++ 
Sbjct: 434 GLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQ 493

Query: 495 GQRYGAY--FALSFCILIALIKNFTVFLGHK-FDYKTFITGYIGLPVYILSWAGYKLIYK 551
              +G+   F + F +LIA        +G    + ++F  GY+  P+ I+ + G+K+  +
Sbjct: 494 TGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYFGHKIYTR 553

Query: 552 T--KVIKSTDVDLYTFKEIYD--REEEEGRIKDQEREER 586
               ++K  D+DL T ++  D     +E +I+ +   +R
Sbjct: 554 DWRLLVKLEDMDLDTGRKQVDLNLRRQEMKIEQETLAKR 592

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  262 bits (670), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 160/529 (30%), Positives = 265/529 (50%), Gaps = 21/529 (3%)

Query: 71  ADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 130
           A+   ++  LKK ++ RH+ M                       P  +LI YA +G +++
Sbjct: 107 ANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILY 166

Query: 131 FTMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 188
             +   GEMA  Y  L  G+ +Y S  VD   GFA+ + Y  ++  + P +L  A++ I+
Sbjct: 167 CIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIK 226

Query: 189 YWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 248
           YW +   VNP V++ IF V+++ INI G + + E EF+ +  K                 
Sbjct: 227 YWTTS--VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVG 284

Query: 249 XXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
              +   +G +YW DPGAF         +  +F    A  V + F++ G E   I  +E 
Sbjct: 285 GAGNDGFIGGKYWHDPGAFNGKH-----AIDRFKGVAATLVTAAFAFGGSEFIAITTAEQ 339

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
            NPRK++P A K  +YRI+  +L T+ LLG  V YN  +LL + G    A  SP+V+A+ 
Sbjct: 340 SNPRKAIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKA--SPYVIAVA 397

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
           + G++V+PH  NA +L+ V S  NS  Y S+R    L+  G APK+F+   + G P  A+
Sbjct: 398 SHGVRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAM 457

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
            +S LF  +A+   S    ++F + + +  +  + +W  I + ++ F +A + QG    +
Sbjct: 458 GVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGE 517

Query: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWA 544
             + +    +G+ +A    ILI LI  F V +      K D + F   Y+ +P+ I  + 
Sbjct: 518 LGFKSQTGVWGSAYACIMMILI-LIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYV 576

Query: 545 GYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           GYK+ +K     I++  +DL + ++I+D  EE  + +D+E  ERL RNG
Sbjct: 577 GYKVWHKDWKLFIRADKIDLDSHRQIFD--EELIKQEDEEYRERL-RNG 622

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  261 bits (668), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 162/525 (30%), Positives = 263/525 (50%), Gaps = 21/525 (4%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           +++  LKK ++ RH+ M                       P  +LI Y  +G +++  + 
Sbjct: 111 NKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQ 170

Query: 135 CLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             GEMA  Y  L  G+ +Y S  VD   GFA+ + Y  ++  + P +L  A++ I+YW +
Sbjct: 171 ACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              VNP V++ IF V+++ INI G + + E EF+ +  K                    +
Sbjct: 231 S--VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGN 288

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G +YW DPGAF         S  +F   VA  V + F++ G E   I  +E  NPR
Sbjct: 289 DGFIGGKYWHDPGAFNGKH-----SIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPR 343

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           K+VP A K  +YRI+  +L T+ LLG  V YN  +LL + G    A  SP+V+A+ + G+
Sbjct: 344 KAVPGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKA--SPYVIAVASHGV 401

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           +V+PH  NA +L+ V S  NS  Y S+R L  L+  G AP++F    K G P  A+ +S 
Sbjct: 402 RVVPHFINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSA 461

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           LF  +A+   S    ++F + + +  +  + +W  I + +I F +A + QG    +  + 
Sbjct: 462 LFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFR 521

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYKL 548
           +    +G+ +A    ILI LI  F V +      K D + F   Y+ +P+ I  + GYK+
Sbjct: 522 SQTGVWGSTYACIMMILI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKI 580

Query: 549 IYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
             K     I++  +DL + ++I+D  EE  + +D+E  ERL +NG
Sbjct: 581 WKKDWKLFIRADKIDLISHRQIFD--EELIKQEDEEFRERL-KNG 622

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  260 bits (665), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 159/520 (30%), Positives = 271/520 (52%), Gaps = 16/520 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           + + L K+L  RH+                         P +++I +  V   +F  +  
Sbjct: 85  DGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINS 144

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGE+A+  P+  GF+ Y +R++DP++ F+I   YL ++ +L P +L AA++ I+YW   D
Sbjct: 145 LGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYW--ND 202

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           ++N   W++IF  VI  +N++ VK FGE EF LS  K                   P   
Sbjct: 203 KINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGG 262

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G +YW DPGAF  ++        +F    +VFV + FSY+GIE+  +  +E+ +PRK+
Sbjct: 263 YIGGKYWHDPGAFVGHTAG-----SQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKT 317

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +P A K T + I   Y+  + L+G  V Y+DPRLL+    S+  A+SP V+AI+N GIK 
Sbjct: 318 IPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGS-SSVDVASSPLVIAIENGGIKG 376

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP + NA +L+ V S  NS +Y  SR + ++AI G  PK   +  K G P NA ++++ F
Sbjct: 377 LPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFF 436

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             ++++  S   A++F +   +  +  I  W+ I I +I F +A   QG    +  Y++ 
Sbjct: 437 GLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQ 496

Query: 495 GQRYGAYFA--LSFCILIALIKNFTVFLG-HKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
              YG+++   + F +LIA        +G  + +  TF  GY+ LP+ +  + G+K  +K
Sbjct: 497 VGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFK 556

Query: 552 TKVIKS--TDVDLYTFKEIYDRE--EEEGRIKDQEREERL 587
              + +   ++DL + K   D E   EE ++++   +++L
Sbjct: 557 NWRLFTPYNEIDLDSGKRDIDLELLREEKKMEELALKKQL 596

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  260 bits (664), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 161/516 (31%), Positives = 264/516 (51%), Gaps = 24/516 (4%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           N  LK+ LK+RH+ M                       P  +LI +A  G +++  +  +
Sbjct: 73  NAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 137 GEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
           GE+A   P+  GFT+YASR+VD + GFA    Y+ ++ ++ P ++ AA++ + YW + D+
Sbjct: 133 GELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDK 192

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
              G ++ +F VVIVAIN  GVK +GE EF  S  K                   P    
Sbjct: 193 YRDG-FVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGY 251

Query: 256 LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 315
           +G R W +PGAF             F    +VFV + FS+ G EL G+  +E  NPRKS+
Sbjct: 252 IGGRLWHNPGAFAN----------GFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSL 301

Query: 316 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVL 375
           P A K   +RI +FY+  + ++G+ V Y   RL+     S+ AAASPFV++IQN+GIK L
Sbjct: 302 PSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQS--SVDAAASPFVISIQNAGIKGL 359

Query: 376 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFC 435
           P + N  +L+ V S  NS ++  SR++ ALA  G  PKIF    + G P   +I++ +F 
Sbjct: 360 PSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFG 419

Query: 436 CLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 495
            L+++  S    ++F++ + +  +  + +W  I++ +I   +A  AQ    ++ ++ AP 
Sbjct: 420 LLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPT 479

Query: 496 QRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKLIYKT 552
             +G+ +     ILI L+  F + L   G K     F   Y+  P+ I  + G+K+  K 
Sbjct: 480 GVWGSVYGFVLIILI-LMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKN 538

Query: 553 --KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
               I++ ++D+ T +    RE +   +K +  EE+
Sbjct: 539 WKLFIRAKNIDIDTGR----RETDIEALKQEIAEEK 570

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  260 bits (664), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 157/531 (29%), Positives = 265/531 (49%), Gaps = 30/531 (5%)

Query: 73  GKDEN----TRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 128
           G++E     T++KK +K+RH+ M                       P  ++I YA   ++
Sbjct: 59  GENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIM 118

Query: 129 VFFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALV 186
           ++  +   GE+   Y  + G +T+Y+S  VDPALGF++ + Y  ++  + P QL  AA+ 
Sbjct: 119 LYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMT 178

Query: 187 IQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXX 246
           ++YW      NP +++ +F VVI+ IN+ G K + E EF  +  K               
Sbjct: 179 VRYW---TNANPDIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAIN 235

Query: 247 XXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCS 306
                    +G +YW  PG+F             F     VF Y+ FSY GIE+  +  S
Sbjct: 236 CGGAGTSGYIGAKYWHSPGSF----------AAGFKGVCYVFCYAAFSYGGIEVMVLTAS 285

Query: 307 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVA 366
           E ENPRKS+P A K  +YRI++ Y+ T  ++   V YN   L+ + G+S S A SP V+A
Sbjct: 286 EQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHA-SPLVIA 344

Query: 367 IQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYN 426
           + + G+K++PHI NA +L+ V S  NS +Y + R L +L+  G APK      + G P  
Sbjct: 345 VASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLI 404

Query: 427 ALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK 486
              +++L   +A++  S     IF + + +  +  I  W +I + ++ F  A  AQG+  
Sbjct: 405 CFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSL 464

Query: 487 SKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIL 541
            +  Y +    +G++FA+   +L+ LI  F V +       + + +TF   Y+  P+ + 
Sbjct: 465 GQIGYKSQTGYWGSWFAIVISVLV-LIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLG 523

Query: 542 SWAGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRN 590
           ++ GYK+ +K     I +++VDL + + I D  EE  R +D E  E++  +
Sbjct: 524 AYFGYKVYHKDWRLCIPASEVDLSSHRNISD--EEILRQEDYEWNEKMSNS 572

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  260 bits (664), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 160/513 (31%), Positives = 266/513 (51%), Gaps = 17/513 (3%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
            T LK +LK RH+ M                       P ++LI +  +G +++  +  L
Sbjct: 82  QTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMAL 141

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
           GE+A   P+ G FT+YA+R++D + GFA  + Y+ ++ +  P ++ +A++ + YW +  +
Sbjct: 142 GELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPK 201

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
              G ++ +F +VIV IN+ GVK +GE EF  S  K                   P+   
Sbjct: 202 YRDG-FVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGY 260

Query: 256 LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 315
           +G +Y+ DPGAF   +        KF    +VFV + FS+ G EL G+  SE+ +PRKSV
Sbjct: 261 IGGKYFHDPGAFAGDTPG-----AKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSV 315

Query: 316 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVL 375
           PKA K   +RI +FY+ ++ ++G+ V YND RL+     S+ AAASPFV+AI   GIK L
Sbjct: 316 PKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGAS--SVDAAASPFVIAIVTHGIKGL 373

Query: 376 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFC 435
           P + N  +L+ V S  NS ++  SR   ALA  G  P+IFA   + G P   +I++    
Sbjct: 374 PSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVG 433

Query: 436 CLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 495
            +A++  S+    +FN+ + +  +  + +W  I I +I F KA  +QG    + ++ +P 
Sbjct: 434 LIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPT 493

Query: 496 QRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKLIYKT 552
             +G+Y+ L F I+I  I  F V L         + F   Y+  P+ +  + G+K IYK 
Sbjct: 494 GVWGSYWGL-FMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHK-IYKR 551

Query: 553 K---VIKSTDVDLYTFKEIYDREEEEGRIKDQE 582
               +I + ++D+ + +   D E  +  I +++
Sbjct: 552 NWKLLIPAGEMDIDSGRREVDLELLKQEIAEEK 584

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  260 bits (664), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 155/531 (29%), Positives = 269/531 (50%), Gaps = 22/531 (4%)

Query: 72  DGKDE----NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGL 127
           DG D     + +LKK +K+RH+ M                       P  ++I YA +G 
Sbjct: 84  DGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGS 143

Query: 128 LVFFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 185
            ++  +   GE+A  Y  L G F +Y S  +DPALGF++ + Y  ++  + P +L  A++
Sbjct: 144 CLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASI 203

Query: 186 VIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 245
            I+YW +   VNP +++ IF VVI+ IN+ G + + E EF+ ++FK              
Sbjct: 204 TIKYWTTS--VNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIV 261

Query: 246 XXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVC 305
                 +   +G +YW DPG+F             F   V+  V + F++   E   +  
Sbjct: 262 NCGGAGNDGYIGGKYWNDPGSFSGDKP-----IDHFKGVVSTLVTAAFAFGATEFIALTA 316

Query: 306 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVV 365
           +E  NPRKS+P A K  +YRI+V Y+ ++ L+G  V +N   L+ + G +  A  SP+V+
Sbjct: 317 AEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHA--SPYVI 374

Query: 366 AIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPY 425
           AI + G+KV+PH+ NA +L+ V S  NS  Y SSR L  LA  G AP       + G P 
Sbjct: 375 AIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPT 434

Query: 426 NALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 485
            A+++S +F  ++++  S     +F + + +  +  + +W  I + +I F +A + QG  
Sbjct: 435 LAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRS 494

Query: 486 KSKFAYVAPGQRYGAYFALSFCILIALIKNFTVF--LGH-KFDYKTFITGYIGLPVYILS 542
             +  + +    +G+Y+A    +LI + + +T    +G  K D + F   Y+ +P+ I  
Sbjct: 495 LGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIAL 554

Query: 543 WAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           + GYK+  +  T  I ++ +DL + + I+D  E+  + +D E  E+L+ +G
Sbjct: 555 YFGYKVWKRDWTLYIPASKIDLISNRRIFD--EDVLKQEDAEYREKLRNSG 603

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  261 bits (666), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 167/529 (31%), Positives = 269/529 (50%), Gaps = 24/529 (4%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           + K EN  LKK +K RH  M                       P  ++I YA +G  V+ 
Sbjct: 139 EQKQEN--LKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYC 196

Query: 132 TMACLGEMASYIP--LDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
            +   GE+A      + GF +Y    VDPALGF++ + +  ++  + P +L  A++ I+Y
Sbjct: 197 IIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKY 256

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W +   VNP V++ IF V+IV IN+ G K + E +F+ +  K                  
Sbjct: 257 WTTS--VNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGG 314

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
                 +G +YWRDPGAF+   T I     +F   VA FV + F++   E   +  SE  
Sbjct: 315 AGTDGYIGSKYWRDPGAFRG-DTPIQ----RFKGVVATFVTAAFAFGMSEQLAMTASEQS 369

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRK++P A K  +YRI+  +L ++ L+G  V Y   +LL   G +  A  SP+V+A+ +
Sbjct: 370 NPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKA--SPYVIAVSS 427

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
            G++V+PH  NA +L+ V S  N   Y SSR L +LA  G APK F    + G P  A++
Sbjct: 428 HGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAML 487

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           +S LF  +A+   S     +F + + +  +  + +WITI + +I F +A + QG    + 
Sbjct: 488 VSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEV 547

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWA 544
            Y +    +G+ +A+   +++ALI  F V +     G K   ++F   Y+ +P++I  + 
Sbjct: 548 GYKSQVGVWGSAYAV-LMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYI 606

Query: 545 GYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
            YK+  K  +  I +  VDL + + I+D  EE  + +D+E +ERL RNG
Sbjct: 607 FYKVWKKDWSLFIPADKVDLVSHRNIFD--EELLKQEDEEYKERL-RNG 652

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  259 bits (662), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 165/529 (31%), Positives = 273/529 (51%), Gaps = 24/529 (4%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           +T LK  LK+RH+ M                       P +++I ++  G +++  +  +
Sbjct: 86  HTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAV 145

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
            EMA   P+ G FT+YA+R++D + GFA  + Y+ ++ ++ P ++ +A++ + YW +  +
Sbjct: 146 AEMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTK 205

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
              G ++ +F +VIV IN+ GVK +GE EF  S+ K                   P    
Sbjct: 206 YRDG-FVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGY 264

Query: 256 LGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
           +G +YW DPGAF        G+T   +F  F +VFV + FS++G EL GI  SEAENPRK
Sbjct: 265 VGAKYWHDPGAF-------VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRK 317

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           +VP A K   +RI++FY+ ++  +G+ V  ND RL+ +   ++ AAASPFV+AI   GI+
Sbjct: 318 AVPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSS--NVDAAASPFVIAITVHGIR 375

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
            LP + N  +L+ V S  NS +Y  SR L ALA  G  PK+ +   + G P   + +S  
Sbjct: 376 GLPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSF 435

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  +A++  S     +FN+ + +  +    +W  I + +I F  A +AQ     +  +V+
Sbjct: 436 FGLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVS 495

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           P   +G+Y+ L F I++ L   F V +   G       F + Y+ LPV ++ +  +KL  
Sbjct: 496 PLGVFGSYWGL-FLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWT 554

Query: 551 KT-KV-IKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWF 597
           K  K+ I    +DL T ++  D +     ++ +  EER     +   WF
Sbjct: 555 KNWKIFIPLGQLDLDTGRKQLDLD----LLRQEVAEERATLAARP-RWF 598

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  259 bits (661), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 161/514 (31%), Positives = 269/514 (52%), Gaps = 19/514 (3%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           N+ LK+ LK RH+ M                       P  +LI +A  G +++  +  +
Sbjct: 74  NSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAM 133

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
           GE+A   P+ G FT+YA+R++D + G+A  + Y+ ++ ++ P ++ AA++ + YW +  +
Sbjct: 134 GELAVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPK 193

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
              G ++ +F VVIV+IN+ GVK +GE EF  S  K                   P    
Sbjct: 194 YRDG-FVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGY 252

Query: 256 LGFRYWRDPGAFKEYSTAITGSTGK-FTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
           +G   W +PGAF      +  + GK F    +VFV + FS+ G EL G+  +E  NPRKS
Sbjct: 253 IGGANWHNPGAF------VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKS 306

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +P+A K   +RI +FY+ ++ L+G+ V YND RL+     S+ AAASPFV+AI+N GIK 
Sbjct: 307 LPRAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGAS--SVDAAASPFVLAIKNHGIKG 364

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP + N  +L+ V S  NS ++  SR L ALA  G  PKIF    + G P   +  +  F
Sbjct: 365 LPSVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFF 424

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             L+++  S    ++F++ + +  +  + +W+ I I ++ F +A  AQG    + ++V+P
Sbjct: 425 GLLSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSP 484

Query: 495 GQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
              +G+ +     +LI L   F + L   G   D K F   Y+ LPV ++ + G+K  YK
Sbjct: 485 AGVWGSIYGTVLIMLI-LAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKC-YK 542

Query: 552 TK---VIKSTDVDLYTFKEIYDREEEEGRIKDQE 582
                 I++ ++D+ T +   D E  +  + +++
Sbjct: 543 RNWKLFIRAENIDIDTGRREVDIEALKVELAEEK 576

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  259 bits (661), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 163/534 (30%), Positives = 263/534 (49%), Gaps = 23/534 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
             + + ++L  RH+                         P +++I +  V   +F  +  
Sbjct: 82  HTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVINS 141

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGE+A+  P+  GF  Y +R+VDP+  F++   YL ++ +L P +L AA+L I+YW   D
Sbjct: 142 LGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYW--DD 199

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            +N   W+ IF  +I+  N++ VK FGE EF LS  K                   P   
Sbjct: 200 TINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGG 259

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G +YW DPGAF   S        +F    +VFV + FSY GIE+  +  +E++NPRK+
Sbjct: 260 YIGGKYWHDPGAFVGDSAGT-----QFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKT 314

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +P A K T + I   Y+  + L+G  VAYND RLL+    S+  AASP V+AI+N GIK 
Sbjct: 315 IPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGS-SSVDVAASPLVIAIENGGIKG 373

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP + NA +L+ + S  NS +Y  SR + ++A+ G  PK  +   K G P  A+  ++ F
Sbjct: 374 LPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFF 433

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             L+++  S    ++F +   +  +  I  W+ I I +I F +A   Q     +  Y++ 
Sbjct: 434 GLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQ 493

Query: 495 GQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
              YG+Y+  +   L+ LI +F   L    G   D + F  GY+  P+ I  + G+KL +
Sbjct: 494 TGIYGSYYGTAILFLV-LIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYF 552

Query: 551 KTKVIKS--TDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFL 602
           K   I +   ++DL T ++  D       I   + E +++R       F ++FL
Sbjct: 553 KNWRIMTPLEEIDLLTGRKEVD-------IDILKEELKIEREALRQSSFMKRFL 599

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  259 bits (663), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 160/525 (30%), Positives = 262/525 (49%), Gaps = 21/525 (4%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           +++  LKK ++ RH+ M                       P  +LI YA +G +++  + 
Sbjct: 111 NKSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQ 170

Query: 135 CLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             GE+A  Y  L  G+ +Y S  VD   GFA+ + Y  ++  + P +L  A++ I+YW +
Sbjct: 171 ACGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              VNP V++ IF V+++ INI G + + E EF+ +  K                    +
Sbjct: 231 S--VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGN 288

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G +YW DPGAF         S  +F   VA  V + F++ G E   I  +E  NPR
Sbjct: 289 DGFIGGKYWHDPGAFNGKH-----SIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPR 343

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           K++P A K  +YRI+  +L T+ +LG  V YN  +LL + G    A  SP+V+AI + G+
Sbjct: 344 KAIPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKA--SPYVIAIASHGV 401

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           +V+PH  NA +L+ V S  NS  Y S+R    L+  G APK F+   + G P  A+ +S 
Sbjct: 402 RVVPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSA 461

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           LF  +A+   S    ++F + + +  +  + +W  I   +I F +A + QG    +  + 
Sbjct: 462 LFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFK 521

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYKL 548
           +    +G+ +A    +LI LI  F V +      K D + F   Y+ +P+ I  + GYK+
Sbjct: 522 SQTGVWGSMYACIMMLLI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKI 580

Query: 549 IYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
             K     I++  +DL + ++I+D  EE  + +D+E  ERL RNG
Sbjct: 581 WTKDWKLFIRADKIDLESHRQIFD--EELIKQEDEEYRERL-RNG 622

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  258 bits (660), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 160/515 (31%), Positives = 262/515 (50%), Gaps = 14/515 (2%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           +D N  L K+L  RH+                         P +++I +  +   +F  +
Sbjct: 72  EDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVI 131

Query: 134 ACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             LGE+A+  P+  GF  Y +R+VDP+  FA+   YL ++ +L P +L AA++ I+YW S
Sbjct: 132 NSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNS 191

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              +N   W+ IF  VI   N++ VK FGE EF LS  K                   P 
Sbjct: 192 T--INSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPK 249

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              LG +YW +PGAF  +++       KF    +VFV + FSY+GIE+T +  +E+++PR
Sbjct: 250 GGYLGGKYWHNPGAFVGHTSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPR 304

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           K++PKA K T + I   Y+  + L+G  V Y+DPRL+S    S+ AAASP V+AI+N GI
Sbjct: 305 KTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGT-SSVDAAASPLVIAIENGGI 363

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           K L  + NA +L+ + S  NS +Y  SR + ++A  G  PK   K  K G P NA ++++
Sbjct: 364 KGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTL 423

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
            F  L+++  S    ++F +   +  +  I  W+ I I +I F +A   Q     +  Y+
Sbjct: 424 FFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYL 483

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKLI 549
           +    +G+ + +    L+ +   +T      G   D ++F  GY+ LP+ I+ + G+KL 
Sbjct: 484 SQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLY 543

Query: 550 YK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQE 582
           +K  + V+   ++DL T ++  D       +  +E
Sbjct: 544 FKNWSWVVTLEEMDLDTGRKALDPHLHRAEVIAEE 578

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  260 bits (664), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 160/527 (30%), Positives = 265/527 (50%), Gaps = 23/527 (4%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           +D N  L++ +K RH+ M                       P  ++I Y  +G  ++  +
Sbjct: 153 EDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCII 212

Query: 134 ACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
              GEMA +Y  L G F ++ S  VDP   FA+ + Y  ++  + P +L  A++ IQYW 
Sbjct: 213 QACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWT 272

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
           ++  V+P V++ IF V+I+ IN  G K + E EF  ++ K                    
Sbjct: 273 TK--VDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAG 330

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
               +G +YW DPGAF+  +        +F   +  FV + F++   E   +  +E  NP
Sbjct: 331 TDGYIGAKYWNDPGAFRGQT-----KIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNP 385

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RK++P A K  +YR++V +L T+ L+G  V Y+  +LL + G +  A  SP+V+AI   G
Sbjct: 386 RKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKA--SPYVLAISLHG 443

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           ++V  H  NA +L+ V S  NS  Y SSR L +LA  G APKIF    + G P  A+  S
Sbjct: 444 VRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCS 503

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            +   +A+   S    ++F + + +  +  + +W  I + ++ F +A + QG    +  Y
Sbjct: 504 AVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGY 563

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYK 547
           ++     G+ +A +  +++ALI  F V L     H  D  +F + Y+ +P+ I+ + GYK
Sbjct: 564 LSQTGILGSLYA-AIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYK 622

Query: 548 LIYKTK---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
            I+K      I++ D+DL + + IYD  EE  R +D+E  E+L RNG
Sbjct: 623 -IWKRDWRLFIRAKDIDLISHRTIYD--EELLRQEDEEYREKL-RNG 665

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  258 bits (658), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 166/527 (31%), Positives = 263/527 (49%), Gaps = 23/527 (4%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
            D+N  LKK +K+RH+ M                       P +++I Y  V  + +F +
Sbjct: 73  SDDN--LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVI 130

Query: 134 ACLGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
              GEMA   P    GF +YAS +V    GFA  + +  ++  + P +L  A++ I+YW 
Sbjct: 131 QAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW- 189

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
             D++N  V++ I  V ++ I+  GV+ +GE EF  +S K                    
Sbjct: 190 -NDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAG 248

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
               +G +YWRDPGAF   + A      +F     V V + FSY G+EL  +  +E ENP
Sbjct: 249 VDGYIGGKYWRDPGAFASDNAA-----SRFKGVAFVLVTAYFSYGGVELFALSVNEQENP 303

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           R+S P A K ++YRI++ YL T+ L+G  V +N  +L+   G +  A  SP+V+A+   G
Sbjct: 304 RRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHA--SPYVLAVSIHG 361

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           +KV+PHI NA +L+ V S  NS LY S R L +LA  G APK F    + G P  ALIL 
Sbjct: 362 VKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILC 421

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            +F  +A+   S     IF +   +  +  + +W +IL+ ++ F  A +AQG   ++  Y
Sbjct: 422 SIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGY 481

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFL---GHK--FDYKTFITGYIGLPVYILSWAGY 546
           ++    +G+ +   F +L+  I  F V L   G K  +  + F   Y+  PV++  + GY
Sbjct: 482 ISITGIWGSLYGCFFNVLV-FIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540

Query: 547 KLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
            L  +  T +     +DL   + +YD E    R +D+E +ER++  G
Sbjct: 541 MLYSRDFTFLTDLKKIDLDNHRRLYDPELL--RQEDEETKERIRNGG 585

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  258 bits (659), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 158/531 (29%), Positives = 265/531 (49%), Gaps = 28/531 (5%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           N +LKK ++ RH+ M                       P  ++I YA +   ++  M  +
Sbjct: 96  NEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAV 155

Query: 137 GEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           GEMA +Y+ L  GF++Y    +DP L FA+ + Y  ++F + P +L  A++ IQYW ++ 
Sbjct: 156 GEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTK- 214

Query: 195 RVNPGVWITIFLVVIVAINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
            VN  +++ IF ++++ INI G  + + E EF+ +  K                    + 
Sbjct: 215 -VNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNS 273

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
             +G RYW  PGAF+       G  G  +F   V+  V + F++ G E   I  SE  NP
Sbjct: 274 GFIGARYWHSPGAFR-------GDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQANP 326

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RK++P A K  +YR ++ Y+ ++ ++G  V YN   LL + G +  A  SP+V+A+ + G
Sbjct: 327 RKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKA--SPYVIAVASHG 384

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           I+V+PH  NA +L+ VFS  +S  Y SSR L  LA  G APKIF    K G P    ++ 
Sbjct: 385 IRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVG 444

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            +   +++   SS  A +FN+ +++  +  + +W  I + +I F +A + QG    +  +
Sbjct: 445 AIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGF 504

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYK 547
            +    +G+ +A    IL+ LI  F V +        D  +F   Y+ +PV+I+ + GYK
Sbjct: 505 KSQAGVWGSVYAFVMMILV-LIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYK 563

Query: 548 LIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEW 596
           +  +     I++ ++DL   + IYD E     +  QER+E  +R      W
Sbjct: 564 IWNRDWRLFIRAKNIDLIAHRHIYDPE-----LLRQERKEMRERARNAPLW 609

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  258 bits (658), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 159/515 (30%), Positives = 265/515 (51%), Gaps = 19/515 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
             + L+++LK RH+ M                       P  +LI +  +  ++      
Sbjct: 80  SQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLS 139

Query: 136 LGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA   P+ G +T+YA+R++D + GFA    Y+ +  ++ P ++ AA++ + YW  + 
Sbjct: 140 LGEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKS 199

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
           +     ++ +F + IV+IN+ GVK +GE EF  S  K                   P H+
Sbjct: 200 QYR-AAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHE 258

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
            +G ++W +PGAF        G T   KF    +VFV + FS+   EL G+  +E E+PR
Sbjct: 259 YIGSKFWSNPGAF-------VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPR 311

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           KSVPKA K   +RI +FY+ ++ ++G+ V Y DPRLL +    + AAASPFV+A++N GI
Sbjct: 312 KSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSS--IVDAAASPFVLALKNHGI 369

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           K LP + N  +L  V S  NS ++  SR L AL+  G  P +F    + G P  ++I S 
Sbjct: 370 KGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSS 429

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
            F  L ++ VS    +IF++ +++  +  +  W+TI + +I F KA  AQ     + A+ 
Sbjct: 430 AFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFA 489

Query: 493 APGQRYGAYFALSFCILIALIKNF--TVFLGH-KFDYKTFITGYIGLPVYILSWAGYKLI 549
           +P   +G+Y+++ F I++ LI  F   +F GH K     F   Y+ +P+ +  + G+K+ 
Sbjct: 490 SPIGIWGSYYSV-FLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIY 548

Query: 550 YKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQE 582
            K    +I    +D+ T +   D E  +  + +Q 
Sbjct: 549 TKNWKLLIDPKYMDIDTGRRELDIELFKQELLEQN 583

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  258 bits (659), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 161/519 (31%), Positives = 265/519 (51%), Gaps = 19/519 (3%)

Query: 68  FAIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGL 127
           F+IA  +D N  L K+L  RH+                         P +++I +  +  
Sbjct: 81  FSIAK-EDINENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIIST 139

Query: 128 LVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALV 186
            +F  +  LGE+A+  P+  GF  Y +R+VDP++ FAI   YL ++ +L P +L AA++ 
Sbjct: 140 CLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASIT 199

Query: 187 IQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXX 246
           I+YW   D +N   W+ IF  VI   N++ VK FGE EF LS  K               
Sbjct: 200 IKYW--NDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLA 257

Query: 247 XXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTG-KFTSFVAVFVYSLFSYTGIELTGIVC 305
               P    LG  YW DPG+F      +    G +F    +VFV + FSY+GIELT +  
Sbjct: 258 CGGGPQGGFLGGHYWHDPGSF------VGDKPGTQFKGLCSVFVTAAFSYSGIELTAVSA 311

Query: 306 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVV 365
           +E+++PRK++PKA K T + +   Y+  + ++G  V ++DPRLL+    S+ AAASP V+
Sbjct: 312 AESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLN-GSSSVDAAASPLVI 370

Query: 366 AIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPY 425
           +I+N+GIK L  + NA +L+ + S  NS +Y  SR + ++A  G  PK+ ++  K G P 
Sbjct: 371 SIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPV 430

Query: 426 NALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 485
           NA++ ++ F  L+++  S   A++F +   +  +  I  W+ I   +I F  A + Q   
Sbjct: 431 NAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKT 490

Query: 486 KSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIL 541
             +  Y++     G+++ +   + + L+ +F   L        D  +F  GY+ LP+ I 
Sbjct: 491 LDELPYLSQCGVIGSWYGV-IVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIA 549

Query: 542 SWAGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRI 578
            + G+KL  +    ++K  D+DL T ++  D  E    I
Sbjct: 550 CYVGHKLYVRNLQVLVKLEDMDLETGRKHIDAHEHRAEI 588

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  257 bits (656), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 161/525 (30%), Positives = 267/525 (50%), Gaps = 23/525 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           + + LKK +K+RH+ M                       P +++I Y  V  + +F +  
Sbjct: 71  DASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQA 130

Query: 136 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEMA +Y  L G F SY S ++    GFA  + +  ++  + P +L  A+L I+YW   
Sbjct: 131 AGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYW--N 188

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D++N  V+I IF V ++ I+  GVK +GE EF  +S K                      
Sbjct: 189 DKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKD 248

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G +YWRDPG+F E       S  KF     + V + FSY G EL  +  +E ENPRK
Sbjct: 249 GYIGAKYWRDPGSFAE-----GDSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRK 303

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           S P+A K ++YRI++ YL T+ L+G  V +N+ +L+ + G +  A  SP+V+A    G+K
Sbjct: 304 STPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHA--SPYVLAASIHGVK 361

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           V+PH  NA +L+ V S  NS LY S R + +LA  G APK      + G P  ALIL  +
Sbjct: 362 VVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAV 421

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  + +++ SS   ++F +   +  +  + +W  I++ ++ F +  +  G  + +  + A
Sbjct: 422 FGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRA 481

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGYKL 548
               +G+ + +SF +L+  I  F V L       K D ++F   Y+  P+++  + GY +
Sbjct: 482 VTGIWGSMYGISFNMLV-FIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGY-M 539

Query: 549 IYK---TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRN 590
           +YK   T ++    +DL   + IYD E    R +D+E +E+++ +
Sbjct: 540 LYKRDFTFLVPLDKIDLNFHRRIYDPELI--RQEDEENKEKIKNS 582

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  256 bits (654), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 167/530 (31%), Positives = 272/530 (51%), Gaps = 29/530 (5%)

Query: 69  AIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 128
           AI + KD  ++L K+L  RH+                         P +++IA+  +   
Sbjct: 55  AIYNTKD--SKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTC 112

Query: 129 VFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 187
           +F  +  LGE+++  P+  GF  Y +R+V+P+ GFA+ + YL ++ IL P +L AA++ I
Sbjct: 113 LFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITI 172

Query: 188 QYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 247
           +YW     +NP  W++IF V I   N++ VK FGE EF LS  K                
Sbjct: 173 RYW--NKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLIC 230

Query: 248 XXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSE 307
              P    +G +YW DPGAF   + A      +F    AVF+ + FSY+G+EL G+  +E
Sbjct: 231 GGGPSGGFIGGKYWNDPGAFVGDTPA-----QRFKGLSAVFITAAFSYSGLELVGVSAAE 285

Query: 308 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 367
           + NPR ++PKA K T + I + YL  + L+G  V  NDP LL+    S+ AAASP V+AI
Sbjct: 286 SRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGT-SSVDAAASPLVIAI 344

Query: 368 QNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNA 427
           QN GIK LP + NA +L+ + S  NS +Y  SR + ++A  G  P+  A   K G P  A
Sbjct: 345 QNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYA 404

Query: 428 LILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 487
           + +++L   L+++  S+   ++F +   +  +  +  W  I + ++ F  A + Q     
Sbjct: 405 IAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLE 464

Query: 488 KFAYVAPGQRYGAYFALSFCILIA--LIKNFTVFL----GHKFDYKTFITGYIGLPVYIL 541
           +  YV+    +G+++    CI+I   LI +F   L    G+  D  +F   Y+ LP++I 
Sbjct: 465 ELPYVSMTGEWGSWYG---CIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIA 521

Query: 542 SWAGYKLIYKTKV---IKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ 588
            + G+K I+K  +   IK ++VD+ +      R + +     QE+E   +
Sbjct: 522 CYLGHK-IWKRNLRLYIKLSEVDVDS-----GRTDTDAATLKQEKEAEAE 565

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  256 bits (653), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 156/501 (31%), Positives = 256/501 (51%), Gaps = 18/501 (3%)

Query: 79  RLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGE 138
            L K+L  RH+                         P +++I +  +   +F  +  LGE
Sbjct: 77  NLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGE 136

Query: 139 MASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVN 197
           +A+  P+  GF  Y +R+VDP+  FA+   YL  + +  P +L AA++ I+YW     +N
Sbjct: 137 LAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYW--NREIN 194

Query: 198 PGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 257
              W+TIF V I  +N++ VKFF E EF +S  K                   P    +G
Sbjct: 195 SDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIG 254

Query: 258 FRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPK 317
            +YW DPGAF   S        +F    +VFV + FSY+G+E+T +  +E++NPRK++PK
Sbjct: 255 GKYWNDPGAFHGDSAG-----SRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPK 309

Query: 318 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPH 377
           A K T + I   Y+  + L+G+ V YND RLLS    S+ A+ASP V+AI+N+GIK LP 
Sbjct: 310 ATKRTFWVITFSYISILTLIGILVPYNDKRLLSGS-SSVDASASPLVIAIENAGIKGLPS 368

Query: 378 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCL 437
           + NA +L+ + S  NS +YV SR + ++A+    PK+F+K  K G P  ++  ++    L
Sbjct: 369 LMNAIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLL 428

Query: 438 AYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQR 497
           +++  S    ++F +   +  +  I  WI I + +I F  A + Q     + AY++    
Sbjct: 429 SFIAASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGI 488

Query: 498 YGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYKLIYKT- 552
           +G+++ +   +L+ LI +F V L        D + F  GY+  P+ I S+ G+K+  K  
Sbjct: 489 WGSWYGVIILVLV-LIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNW 547

Query: 553 ---KVIKSTDVDLYTFKEIYD 570
                ++  D+DL     I++
Sbjct: 548 KWVIPLEEIDIDLGKKNTIWN 568

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  257 bits (656), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 163/537 (30%), Positives = 279/537 (51%), Gaps = 27/537 (5%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           D + ++ K+L  RH+                         P +++I +  +   +F  + 
Sbjct: 91  DGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVN 150

Query: 135 CLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            LGE+A+  P+  GF  Y +R++DP+ GFA+   YL ++ +L P +L AA++ I+YW   
Sbjct: 151 SLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRYW--N 208

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D++N   W+ IF   I   N++ VK FGE EF LS  K                   P  
Sbjct: 209 DKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGPKG 268

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G +YW DPGAF   ++       KF    +VFV + FSY+G+ELT +  +E+ NPR+
Sbjct: 269 GYIGGKYWHDPGAFVGETSGT-----KFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRE 323

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           ++PKA K T + I + Y+  + L+G  V YN+P+LL+    S+ AA+SP V+AI+N GI+
Sbjct: 324 TIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGS-SSVDAASSPLVIAIENGGIR 382

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
            LP + NA +L+ + S  NS +Y  SR + ++A     P+   +  + G P NA +L++ 
Sbjct: 383 GLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLF 442

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  L+++  S    ++F +   +  +  I +W+ I + +I F +A   QGI   +  Y++
Sbjct: 443 FGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYIS 502

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYKLI 549
                G+++ +   + + L+ +F   L    G   D  +F  GY+  P+ I+ + G+KL 
Sbjct: 503 MTGVSGSWYGV-IVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLY 561

Query: 550 YKTK--VIKSTDVDLYTFKEIYDRE--EEEGRIKDQEREERLQRNGKNMEWFYEKFL 602
            + K  +I   D+DL + +++ D E   EE RI   E+E+  +R+      F+ +FL
Sbjct: 562 IRKKRLLIDVADMDLVSDRKVVDVEVCREEMRI---EKEQLAKRS------FFARFL 609

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  256 bits (655), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 171/521 (32%), Positives = 270/521 (51%), Gaps = 23/521 (4%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           K   + L+ +LK+RH+ M                       P  +LI ++  G ++F  +
Sbjct: 82  KTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMV 141

Query: 134 ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             LGE+A   P+ G FT+YA+R++D + GFA  + Y+ ++ ++ P ++ AA++ + YW +
Sbjct: 142 MALGELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWET 201

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
             R   G ++ +F +V+V IN+ GV+ +GE EF  S  K                   P 
Sbjct: 202 PVRYTDG-FVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPV 260

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
              +G RYW +PGAF        GST   KF  F +VFV + FS+ G EL G+  SEA+N
Sbjct: 261 GGYVGARYWHNPGAF-------VGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKN 313

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRK+VP A K   +RI++FY+  + L+G  V YNDPRL+S+   S+ A+ASPFV+AI   
Sbjct: 314 PRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSS--SVDASASPFVIAIVTH 371

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           GI  LP + N  +L+ V S  NS +Y  SR L AL+  G  PKI +   + G P   + +
Sbjct: 372 GISGLPSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAI 431

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           S  F  +A++  S+   ++FN+ + +  +    +W  I I +I F  A +AQG    +  
Sbjct: 432 SSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELP 491

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYK 547
           +V+P    G+Y+ L   IL+ LI  F + L   G       F + Y+  PV +  +  +K
Sbjct: 492 FVSPAGVIGSYWGLFLNILM-LIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHK 550

Query: 548 LIYKTK--VIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
           L  K    +I   DVD+ T +    R+ +   +K +  EE+
Sbjct: 551 LWKKNWKFLIPLEDVDIDTGR----RDTDVNLLKQEIAEEK 587

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  258 bits (658), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 159/529 (30%), Positives = 268/529 (50%), Gaps = 25/529 (4%)

Query: 73  GKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFT 132
            ++++  L+K +K RH+ +                       P  ++I YA +G  ++  
Sbjct: 124 AEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCI 183

Query: 133 MACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           +   GEMA +Y  L G F +Y S  VD A GF++ + Y  ++  + P +L  A++ IQYW
Sbjct: 184 IQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYW 243

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
            +   VN  V++ IF V+I+ IN+ G K + E EF+ +S K                   
Sbjct: 244 TTT--VNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGA 301

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
            +   +G +YW +PGAF+        S  +F   ++ F  + F++   E   I  SE  N
Sbjct: 302 GNDGYIGAKYWHNPGAFRG-----DKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSN 356

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PR+++P A K  +YRI+  +L ++ L+G  V YN   L+ +   S +  ASP+V+A+ + 
Sbjct: 357 PRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSG--SAATKASPYVIAVASH 414

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G++V+PH  NA +L+ V S  NS  Y S R LY+L+  G AP  F    + G P  A+I+
Sbjct: 415 GVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIM 474

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           S LF  +A+   SS    +F + + +  +  + +WI I + +I F +A + QG    +  
Sbjct: 475 SALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIG 534

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGY 546
           + +    +G+ +A +  + +ALI  F V +        D + F   Y+ +P+ I+ + GY
Sbjct: 535 FKSQVGVWGSSYA-AIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGY 593

Query: 547 KLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQERE--ERLQRNG 591
           K+  +     I++ D+DL + ++IYD E     IK +E E  ERL RNG
Sbjct: 594 KICKRDWKLFIRAKDIDLVSHRKIYDGE----LIKQEEEEFKERL-RNG 637

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  256 bits (653), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 152/504 (30%), Positives = 257/504 (50%), Gaps = 16/504 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            N  L K L  RH+                         P +++I +  +   +F  +  
Sbjct: 71  NNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINA 130

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGEMA+  P+  GF  Y +R++DP++GFA+   YL ++ +L P +L AA++ I+YW   +
Sbjct: 131 LGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NE 188

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            +N   W+ IF  VI   N++ VK FGE EF LS  K                   P   
Sbjct: 189 TINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGG 248

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G +YW  PG+F  +++       KF    +VFV + FSY+GIE+T +  +E+++PR +
Sbjct: 249 FIGGKYWNHPGSFVGHNSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTT 303

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +PKA K T + I   Y+  + L+G  V Y+DPRLLS    S+ AA+SP V+AI+N GIK 
Sbjct: 304 IPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGT-SSVDAASSPLVIAIENDGIKG 362

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP + NA +L+ + S  NS +Y  SR + A+A  G  P+I  +    G P NA+I ++ F
Sbjct: 363 LPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFF 422

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             L+++  S   A +F +   +  +  I  W+ I + +I F ++   Q     +  +++ 
Sbjct: 423 GLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQ 482

Query: 495 GQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
              +G+++  +  + + L+ +F   L    G   D ++F  GY+  P+ +  + G+KL  
Sbjct: 483 TGVWGSWYG-TIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYV 541

Query: 551 KTK--VIKSTDVDLYTFKEIYDRE 572
           + +  ++   D+DL T +   D +
Sbjct: 542 RKREFMVGLADMDLDTGRRQVDLD 565

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  257 bits (656), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 156/521 (29%), Positives = 260/521 (49%), Gaps = 20/521 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           ++  LKK ++ RH+ M                       P  +LI YA +G +++  +  
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 136 LGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEMA  Y  L  G+ +Y S  VD   GFA+ + Y  ++  + P +L  A++ I+YW + 
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
             VNP V++ IF V+++ INI G + + E EF+ +  K                    + 
Sbjct: 232 --VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGND 289

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G +YW +PGAF         +  +F   VA  V + F++ G E   I  +E  NPRK
Sbjct: 290 GYIGGKYWHEPGAFNGVH-----AIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRK 344

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           ++P A K  +YRI+  +L T+ ++G  V YN  +LL + G    A  SP+V+AI + G++
Sbjct: 345 AIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKA--SPYVIAIASHGVR 402

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           V PH  NA +L+ V S  NS  Y S+R    L+  G APKIF+   + G P  A+ +S L
Sbjct: 403 VAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSAL 462

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  +A+   S    ++F + + +  +  + +W  I + +I F +A + QG    +  + +
Sbjct: 463 FAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKS 522

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYKLI 549
               +G+ ++    ILI LI  F V +      K D + F   Y+ +P+ I+ + GYK+ 
Sbjct: 523 QTGVWGSIYSCIMMILI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMW 581

Query: 550 YK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ 588
            K     I++  +DL + ++I+D  EE  + +D E  ERL+
Sbjct: 582 NKDWKLFIRADKIDLTSHRQIFD--EELIKQEDDEYRERLR 620

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  256 bits (655), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 158/526 (30%), Positives = 263/526 (50%), Gaps = 23/526 (4%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           ++N  LK+ ++ RH+ M                       P  ++I Y+ +G +++  + 
Sbjct: 125 NDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQ 184

Query: 135 CLGEMA---SYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
             GEMA   S +P  G+  Y S  V+   GFAI + Y  ++  + P +L  A+L I+YW 
Sbjct: 185 ATGEMAIAYSNLP-GGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWT 243

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
           +   VN  +++ IF  +I+ IN+ G K + E EF+ +  K                    
Sbjct: 244 TS--VNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAG 301

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
           +   LG  YW  PGAF+  S     S   F       V + F+Y G E   +  +E  NP
Sbjct: 302 NDGYLGGLYWHTPGAFRGDS-----SIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNP 356

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           R ++P A K  +YRII  YL ++ ++G  V ++  RLL + G + SA  SP+V+A    G
Sbjct: 357 RAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSA--SPYVLAASLHG 414

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           ++V+PH  NA +L+ V S  NS  Y SSR L +LA  G APK F    + G P  A+++S
Sbjct: 415 VRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMS 474

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            LF  +A+   S    ++F + + +  +  + +W  I + +I F  A + QG    +  Y
Sbjct: 475 ALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGY 534

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYK 547
           +A    +G+++AL F + +  I  F V +      +   + F   Y+ +P+ I+ + GYK
Sbjct: 535 LAQTGVWGSWYAL-FMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYK 593

Query: 548 LIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           + YK  T +IK+ D+DL + ++I+D  E+  + +D E  +RL +NG
Sbjct: 594 IYYKDWTLLIKAEDIDLQSHRQIFD--EDLLKEEDFEYRQRL-KNG 636

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  255 bits (652), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 167/534 (31%), Positives = 267/534 (50%), Gaps = 23/534 (4%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           + +T LKK +K RH+ M                       P A++I Y  V ++ +  + 
Sbjct: 86  NTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQ 145

Query: 135 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             GEMA +Y  L G F +YAS +V    GFA  + +  ++  + P +L  A+L+I+YW  
Sbjct: 146 AAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYW-- 203

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
            ++VN  V++ IF V ++ I+ +GVK +GE EF  +  K                     
Sbjct: 204 TEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGH 263

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G +YW  PGAF     A T +  +F     V V   FSY G EL  +  +E ENPR
Sbjct: 264 DGYIGGKYWHSPGAF-----AGTNAAERFKGVCYVLVSGYFSYGGTELYVLSVNEQENPR 318

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           KS P A K ++YRI+V YL T+ L+G  V +ND +L+   G +  A  SP+V+A    G+
Sbjct: 319 KSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHA--SPYVLAASIHGV 376

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           +V+PHI NA +L+ V S  NS LY + R L +LA  G APK      + G P  AL+   
Sbjct: 377 RVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACA 436

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           +F  +A+   S    ++F +   +  +  + +W +I++ ++ F +A + QG D ++  Y+
Sbjct: 437 VFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYI 496

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLG---HKFDYKTFITGYIGLPVYILSWAGYKLI 549
           A    +G+ + + F IL+  I  F V L         ++F   Y+  P++I  + GY + 
Sbjct: 497 ANTGYWGSVYGVVFNILV-FIAQFWVALAPPKSPITAQSFFESYLAFPIWIAFYFGYMIW 555

Query: 550 YK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGK---NMEWFY 598
            K  T +     +DL   + IYD E    + +D E +ER+ RNG     ++WF+
Sbjct: 556 NKDYTFLNPLDKIDLDHHRRIYDPEVL--KQEDMENKERV-RNGNIWTKLKWFW 606

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  256 bits (653), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 153/510 (30%), Positives = 252/510 (49%), Gaps = 19/510 (3%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           D  D   +LKK ++ RH+ +                       P  ++I Y  +G L++ 
Sbjct: 108 DEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYC 167

Query: 132 TMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
            +   GEMA +Y+ L  GF +Y +  +DP   FA  + Y  ++  + P +L  A++ I+Y
Sbjct: 168 IIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKY 227

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 248
           W ++  V+P V++ IF V I+ INI+G  + + E EF  +S K                 
Sbjct: 228 WTTK--VDPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICG 285

Query: 249 XXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
                  +G RYW DPGAF+        +  +F   VA  V + FS+   E   +  SE 
Sbjct: 286 GAGTDGYIGGRYWHDPGAFRGER-----AVDRFKGVVATLVTAAFSFGQSEFIAVTASEQ 340

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
            NPR+++P A K  +YR +  YL ++ LLG  V YN  +LL  +   + A  SP+V+A+ 
Sbjct: 341 SNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKA--SPYVLAVA 398

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
           N G++V+PH  NA +++ V S  NS  Y S R L  L+  G APKIF+   + G P   +
Sbjct: 399 NHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGI 458

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
           I++ LF  +A+   S    ++F + + V  +  I +W++I + ++ F +A   QG    +
Sbjct: 459 IVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGE 518

Query: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWA 544
             +++    YG+ ++  F + + L+  F V L      K D  +F   Y+  P++I  + 
Sbjct: 519 CGFLSQVGIYGSAYSF-FVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYI 577

Query: 545 GYKLIYKT--KVIKSTDVDLYTFKEIYDRE 572
           GYK   K     IKS D+DL   ++IYD +
Sbjct: 578 GYKCYTKDWRLYIKSQDIDLVAHRQIYDED 607

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  256 bits (655), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 165/530 (31%), Positives = 269/530 (50%), Gaps = 26/530 (4%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           + K EN  LKK +K RH  M                       P  ++I YA +G  V+ 
Sbjct: 139 EQKQEN--LKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYC 196

Query: 132 TMACLGEMASYIP--LDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
            +   GE+A      + GF +Y    VDPALGF++ + +  ++  + P +L  A++ I+Y
Sbjct: 197 IIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKY 256

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W  +  V+P V++ IF V+I+ IN+ G K + E +F+ +  K                  
Sbjct: 257 WTVK--VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGG 314

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
                 +G +YWRDPGAF+   T I     +F   VA FV + F++   E   +  SE  
Sbjct: 315 AGTDGYIGSKYWRDPGAFRG-DTPIQ----RFKGIVATFVTAAFAFGMSEQLAMTASEQS 369

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRK++P A K  +YRI+  +L ++ L+G  V Y   +LL   G +    ASP+V+A+ +
Sbjct: 370 NPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSA--TKASPYVIAVSS 427

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
            G++V+PH  NA +L+ V S  NS  Y SSR L +LA  G APK F    + G P  A++
Sbjct: 428 HGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAML 487

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           +S LF  +A+   S     +F + + +  +  + +WITI + +I F +A + QG    + 
Sbjct: 488 VSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEV 547

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWA 544
            Y +    +G+ +A+   +++ALI  F V +     G K   ++F   Y+ +P+ I  + 
Sbjct: 548 GYKSQVGVWGSAYAV-LMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYI 606

Query: 545 GYKLIYKTK---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
            +K ++K      I +  VDL + + I+D  EE  + +D+E +ERL RNG
Sbjct: 607 FFK-VWKNDWSLFIPANKVDLVSHRNIFD--EELLKQEDEEYKERL-RNG 652

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  254 bits (650), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 168/533 (31%), Positives = 265/533 (49%), Gaps = 24/533 (4%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           +T+LKK +K+RH+ M                       P  ++IAY  V  + +F +   
Sbjct: 72  DTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAA 131

Query: 137 GEMASYIP-LDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           GEMA   P L G F +Y S ++    GFA  + +  ++  + P +L  AA+ +QYW   D
Sbjct: 132 GEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYW--ND 189

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            +N  V++ IF V ++ I+  GVK +GE EF  +  K                    +  
Sbjct: 190 SINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSG 249

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G +YW DPGAF   + A     G+F     V V + FSY G+EL  +  +E ENPR+S
Sbjct: 250 YIGAKYWHDPGAFTSDTNA-----GRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRS 304

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
            P A K ++YRI+V YL T+ L+G  V  N   L+ + G    A  SP+V+A    G+KV
Sbjct: 305 TPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHA--SPYVLAASIHGVKV 362

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           +PHI NA +L+ + S  NS LY + R + ALA  G APK      + G P  ALI+  +F
Sbjct: 363 VPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVF 422

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             + ++  SS   ++FN+   +  +  + +W  I+I +I F +A + Q     +  Y +P
Sbjct: 423 GVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSP 482

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYKLIY 550
              YG+YF + F +L+  +  F V L      +    TF   Y+  P++   + GY +I+
Sbjct: 483 FGVYGSYFGVFFNLLV-FVAQFWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGY-MIW 540

Query: 551 KTKVIKSTD---VDLYTFKEIYDREEEEGRIKDQEREERLQRNG--KNMEWFY 598
           K      +D   VDL   + IYD E    + +D+E++E L+ +   K M +F+
Sbjct: 541 KRDFTLFSDLESVDLDYHRRIYDPELV--KQEDEEKKEMLKNSPMWKRMYYFW 591

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  255 bits (651), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 162/521 (31%), Positives = 259/521 (49%), Gaps = 23/521 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            +++LKK +K+RH+ M                       P A++I Y  V  + +F +  
Sbjct: 87  SDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQA 146

Query: 136 LGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEMA   P     F +Y+S ++    GFA  + Y F++  + P +L  AA+ I++W   
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFW--N 204

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D +NP ++I IF V ++ I+  GVK +GE EF  +  K                    + 
Sbjct: 205 DTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGND 264

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G +YWR+PGAF   ++A     G+F +   + V + FS+ G+EL  +   E  NPRK
Sbjct: 265 GYIGGKYWRNPGAFAGDTSA-----GRFKNVCYILVTAYFSFGGMELFALSVQEQANPRK 319

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           + P A K ++YRI+V YL T+ L+G  V YND +L+   G +  A  SP+V+A    G+K
Sbjct: 320 TTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHA--SPYVLAASIHGVK 377

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           V+PHI NA +L+ V S  NS LY   R + +LA  G  PK      + G P  ALI+  +
Sbjct: 378 VVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSV 437

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  + ++  SS    +F +   +  +  + +W +I++ ++ F +A + QG    +  Y A
Sbjct: 438 FGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAGYKL 548
               +G+ + + F IL+  I  F V L     G K   ++F   Y+  P++I  + GY +
Sbjct: 498 TTGIWGSAYGVFFNILV-FIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGY-M 555

Query: 549 IYK---TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
           IY    T +     +DL   + IYD E    R +D E EER
Sbjct: 556 IYNRDFTFLNPLDKIDLDFHRHIYDPELM--RQEDLENEER 594

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  255 bits (651), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 158/569 (27%), Positives = 276/569 (48%), Gaps = 37/569 (6%)

Query: 31  ADNFPVKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAIADGKDENTRLKKELKARHIS 90
           ++N     +E+ +++++EN V                        +N  LK+ +K RH+ 
Sbjct: 74  SENLDKDGKEVADLEVQENQVLT-----------------EKSNQKNKELKQTIKPRHVI 116

Query: 91  MXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEMA-SYIPLDG-F 148
           +                       P  +LI Y+ +G  ++  +   GE+A SY  L G F
Sbjct: 117 LISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGF 176

Query: 149 TSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVV 208
             Y S  VDPA GF++ + Y  ++  + P +L  A++ I+YW +   VN  +++ IF V+
Sbjct: 177 NVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTT--VNADIFVGIFYVL 234

Query: 209 IVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRDPGAFK 268
           I+ IN  G + + E EF+ +  K                    +   +G RYW  PGAF 
Sbjct: 235 IIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAF- 293

Query: 269 EYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIV 328
               A       F   +A  V + F++   E   +  +E  NPRK++P A K  +YRI+ 
Sbjct: 294 ----AGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILF 349

Query: 329 FYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHIFNACVLVFVF 388
            +L ++ L+G  V Y+  +L+ + G +  A  SP+V+A+   G+KV+PH  NA +L+ V 
Sbjct: 350 IFLGSITLVGFLVPYDSDQLMGSGGSATKA--SPYVLAVSTHGVKVVPHFINAVILLSVL 407

Query: 389 SACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLAYMNVSSGSAK 448
           S  NS  Y SSR LY+LA  G APK F    + G P+ A++ + +F  +++   S    +
Sbjct: 408 SVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQ 467

Query: 449 IFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALSFCI 508
           +F + + +  +  + +W  I + +I F KA   Q     +  + A    +G+Y+ + F +
Sbjct: 468 VFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYY-VCFML 526

Query: 509 LIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYKLIYK--TKVIKSTDVDL 562
           ++ LI  F V +      K D + F   Y+ +P+ IL + GYK+  K  +  I++ ++DL
Sbjct: 527 VMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFIRANNIDL 586

Query: 563 YTFKEIYDREEEEGRIKDQEREERLQRNG 591
              ++I+D  EE  + +D+E  E+L+  G
Sbjct: 587 DKHRQIFD--EELLKQEDEEYREKLKNGG 613

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  254 bits (650), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 163/530 (30%), Positives = 260/530 (49%), Gaps = 27/530 (5%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            +++LKK +K+RH+ M                       P A++I Y  V  + +F +  
Sbjct: 87  SDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYFMIQA 146

Query: 136 LGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEMA   P     F +Y+S ++    GFA  + Y F++  + P +L  A++ IQYW   
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTIQYW--N 204

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D++NP V+I IF + ++ I++ GVK +GE EF  +  K                    D 
Sbjct: 205 DKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAGDD 264

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G  YW +PGAF     A   S  +F +   + V   FS+ G+EL  +   E  NPRK
Sbjct: 265 GYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQSNPRK 319

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           S P A K ++YRI++ YL T+ L+G  V YND +L+   G +  A  SP+V+A    G+K
Sbjct: 320 STPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHA--SPYVLAASIHGVK 377

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           ++PHI NA +L+ V S  NS LY   R + +L+  G APK      + G P  ALI+  +
Sbjct: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCI 437

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  +A++  SS    +F +   +  +  + +W +I++ ++ F +A + QG    +  Y A
Sbjct: 438 FGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGYKL 548
               +G+ +   F IL+  I  F V L       +   ++F   Y+  P+++  + GY +
Sbjct: 498 TTGIWGSVYGFFFNILV-FIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGY-M 555

Query: 549 IYK---TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNME 595
           IY    T +     +DL   + IYD E    R +DQE EE+     KNM 
Sbjct: 556 IYNRDFTLLNPLDKIDLDFHRRIYDPELI--RQEDQENEEKT----KNMS 599

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  254 bits (649), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 159/518 (30%), Positives = 256/518 (49%), Gaps = 22/518 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
             + LKK +K+RH+ M                       P  +++AY  V  + +F +  
Sbjct: 97  SESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQA 156

Query: 136 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEMA +Y  L G F SY S +V    GFA  + +L ++  + P +L  ++L I+YW   
Sbjct: 157 AGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYW--N 214

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D++N  V++ IF V ++ I+  GV+ +GE EF  +S K                      
Sbjct: 215 DKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHD 274

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G +YW DPGAF  ++     + G+F     + V + FSY G EL  +  +E ENPRK
Sbjct: 275 GYIGGKYWHDPGAFTSHT-----NIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRK 329

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           S P+A K ++YRI+V YL T+ L+G  V +++ +L+ + G +  A  SP+V+A    G++
Sbjct: 330 STPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHA--SPYVLAASIHGVR 387

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           ++PH  NA +L+ V S  NS LY S R L +LA  G APK      + G P  AL    L
Sbjct: 388 IVPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSL 447

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  + +   S+   ++F +   +  +  + +W  I++ ++ F +A + QG D ++  Y A
Sbjct: 448 FGVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKA 507

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
               +G+ + + F IL+     F V L   G K    +F   Y+  P++   + GY L  
Sbjct: 508 VSGVWGSVYGVFFNILV-FFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWN 566

Query: 551 K--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
           K  T +I    +DL   + +YD E        QEREE+
Sbjct: 567 KDFTFLIPLESIDLDFHRRVYDPE-----FIRQEREEK 599

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  252 bits (643), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 157/479 (32%), Positives = 249/479 (51%), Gaps = 14/479 (2%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
            T LK  LK RH+ M                       P ++LI +   G +++  +  L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
           GE+A   P+ G FT+YA+R++D + G+A  + Y+ ++ ++ P ++ +A++ + +W +  +
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
              G ++ +F VVIV IN+ GVK +GE EF  S  K                   P+   
Sbjct: 203 YRDG-FVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGY 261

Query: 256 LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 315
           +G +YW DPGAF   +        KF    +VFV S FS+ G EL G+  SE+  PRKSV
Sbjct: 262 IGGKYWHDPGAFAGDTPG-----AKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSV 316

Query: 316 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVL 375
           PKA K   +RI +FY+ ++ ++G+ V YND  L+     S+ AAASPFV+AI+  GIK L
Sbjct: 317 PKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGAS--SVDAAASPFVIAIKTHGIKGL 374

Query: 376 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFC 435
           P + N  +L+ V S  NS +Y  SR + ALA     P+IFA   + G P   + ++  F 
Sbjct: 375 PSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFG 434

Query: 436 CLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 495
            +A++  S     +FN+ + +  +  + +W  I I +I F KA  AQG D  + ++ +P 
Sbjct: 435 LIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPT 494

Query: 496 QRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
             +G+Y+ L F ++I  I  F V L   G     + F   Y+  P+ +  + G+K IYK
Sbjct: 495 GVWGSYWGL-FMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHK-IYK 551

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  254 bits (650), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 164/527 (31%), Positives = 265/527 (50%), Gaps = 24/527 (4%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           K EN  LKK +K RH  M                       P  ++I YA +G  V+  +
Sbjct: 141 KQEN--LKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCII 198

Query: 134 ACLGEMASYIP--LDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
              GE+A      + GF +Y S  VDPA+GF++ + +  ++  + P +L  A++ I+YW 
Sbjct: 199 QACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWT 258

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
            +  VN  V++ IF V+I+ INI G K + E +F+ +  K                    
Sbjct: 259 VK--VNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAG 316

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
               +G RYWRDPGAF+  +     S  +F   VA FV + F++   E   +  SE  NP
Sbjct: 317 TDGYIGSRYWRDPGAFRGDT-----SIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNP 371

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           RK++P A K  +YRI+  +L ++ L+G  V Y   +LL   G +    ASP+V+A+ + G
Sbjct: 372 RKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSA--TKASPYVIAVSSHG 429

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           ++V+PH  NA +L+ V S  NS  Y SSR L +LA  G APK F    + G P  A+I+S
Sbjct: 430 VRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVS 489

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            +F  +A+   S     +F + + +  +  + +WITI + +I F K  + QG    +  Y
Sbjct: 490 AVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGY 549

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGY 546
            +    +G+ +A+   +L ALI  F V +       K   ++F   Y+ +P+ I  +  Y
Sbjct: 550 KSQVGVWGSAYAVVLMVL-ALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFY 608

Query: 547 KLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           K+  +  +  I +  +DL + + I+D  EE  + +D+E ++RL RNG
Sbjct: 609 KVWKRDWSLFIPADKIDLVSHRNIFD--EELLKQEDEEYKDRL-RNG 652

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  253 bits (645), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 167/527 (31%), Positives = 268/527 (50%), Gaps = 26/527 (4%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           D   ++  LK+ +K RH+ M                       P ++LI YA V  +++ 
Sbjct: 79  DDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYC 138

Query: 132 TMACLGEMAS-YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
            +    E+A  Y  L G F +Y +  VD A  F++ + Y  ++  + P +L  A++ I+Y
Sbjct: 139 VIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKY 198

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W   D +NP  ++ IF VV++ IN +G   + E EF+ ++ K                  
Sbjct: 199 W--NDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGG 256

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGIVCSE 307
             +   LG  YW DPGAF+       G+ G  +F   VAV V + F+Y G E + +  +E
Sbjct: 257 AGNDGYLGSVYWHDPGAFR-------GNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAE 309

Query: 308 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 367
            +NP+KS+  A K  VYRII  YL T  LLG  V YN P LL +   S +  ASPFV+AI
Sbjct: 310 QQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSG--SAATHASPFVIAI 367

Query: 368 QNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNA 427
            + G+KV+PHI NA +L+ V S  NS LY SSR L +L+  G APK+F    + G P   
Sbjct: 368 ASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRC 427

Query: 428 LILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 487
           L++S +F  L ++  S     +F + + +  +  + +W +I + ++ F ++   QG    
Sbjct: 428 LLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLD 487

Query: 488 KFAYVAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSW 543
           +  Y +    +GAY+A+   IL+ LI  F V +     +K D   F   Y+ +P+ I  +
Sbjct: 488 ELGYQSWTGVWGAYYAM-IMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLY 546

Query: 544 AGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ 588
            GYKL Y+    +I + +VDL + ++I+D E     ++ ++ EE+ Q
Sbjct: 547 LGYKLWYRDWRVIIPANEVDLVSHRKIFDAE----IMQSEQLEEKEQ 589

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  254 bits (649), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 152/505 (30%), Positives = 258/505 (51%), Gaps = 17/505 (3%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           ++++  LKK +K RH+ M                       P  +L+ +  +G  ++  +
Sbjct: 143 ENKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCII 202

Query: 134 ACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
             +GEMA +Y  L  GF +Y S  VDPA GF++ + Y  ++  + P +L  A++ I+YW 
Sbjct: 203 QAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWT 262

Query: 192 SRDRVNPGVWITIFLVVIVAINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
           ++  V+P V++ IF V+I+AINIVG    + E EF  +S K                   
Sbjct: 263 TK--VDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGA 320

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
            +   +G +YW +PGAF+        +  +F   +A  V + F++   E  G+  SE  N
Sbjct: 321 GNDGYIGGKYWHEPGAFRGEH-----AIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSN 375

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRK++P A K  +YRI+  +L ++ ++G  V Y+  +LL + G  + A  SP+V+A+   
Sbjct: 376 PRKAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKA--SPYVLAVSTH 433

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G+KV+PH  NA +L+ V S  NS  Y SSR L +LA  G APKIF    + G P   + +
Sbjct: 434 GVKVVPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAM 493

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + LF  +A+   S    ++F + + +  +  + +WI I + ++ F +A   QG    +  
Sbjct: 494 ASLFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELG 553

Query: 491 YVAPGQRYGAYFA--LSFCILIALIKNFTVFLGH-KFDYKTFITGYIGLPVYILSWAGYK 547
           + +    +G+ +A  +  CILIA        +G  K D K F   Y+ +P+ +  + GYK
Sbjct: 554 FRSQVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYK 613

Query: 548 LIYK--TKVIKSTDVDLYTFKEIYD 570
           +  K  T  I++ D+DL + + I+D
Sbjct: 614 IYTKNWTIFIRAKDIDLVSHRNIFD 638

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  251 bits (641), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 160/488 (32%), Positives = 259/488 (53%), Gaps = 21/488 (4%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           K +N  + + LK+RHI +                       P  +LI+Y  +   V+  +
Sbjct: 46  KPQN-EMVRGLKSRHIQLIALGDAIGTGLFIGSGGALSTCGPAPILISYIVMSFFVWTIV 104

Query: 134 ACLGEMASYIPLDG---FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
             L EM + IPL G     S A  YV   L F  G+   +   ++ P+++TA A++IQYW
Sbjct: 105 NQLTEMVALIPLPGEASMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEITACAMLIQYW 164

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                 N  ++I+IF+V  VAI ++ V+ FGE EF +SS K                   
Sbjct: 165 TD---ANSAIFISIFIVFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIVGIVIFFGGG 221

Query: 251 PDHDR-LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCS-EA 308
           P  D  LGF YW+ PGAFKE+   + GSTGKF +     + S FS+  +  T   CS E+
Sbjct: 222 PSQDHILGFHYWKKPGAFKEH--LVPGSTGKFLAVWTAIIKSGFSFVLVPETVASCSAES 279

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST-KGKSMSAAASPFVVAI 367
            +PR+++P+A +  VYR+ +FY+  V ++ + V  +D  LL+     + +AAASP+V+ I
Sbjct: 280 ASPRRNMPRACQRFVYRLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNAAASPYVIGI 339

Query: 368 QNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNA 427
           + +GIKVLPHI NAC+L   +S   ++LY  SR L+++A+ G AP+IFAK +++GVPY +
Sbjct: 340 KEAGIKVLPHIINACILTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKVNRFGVPYYS 399

Query: 428 LILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK- 486
             ++ LF  LAY+N S  S+ +FN+  N+ ++ G +SW+ + + Y  F        IDK 
Sbjct: 400 TAVACLFTLLAYLNCSKSSSLVFNWLSNIATISGFISWVFVSVTYTRFRTV-----IDKL 454

Query: 487 ---SKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSW 543
               +  +    Q+  AY  ++F +L++L   + VF+   ++   F   Y+ +    + +
Sbjct: 455 DLNDRIPFRRRFQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTSDFFASYVTIGFVAVLF 514

Query: 544 AGYKLIYK 551
            G  + YK
Sbjct: 515 IGSTIYYK 522

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  251 bits (642), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 170/516 (32%), Positives = 265/516 (51%), Gaps = 25/516 (4%)

Query: 80  LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEM 139
           LK  LK+RH+ M                       P  +LI +   G +++  +  +GE+
Sbjct: 87  LKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGEL 146

Query: 140 ASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNP 198
           A   P+ G FT+YA+R++D + GFAI + Y+ ++ I  P ++ +A++ + YW    +   
Sbjct: 147 AVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRD 206

Query: 199 GVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 258
           G ++ +F V  V IN+ GVK +GE EF  +  K                   P    +G 
Sbjct: 207 G-FVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGA 265

Query: 259 RYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVP 316
           +YW  PGAF        G T   KF  F  VF+ + FS+ G E+ G+  SE+ENPRKSVP
Sbjct: 266 KYWHHPGAF-------VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVP 318

Query: 317 KAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLP 376
            A K   +RI +FY+  + L+GM V YND RL+     S+ AAASPFV+A+ N GI+ LP
Sbjct: 319 GAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGAS--SVDAAASPFVIAVVNQGIRGLP 376

Query: 377 HIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCC 436
            + N  +L+ V S  NS +Y+ SR L ALA  G  PKI A   + G P  A+ ++  F  
Sbjct: 377 SVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGL 436

Query: 437 LAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQ 496
           +A++  SS   ++FN+ + +  +  + SW  I I +I F +A  AQG    +  +V+   
Sbjct: 437 IAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVG 496

Query: 497 RYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK 553
             G+Y+ +  C+L+ LI  F V L   G   + K F   Y+  P+ +L++  +  I+K  
Sbjct: 497 IAGSYWGIFICVLM-LIAQFYVGLFPAGASPNAKDFFMAYLSFPI-VLAFYIFHKIWKKN 554

Query: 554 ---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
               IK+ D+D+ T +   DR+     +K +   ER
Sbjct: 555 WKLYIKAEDMDIDTGRREVDRD----LLKQEVAAER 586

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  251 bits (640), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 159/526 (30%), Positives = 268/526 (50%), Gaps = 21/526 (3%)

Query: 80  LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEM 139
           L++ LK RH+ M                       P A+LI +  +GL+++  +  +GE+
Sbjct: 80  LQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGEL 139

Query: 140 ASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNP 198
           A   P+  GFT+Y  R+VD + GFAI Y Y+ ++ ++ P ++ AA++ + YW +  +   
Sbjct: 140 AVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRD 199

Query: 199 GVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 258
           G ++ +F VVIV IN+ GVK +GE EF  S  K                   P    +G 
Sbjct: 200 G-FVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGG 258

Query: 259 RYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKA 318
           +YW +PGAF   +        +F +  +VFV + FS+ G EL G+  +E ENPRK++P+A
Sbjct: 259 KYWHNPGAFNGDNAG-----QRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRA 313

Query: 319 IKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHI 378
            K   +RI +FY+ ++ L+G+ V Y    L+ +   S+ AAASPFV+AI+  GI  LP +
Sbjct: 314 AKQVFWRITLFYIISLCLIGLLVPYTSENLIGSS--SVDAAASPFVLAIKTHGISGLPSV 371

Query: 379 FNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLA 438
            N  +L+ V S  NS +Y  SR L ALA  G  P+IF+   + G P   ++ +  F  L 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 439 YMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRY 498
           ++  S     +FN+ + +  +  + +W  I I ++ F +A  AQG    + A+ +    +
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 499 GAYFALSFCILIALIKNFTVF---LGHKFDYKTFITGYIGLPVYILSWAGYKLIYK--TK 553
           G+YF +   I +  I  F +    +G   +   F   Y+ + V +  +  +KL  +  T 
Sbjct: 492 GSYFGV-ILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWTF 550

Query: 554 VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYE 599
             ++ D+D+ T +    RE +   +K +  EE+L+ + K   W+Y 
Sbjct: 551 AKRAKDIDIDTGR----RELDLDALKQEIAEEKLRLSTK--PWWYR 590

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  249 bits (636), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 157/527 (29%), Positives = 261/527 (49%), Gaps = 32/527 (6%)

Query: 71  ADGKDENT-RLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 129
           AD +D  T ++KK +K RH+ M                       P  +++ Y     ++
Sbjct: 55  ADAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAML 114

Query: 130 FFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 187
           +  +   GE+   Y  + G +T+Y+S  VDPA+GF++ + Y  ++  + P QL  AA++I
Sbjct: 115 YLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMII 174

Query: 188 QYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 247
           QYW     +NP +++ I   VIV IN+ G K + E EF+ +  K                
Sbjct: 175 QYWTD---INPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINC 231

Query: 248 XXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSE 307
                   +G +YW +P  F             F     VF Y+ F+Y GIE+  +  SE
Sbjct: 232 GGAGTSGYIGDKYWHEPRPFMN----------GFKGLCFVFCYAAFAYGGIEVMVLSASE 281

Query: 308 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 367
            ENPRKS+  A K  +YRI++ YL T  ++   V  + P L S   +     ASP V+A+
Sbjct: 282 QENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGSR-----ASPLVIAV 336

Query: 368 QNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNA 427
              G+K++PHI NA +L+ V S  NS LY + R L +LA  G APKIF    + G P  A
Sbjct: 337 SFHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPA 396

Query: 428 LILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 487
             ++++F  LA++  S     +F + + +  +  +  W++I I +I F  A +AQG    
Sbjct: 397 FFVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMG 456

Query: 488 KFAYVAPGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSW 543
           +  Y A    +G++ A+    LI LI  F V +        D ++F   Y+  P+ +L++
Sbjct: 457 EVGYKARTGYWGSWIAVVTAFLI-LIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAY 515

Query: 544 AGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ 588
            GYK+ +K     I +++VDL + ++++D +E    +K ++ E +L+
Sbjct: 516 FGYKIYHKDWRICIPASEVDLISHRQVFDEDE----LKQEDLEWKLK 558

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  249 bits (637), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 165/528 (31%), Positives = 255/528 (48%), Gaps = 21/528 (3%)

Query: 81  KKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEMA 140
           KK +K+RH+ M                       P +++IAY  V  + +F +   GEMA
Sbjct: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153

Query: 141 -SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNP 198
            +Y  L G F +Y S ++    GFA  + +  ++  + P +L  AA+ I+YW     ++P
Sbjct: 154 VTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYW--NTSIDP 211

Query: 199 GVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 258
            V++ IF V ++ I+  GV+ +GE EF  ++ K                        +G 
Sbjct: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGG 271

Query: 259 RYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKA 318
           +YW DPGAF     A +    +F       V + FSY G EL  +  ++ +NPRKS P A
Sbjct: 272 KYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAA 326

Query: 319 IKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHI 378
            K  VYRI+V YL T+ L+G  V +N   LL   G +    ASP+V+A    GIKV+PHI
Sbjct: 327 AKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGN-GLHASPYVLAASIHGIKVVPHI 385

Query: 379 FNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLA 438
            NA +L+ + S  NS LY   R L +LA  G AP+  +   + G P  AL+LS L   + 
Sbjct: 386 INAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIG 445

Query: 439 YMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRY 498
           +   S    ++F +   +  +  + +W +I+  +I F +A + Q        Y A    +
Sbjct: 446 FAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLW 505

Query: 499 GAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAGYKLIYK-- 551
           G+YF + F IL+     F V L     G K D  +F   Y+ +P++++ + GY   YK  
Sbjct: 506 GSYFGVGFNILV-FAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDF 564

Query: 552 TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYE 599
           T +     VDL   +++YD E    R +D E +ERL RN   +   YE
Sbjct: 565 TVLTDLNQVDLDNHRKVYDPEFL--RQEDLENKERL-RNSSFLVKIYE 609

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  249 bits (636), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 166/525 (31%), Positives = 258/525 (49%), Gaps = 23/525 (4%)

Query: 72  DGKDEN-TRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 130
           DG+ ++   LKK++K RH+ M                       P  ++I Y  V  + +
Sbjct: 86  DGESKDGIHLKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAPLVIGYGMVSFVTY 145

Query: 131 FTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 188
           F +   GE+A +Y  L G F SY    +    GFA  +    ++  + P +  AA+L I+
Sbjct: 146 FMIQAAGELAVAYPTLPGNFNSYFGILISKPFGFATVWLAAVQWLTVLPLEFIAASLTIK 205

Query: 189 YWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 248
           YW   DR++  V++ IF V ++ I+ VGV+ +GE EF  +  K                 
Sbjct: 206 YW--NDRISGDVFVVIFYVFLLFIHFVGVRAYGETEFIFNLCKVLMIIGFIILSIVINAG 263

Query: 249 XXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
              +   +G +YW DPGAF   +    GS  +F     + V   FSY G EL  +  +E 
Sbjct: 264 GAGNDGYIGGKYWNDPGAF---AGETAGS--RFKGVCYILVTGYFSYGGTELFVLSVNEQ 318

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
           ENPRKS P+A K ++YRI++ YL T+ L+G  V YNDPRL+     S S A SP+V+A  
Sbjct: 319 ENPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRLMGADDASGSHA-SPYVLAAS 377

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
             G+K++PH  NA VL+ + S  NS LY + R + +LA  G APKI A   + G P  +L
Sbjct: 378 IHGVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQGFAPKIMAYVDREGRPLVSL 437

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
            +  LF  + +   SS   ++F +   +  +  + +W    I +I F  A + QG D  +
Sbjct: 438 GICALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFFISHIRFRWAMKLQGKDIKE 497

Query: 489 FAYVAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWA 544
             ++A    YG+++ L F IL+     F V L      K   ++F   Y+  P+++  + 
Sbjct: 498 VGFLASTGLYGSFYGLFFNILV-FAAQFWVALSPIGSKKVGAESFFESYLAFPIWLFFYF 556

Query: 545 GYKLIYKT----KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREE 585
           GY +  K       ++S D+D +  + IYD  EE   I  QE+EE
Sbjct: 557 GYMVWAKDFTFLNPLESIDLDFH--RRIYD-PEEMAEINRQEKEE 598

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  250 bits (639), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 166/545 (30%), Positives = 275/545 (50%), Gaps = 31/545 (5%)

Query: 71  ADGKDENTRL----KKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVG 126
           A  KDE T L     K+L  RH+                         P +++I +  V 
Sbjct: 128 ARDKDEETLLATDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVS 187

Query: 127 LLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 185
             +F  +  LGE+A+  P+  GF+ Y  ++VDP+  FA+   YL ++ +L P +L AA++
Sbjct: 188 TALFTVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASI 247

Query: 186 VIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 245
            I+YW S   +N   W++IF V I   N++ VK FGE EF LS  K              
Sbjct: 248 TIRYWNSS--INSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVL 305

Query: 246 XXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVC 305
                P H+ +G +YW DPGAF       T S  KF    +VFV + FS++GIE+T +  
Sbjct: 306 DCGGGPSHEYIGGKYWHDPGAF-----VGTTSGSKFKGLCSVFVTAAFSFSGIEMTAVSA 360

Query: 306 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVV 365
           +E+ NPR+++PKA K T + I   Y+  + L+G  V YNDPRL++    S+ AA+SP V+
Sbjct: 361 AESRNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGS-SSVDAASSPLVI 419

Query: 366 AIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPY 425
           AI+N  I  LP + NA +L+ + S  NS +Y  SR + +++     PK+FAK  + G P 
Sbjct: 420 AIENGHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPI 479

Query: 426 NALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 485
            A+   + F  L+++  S   A++F +   +  +  I  W+ I + +I F +    Q I 
Sbjct: 480 PAICFVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQIS 539

Query: 486 KSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIL 541
             +  +++    +G+ + +    L+ L+ +F   L      K +  +F  GY+  P+ + 
Sbjct: 540 LDELPFLSQTGIWGSIYGIVILFLV-LVASFWTSLFPVGSSKANATSFFEGYLSFPILLG 598

Query: 542 SWAGYKLIYKT--KVIKSTDVDLYTFKEIYDRE--EEEGRIKDQEREERLQRNGKNMEWF 597
            +  +K+ +K     I ++ +DL++ ++  D E   EE R+   E+E   QR+      F
Sbjct: 599 CYIAHKVYFKNWRWYIPASKMDLHSGRKQVDLEVVREELRL---EKEHLAQRS------F 649

Query: 598 YEKFL 602
           + +FL
Sbjct: 650 FYRFL 654

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  249 bits (635), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 154/522 (29%), Positives = 267/522 (51%), Gaps = 18/522 (3%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           +D++ R  K+L  RH+                         P +++I +  +   +F  +
Sbjct: 66  EDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIV 125

Query: 134 ACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             LGE++S  P+  GF  Y SR+V+P+ GFA+   YL ++ +L P +L AA+L I+YW  
Sbjct: 126 NALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW-- 183

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              +N   W+ IF  +I+  N++ VK FGE EF LS  K                   P 
Sbjct: 184 NHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPK 243

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G +YW +PGAF  ++        +F    +VFV + FSY+G EL  +  +E+ NPR
Sbjct: 244 GGYIGGKYWSNPGAFVGHTAG-----DRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPR 298

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
            ++PKA K T + I V Y+  + L+G  V+ +DPRLL+    S+  AASP V+AI+N GI
Sbjct: 299 ITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLN-GSSSVDVAASPLVIAIENGGI 357

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           K LP + NA +L+ V S  NS +Y  SR + ++A  G  PK+F    + G P  A++ ++
Sbjct: 358 KGLPSLMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATL 417

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           +F  L+++  S    ++F +   +  +  +  W  I + +I F +  + +G    +  +V
Sbjct: 418 IFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFV 477

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYKL 548
           +    +G+Y+     I I L+  F   L    G   + ++F   Y+  P+ +  + G+KL
Sbjct: 478 SMTGVWGSYYG-CIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKL 536

Query: 549 IYKT-KVIKST-DVDLYTFKEIYDRE--EEEGRIKDQEREER 586
             ++ +++  T ++DL + +   D E  ++E RI++Q   ++
Sbjct: 537 YTRSWRLLTPTKEIDLDSGRRAVDLELMKDEKRIEEQAMRQK 578

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  249 bits (635), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 160/520 (30%), Positives = 255/520 (49%), Gaps = 22/520 (4%)

Query: 80  LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEM 139
           +KK LKARH+ M                       P +++I Y  V  +V+F +   GEM
Sbjct: 90  MKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEM 149

Query: 140 A-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVN 197
           A +Y  L G F +Y S ++  + GFA  + +  ++  + P +L  ++L IQYW     +N
Sbjct: 150 AVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYWTD---LN 206

Query: 198 PGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 257
             +++ IF V ++ I+ +GVK +GE EF  +  K                    +   +G
Sbjct: 207 GDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIG 266

Query: 258 FRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPK 317
            +YW  PG+F E      G T +F     V V   FSY G EL  +  +E   PRK+ P 
Sbjct: 267 GKYWHTPGSFAE-----GGPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPA 321

Query: 318 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPH 377
           A K ++YRI+V YL T+ L+G  V +N  +L+   G S  A  SP+V+A    G+KV+PH
Sbjct: 322 AAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHA--SPYVLAASIHGVKVVPH 379

Query: 378 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCL 437
           I NA +L+ V S  NS LY S R L +LA  G APK      + G P  AL+L  +F C+
Sbjct: 380 IINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGCI 439

Query: 438 AYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQR 497
           A++  S    ++F +   +  +  + +W  I+  ++ F  A + Q  D  +  Y A    
Sbjct: 440 AFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATAGI 499

Query: 498 YGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAGYKLIYKT 552
           YG++F   F +L+ LI  F V L     G     ++F   Y+ +P+++  +  Y +  K 
Sbjct: 500 YGSWFGSIFGVLV-LIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYNKE 558

Query: 553 KVIKS--TDVDLYTFKEIYDREEEEGRIKDQEREERLQRN 590
             I +  + +DL   + IYD +    R +D E +E+L+ +
Sbjct: 559 WTILTDLSKIDLDAHRRIYDPDLI--RQEDAENKEKLKNS 596

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  249 bits (635), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 160/532 (30%), Positives = 263/532 (49%), Gaps = 27/532 (5%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            +++LKK +K+RH+ M                       P A++I Y  V  + +F +  
Sbjct: 87  SDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQA 146

Query: 136 LGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEMA   P     F +Y+S ++    GFA  + Y F++  + P +L  A++ IQ+W   
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFW--N 204

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D++NP ++I IF V ++ ++  GVK +GE EF  +  K                    + 
Sbjct: 205 DKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGND 264

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G  YW  PGAF     A   S  +F +   + V + FS+ G+EL  +   E  NPRK
Sbjct: 265 GYIGGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRK 319

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           S P A K ++YRI+V YL T+ L+G  V YND +LL   G +  A  SP+V+A    G++
Sbjct: 320 STPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHA--SPYVLAASIHGVR 377

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           ++PHI NA +L+ V S  NS LY   R + +LA  G APK      + G P  ALI+  +
Sbjct: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCV 437

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
              +A++  SS    +F +   +  +  + +W +I++ ++ F +A + QG   ++  Y A
Sbjct: 438 IGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKA 497

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAGYKL 548
               +G+ +   F IL+  I  F V L     G K + + F   Y+  P++++ + GY +
Sbjct: 498 TTGIWGSIYGSFFNILV-FIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGY-M 555

Query: 549 IYK---TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWF 597
           IY    T +     +DL   + +YD E    R +D+E +E++    KNM + 
Sbjct: 556 IYNRDFTLLNPLDKIDLDFHRRVYDPELM--RQEDEENKEKI----KNMSFL 601

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  248 bits (634), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 159/517 (30%), Positives = 264/517 (51%), Gaps = 21/517 (4%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
            T LK  LK RH+ M                       P ++LI +   G +++  +  L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
           GE+A   P+ G FT+YA+R++D + G+A  + Y+ ++ ++ P ++ +A++ + +W +  +
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
              G ++ +F + IV IN+ GVK +GE EF  S  K                   P    
Sbjct: 203 YRDG-FVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGY 261

Query: 256 LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 315
           +G +YW DPGAF   +        KF    +VFV + FS+ G EL G+  SE+  PRKSV
Sbjct: 262 IGGKYWHDPGAFAGDTPG-----AKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSV 316

Query: 316 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVL 375
           PKA K   +RI +FY+ ++ ++G+ V YND  L+     S+ AAASPFV+AI+  GIK L
Sbjct: 317 PKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGAS--SVDAAASPFVIAIKTHGIKGL 374

Query: 376 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFC 435
           P + N  +L+ V S  NS +Y  SR + ALA     P+IF+   + G P   + ++  F 
Sbjct: 375 PSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFG 434

Query: 436 CLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 495
            +A++  S    ++FN+ + +  +  + +W  I I +I F KA  AQG    + ++ +P 
Sbjct: 435 LIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPT 494

Query: 496 QRYGAYFALSFCILIALIKNFTVF---LGHKFDYKTFITGYIGLPVYILSWAGYKLIYKT 552
             +G+Y+ L F ++I  I  F V    +G     + F   Y+  P+ ++ + G+K IYK 
Sbjct: 495 GVWGSYWGL-FMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHK-IYKR 552

Query: 553 K---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
                I +  +D+ T +    RE +   +K +  EE+
Sbjct: 553 NWKLFIPAEKMDIDTGR----REVDLDLLKQEIAEEK 585

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  248 bits (633), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 156/523 (29%), Positives = 264/523 (50%), Gaps = 22/523 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            +T+ KK L +RH+ M                       P +++I Y  V  + +F +  
Sbjct: 73  SDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYVLVSFVTYFMIQA 132

Query: 136 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEMA +Y  L G F +Y S ++  + GFA  + +  ++  + P +L  ++L I+YW   
Sbjct: 133 AGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELITSSLTIKYW--N 190

Query: 194 DRVNPGVWITIFLVVIVAINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
           D++N  +++ IF V +VAI++VG ++ +GE EF  +S K                    +
Sbjct: 191 DKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILSIVINAGGAGN 250

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G +YW +PG+F E       +T +F     V V   FSY G EL  +  +E   PR
Sbjct: 251 DGYIGGKYWHEPGSFAE-----GDATSRFKGICLVLVSGYFSYGGTELYVLSVNEQAEPR 305

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           K+ P A K ++YRI++ YL T+ L+G  V +N+ +L+   G +  A  SP+V+A    G+
Sbjct: 306 KATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHA--SPYVLAATIHGV 363

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           K++PH  NA +L+ V S  NS L+   R L +LA  G APKI +   + G P  AL +S 
Sbjct: 364 KIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRPLVALGISF 423

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           L   +A+++ +S   ++F +   +  +  I +W  I+  ++ F  A + QG D ++  Y 
Sbjct: 424 LIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDINELGYK 483

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAGYK 547
           A    +G+ +   F +L+ LI  F V L     G K D + F   Y+  P+++  + GY 
Sbjct: 484 ANTGVWGSAYGAFFGVLV-LIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWVACYFGYM 542

Query: 548 LIYKTKVIKS--TDVDLYTFKEIYDREEEEGRIKDQEREERLQ 588
           +  K   + S    +DL +++ IYD E    + +D+E +E L+
Sbjct: 543 IYNKDFTLLSPLDKIDLDSYRRIYDPELI--KQEDEENKENLK 583

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  247 bits (630), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 162/517 (31%), Positives = 261/517 (50%), Gaps = 21/517 (4%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           ++ LK+ LK RH+ M                       P A++IA+   G +V+  +  L
Sbjct: 86  SSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQAL 145

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
           GE+A  +P+ G + SY SR+++P+ GFAI Y YL    I  P +L AA++ + YW   D 
Sbjct: 146 GELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYW-DVDS 204

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP-DHD 254
                ++ +F +VIV IN+ GVK +GE EF  S  K                   P D  
Sbjct: 205 KYADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEG 264

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G RYW +PG F             F  F A+FV S FS+ G E+  +  +E ENPRK 
Sbjct: 265 YIGARYWYNPGGFAH----------GFKGFAAIFVTSAFSFAGSEMFALAAAETENPRKD 314

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +P+A K   +RI +FY+ ++ L+G  V Y D  L +    S+ A+ASPFV+AI  +GIK 
Sbjct: 315 LPRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAAS--SVDASASPFVIAIARAGIKG 372

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP + N  +L+ V S  N  +Y +SR + +LA  G  P+ F    + G P   ++L  +F
Sbjct: 373 LPSVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIF 432

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             L++++ SS   ++F++ + +  +     W +I + ++ F +A   QG    + +Y A 
Sbjct: 433 GLLSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQ 492

Query: 495 GQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
              +G+ + +   I I L   F V L   G   +   F + Y+ LPV I  +  +KL  +
Sbjct: 493 TGIWGSLYGIGL-IFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTR 551

Query: 552 --TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
             T +IKS+D+D+ T +   D E  +  I+++++  R
Sbjct: 552 SWTFLIKSSDIDIDTGRREMDLELLKQEIQEEQQYIR 588

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  247 bits (630), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 159/525 (30%), Positives = 261/525 (49%), Gaps = 23/525 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            N  LKK +K+RH+ M                       P +++I Y  V  + +F +  
Sbjct: 82  SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQA 141

Query: 136 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEM  +Y  L G F +Y S ++  + GFA  + +  ++  + P +L  +++ ++YW   
Sbjct: 142 AGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYW--N 199

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D +N  V+I IF V ++ I+  GVK +GE EF  +S K                      
Sbjct: 200 DTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVD 259

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G +YWRDPG+F E S A      +F     + V + FS+ GIEL  +  +E  NPRK
Sbjct: 260 GYIGGKYWRDPGSFAEGSGAT-----RFKGICYILVSAYFSFGGIELFVLSINEQSNPRK 314

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           S P A K +VYRI++ YL T+ L+G  V +N+ +L+ + G +    ASP+V+A     ++
Sbjct: 315 STPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSA--THASPYVLAASIHKVR 372

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           V+PHI NA +L+ V S  NS LY + R + +LA  G APK      + G P  AL++  L
Sbjct: 373 VIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSL 432

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
              + ++  S    + F +   +  +  + +W  I++ +I F KA + QG    +  Y A
Sbjct: 433 VGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKA 492

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAGYKL 548
               +G+Y+ + F +L+  +  F V L     G K D + F   Y+  P++I  + GY +
Sbjct: 493 NTGIWGSYYGVFFNMLV-FMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGY-M 550

Query: 549 IYK---TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRN 590
           +YK   T +     +DL   + +YD E    R +D+E +ERL+ +
Sbjct: 551 VYKRDFTFLNPLDKIDLDFHRRVYDPEIM--RQEDEENKERLKNS 593

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  248 bits (632), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 153/532 (28%), Positives = 268/532 (50%), Gaps = 20/532 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           EN+ LK+ +K RH+ +                       P  ++I Y+ +G  ++  +  
Sbjct: 113 ENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQA 172

Query: 136 LGEMA---SYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
            GE+A   S +P   F  Y +  VD A GFA+ + Y  ++  + P +L  A++ I+YW +
Sbjct: 173 CGELAVCYSSLP-SNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 231

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              VNP ++++IF V+I+ IN  G + + E EF+ +S K                     
Sbjct: 232 S--VNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGT 289

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G +YW  PGAF             F   +A F  + F++   E   +  +E  NPR
Sbjct: 290 SGYIGAKYWHSPGAFNG-----NRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPR 344

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           K++PKA K+ +YRI+  +L ++ L+G  V YN P LL +   S +  ASP+VVA+ + G+
Sbjct: 345 KAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSG--SDATKASPYVVAVASHGV 402

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           +V+PH  NA +L+ V S  NS  Y SSR L +LA  G APK+F    K G P  A++ S 
Sbjct: 403 RVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCST 462

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           LF  +A+   S    ++F + + +  +  + +W+ I I ++ F +A + QG    +  + 
Sbjct: 463 LFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFK 522

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYKL 548
           +    YG+ +A +  IL ALI  F V L    G+  D + F   Y+ +P+ ++ + GYK+
Sbjct: 523 SQVGIYGSLYAATMLIL-ALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKI 581

Query: 549 IYKTKV--IKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFY 598
             +     I +  +DL + ++++D +  +  + + E+E++    G+ ++ F+
Sbjct: 582 RKRDWKFWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEKKNLSTGRKIQEFF 633

>Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}
           complement(18362..20104) [1743 nt, 581 aa]
          Length = 580

 Score =  246 bits (628), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 154/506 (30%), Positives = 259/506 (51%), Gaps = 13/506 (2%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           +T+  ++L  RH+ +                       P  +LIA+A   + +       
Sbjct: 64  STKTHRKLLNRHVQLIAISGVIGTALFVAIGKALYHGGPAFLLIAFALWCIPILCITVST 123

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
            EM S++P+   F   AS+  D +L     + + F   +  P ++ +   +I YW  RD 
Sbjct: 124 AEMVSFLPVASPFLRLASKCADESLAVTASWNFWFLECVQIPFEIVSVNTIIHYW--RDD 181

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
            N  + + + +V+ + I+I  VK++GE EFWL+SFK                   P HDR
Sbjct: 182 YNAAIPLVVQVVLYLFISIATVKYYGEMEFWLASFKIILAIGLFFFTLVTMLGGNPKHDR 241

Query: 256 LGFRYWRDPGAFKEY----STAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
            GFRYW +   FK+Y    +T  T S G F  F+   + + F+  G E   ++  E + P
Sbjct: 242 YGFRYWGEE-PFKKYYPDNNTNGTDSLGYFQGFLTCLIQAAFTIAGGEYISMLAGEIKLP 300

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNS 370
           RK +PKA K   +R+ + +L T   LG+  + NDP L +   ++   A +SPFV+A+ N 
Sbjct: 301 RKVLPKAFKQVFWRLTIIFLGTCLCLGIVCSPNDPSLTAAINEARPGAGSSPFVIAMNNL 360

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            I+VLP I NA ++   FSA N+  Y SSR LY +A+DG APKIF + +K+GVP  A+ +
Sbjct: 361 RIRVLPDIVNAALITSAFSAGNAYTYCSSRTLYGMALDGYAPKIFTRCNKYGVPIYAVGV 420

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           S+L+  ++ + ++S SA + N+ VN+++   +++++ + ++Y++F +A  AQ        
Sbjct: 421 SLLWALISLLQLNSNSAIVLNWLVNLITASQLINFVFLCVIYLFFRRAYNAQKDKLPPLP 480

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           + + GQ Y A F L     +  I+ +TVF+   ++ + F+  Y+ + + +  + GYK I+
Sbjct: 481 FRSWGQPYTAIFGLVCAFSMIFIQGYTVFIHSLWNTRDFLFCYLMVFINVAIYLGYKFIW 540

Query: 551 ---KTKVIKSTDVDLYT-FKEIYDRE 572
              K K I    VD  T  KEI   E
Sbjct: 541 KRGKDKFIDPHKVDFITDLKEIEAHE 566

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  246 bits (627), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 157/515 (30%), Positives = 262/515 (50%), Gaps = 22/515 (4%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           N  LK+ LK+RH+ M                       P  +LI +A  G +++  +  +
Sbjct: 73  NAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 137 GEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
           GE+A   P+  G+T+YASR+VD + GFA    Y   + I  P ++ AA++ + YW +  +
Sbjct: 133 GELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAK 192

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
                ++ +F VVIV IN+ GVK +GE EF  S  K                   P    
Sbjct: 193 YRDA-FVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGY 251

Query: 256 LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 315
           +G R W +PGAF             F    +VFV + FS+ G EL G+  +E  NPRKS+
Sbjct: 252 IGGRLWHNPGAFAN----------GFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSI 301

Query: 316 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVL 375
           P A K   +RI +FY+  + ++G+ V Y   RL+     S+ AAASPFV++IQN+GIK L
Sbjct: 302 PSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQS--SVDAAASPFVISIQNAGIKGL 359

Query: 376 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFC 435
           P + N  +L+ V S  N  ++  SR++ ALA  G  PKIF    + G P   ++++ +F 
Sbjct: 360 PSVINVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFG 419

Query: 436 CLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 495
            L+++  S    ++F++ + +  +  + +W  IL+ +I   +A  AQ    ++ ++ AP 
Sbjct: 420 LLSFIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPT 479

Query: 496 QRYGAYFALSFCILIALIKNFTVF--LGHKFDYKTFITGYIGLPVYILSWAGYKLIYKT- 552
             +G+ ++L   ILI + + +     +G K     F   Y+  P+YI+ + G+K+  K  
Sbjct: 480 DVWGSVYSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNW 539

Query: 553 -KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
              IK++D+D+ + +    RE +   +K +  EE+
Sbjct: 540 KLFIKASDIDIDSGR----RETDIEALKQEIAEEK 570

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  245 bits (626), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 162/525 (30%), Positives = 260/525 (49%), Gaps = 27/525 (5%)

Query: 78  TRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLG 137
           T LKK +K+RH+ M                       P +++I Y  V  + +F +   G
Sbjct: 51  THLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAG 110

Query: 138 EMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
           EMA +Y  L G F SY S ++    GFA  + +  ++  + P +L  A+L ++YW   D+
Sbjct: 111 EMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYW--NDK 168

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
           +N  V+I IF   ++ I+  GVK +GE EF  +S K                        
Sbjct: 169 INADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGY 228

Query: 256 LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 315
           +G +YW DPG+F +    IT    +F     + V + FSY G EL  +  +E ENPRKS 
Sbjct: 229 IGAKYWHDPGSFAD-GPPIT----RFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKST 283

Query: 316 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVL 375
           P A K ++YRI++ YL T+ L+G  V +N   L+     S +  ASP+V+A     +KV+
Sbjct: 284 PAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAG--SAATHASPYVLAASLHSVKVV 341

Query: 376 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFC 435
           PH  NA +L+ V S  NS LY + R + +LA  G APK      + G P   LIL  LF 
Sbjct: 342 PHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFG 401

Query: 436 CLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 495
            + +++ SS   ++F +   +  +  + +W  I++ +I F +A +  G    +  + A  
Sbjct: 402 VIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVT 461

Query: 496 QRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
             +G+Y+  +F IL+  I  F V L     G K D + F   Y+  P++++ + GY +IY
Sbjct: 462 GIWGSYYGCAFNILV-FIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGY-MIY 519

Query: 551 K---TKVIKSTDVDLYTFKEIYDRE--EEEGRIKDQEREERLQRN 590
           K   T +     +DL   + IYD +  ++E    D+E +ERL+ +
Sbjct: 520 KRDFTILNPLEKIDLDFHRRIYDPDFIKQE----DEENKERLKNS 560

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  246 bits (627), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 159/525 (30%), Positives = 265/525 (50%), Gaps = 22/525 (4%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           +   ++  LK+ ++ RH+ M                       P +++I YA V  +++ 
Sbjct: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132

Query: 132 TMACLGEMAS-YIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
            +    E+A  Y  L  GF +Y S  VD A GF++ + Y  ++  + P +L  A++ I+Y
Sbjct: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W     +NP  ++TIF VV+VAIN VG   + E EF+ +  K                  
Sbjct: 193 W--NQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGG 250

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
             +   LG RYW DPGAF+      + S  +F   VAV V + F+Y G E + +  +E +
Sbjct: 251 AGNDGYLGARYWHDPGAFRG-----SDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NP+KS+  A K  VYRI+  Y+ T  LLG  V +N   LL + G +  A  SPFV+A+ +
Sbjct: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHA--SPFVIAVAS 363

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
            G++V+PH  NA +L+ V S  NS LY SSR L +L+  G AP+      + G P   L+
Sbjct: 364 HGVRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLL 423

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           +S +F  L+++  S     +F + + +  +  + +W +I + ++   +A   QG    + 
Sbjct: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAG 545
            YVA    +GAY+A++  + I L+  F V +     +K D   F   Y+ +P+ I  + G
Sbjct: 484 GYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLG 542

Query: 546 YKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ 588
           YK+  +    +I S++VDL   ++I+D E     ++ ++ EE+ Q
Sbjct: 543 YKIWTRDWRLLIPSSEVDLVAHRKIFDAEV----LRHEQLEEKEQ 583

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  246 bits (627), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 154/523 (29%), Positives = 259/523 (49%), Gaps = 22/523 (4%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           N +L+K ++ RH+ M                       P  +LI Y  +   ++  +   
Sbjct: 77  NNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQAC 136

Query: 137 GEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           GEMA +Y+ L  GF +Y S  VD A  FA+ + Y  ++  + P +L  A++ I+YW   +
Sbjct: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NE 194

Query: 195 RVNPGVWITIFLVVIVAINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           +V+P V++TIF ++I+AIN+ G  + + E EF+ +  K                      
Sbjct: 195 KVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTS 254

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G  YW +PGAF+ ++        +F   V+  V + FS+   E   I  SE  NPRK
Sbjct: 255 GYIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRK 309

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           ++P A K  +YR +  Y+ ++ ++G  V YN P LL +K  S    ASP+V+A+ + GI+
Sbjct: 310 AIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSK--SSQTKASPYVIAVASHGIR 367

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           + PH  NA +L+ V S  NS  Y SSR L  LA  G APKIF    + G P   +I + L
Sbjct: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
              +A+   S    ++F++ + +  +  + +W TI + +I F +A + QG   ++  Y +
Sbjct: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYKLI 549
               +G+ +A +   LI LI  F V L     +  +   F   Y+ +P+ +L + GYK  
Sbjct: 488 QVGVWGSIYAATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTW 546

Query: 550 YK--TKVIKSTDVDLYTFKEIYDRE---EEEGRIKDQEREERL 587
            K     I++ D+DL + + IYD +   +E+ + K+  +   L
Sbjct: 547 KKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSL 589

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  246 bits (627), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 153/526 (29%), Positives = 266/526 (50%), Gaps = 18/526 (3%)

Query: 73  GKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFT 132
           G   + +LKK +K+RH+ M                       P  ++I YA +G  ++  
Sbjct: 89  GDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCI 148

Query: 133 MACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           +   GE+A  Y  L G F +Y S  +DPALGF++ + Y  ++  + P +L  A++ I+YW
Sbjct: 149 IQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYW 208

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
            +   VNP +++ IF V+ +AIN+ G + + E EF+ ++ K                   
Sbjct: 209 TTS--VNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGA 266

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
            +   +G +YW DPG+F             F   V+  V + F++   E   +  +E  N
Sbjct: 267 GNDGYIGGKYWNDPGSFSGDK-----PIDHFKGVVSTLVTAAFAFGATEFIALTAAEQAN 321

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRKS+P A K  +YRIIV +L ++ L+G  V +N   L+ + G +  A  SP+V+AI + 
Sbjct: 322 PRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHA--SPYVIAIASH 379

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G+KV+PH  NA +L+ V S  NS  Y SSR L +LA  G AP       + G P  A+I+
Sbjct: 380 GVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMII 439

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           S +F  ++++  S     +F + + +  +  + +W  I + +I F +A + QG    +  
Sbjct: 440 SAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELG 499

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVF--LGH-KFDYKTFITGYIGLPVYILSWAGYK 547
           + +    +G+Y+A    +LI + + +T    +G  K D + F   Y+ +P+ I  + GYK
Sbjct: 500 FKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYK 559

Query: 548 LIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           +  +  T  I ++ +DL + + I+D  E+  + +D E  E+L+ +G
Sbjct: 560 VWKRDWTLYIPASKIDLISNRRIFD--EDVLKQEDAEFREKLRNSG 603

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  246 bits (628), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 162/532 (30%), Positives = 265/532 (49%), Gaps = 21/532 (3%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           NT LKK +K+RH+ M                       P A++I Y  V  + +F +   
Sbjct: 112 NTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLVSFVTYFMIQAA 171

Query: 137 GEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           GEMA +Y  L G F +Y+S +V  A GFA  + +  ++  + P +L  A+L I+YW   D
Sbjct: 172 GEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELITASLTIKYW--ND 229

Query: 195 RVNPGVWITIFLVVIVAINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           ++N  V+I IF V ++ I++ G V  +GE EF  +  K                    + 
Sbjct: 230 KINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMSIVINAGGAGNR 289

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
           + +G ++W DPGAF   +    GS  +F     V V   FSY G EL  +  +E  NPR+
Sbjct: 290 EYIGGKFWHDPGAF---AGKTAGS--RFKGICYVLVSGYFSYGGTELFALSVNEQSNPRR 344

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           S P+A K ++YRI++ YL T+ L+G  V Y+   L+ + G +  A  SP+V+A   +G+K
Sbjct: 345 STPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHA--SPYVLAASLNGVK 402

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           + PH  NA +L+ V S  NS LY + R + +LA  G APK      + G P  ALI  +L
Sbjct: 403 IAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLLALIACLL 462

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
              + ++  S    ++F +   +  +  + +W +I++ ++ F  A + Q     +  Y A
Sbjct: 463 VGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSLEELGYKA 522

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLGHKFDYK----TFITGYIGLPVYILSWAGYKLI 549
               YG+ + + F +L+   + +T       D K    +F   Y+ +P++++ + GY L 
Sbjct: 523 TTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVFYFGYMLW 582

Query: 550 YKT-KVIKSTD-VDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYE 599
            +  +++K  D +DL   + IYD E    R +D+E +ERL RNG  M   Y 
Sbjct: 583 TRDFQLLKPLDKIDLDFHRRIYDPELM--RQEDEESKERL-RNGSFMMRMYH 631

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  245 bits (625), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 159/524 (30%), Positives = 258/524 (49%), Gaps = 21/524 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            N  LKK +K+RH+ M                       P +++I Y  V  + +F +  
Sbjct: 82  SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQA 141

Query: 136 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEM  +Y  L G F +Y S ++  + GFA  + +  ++  + P +L  +++ I+YW   
Sbjct: 142 AGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYW--N 199

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D +N  V+I IF V ++ I+  GVK +GE EF  +S K                      
Sbjct: 200 DSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVD 259

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G +YWRDPG+F + S A      +F     + V + FS+ GIEL  +  +E  N RK
Sbjct: 260 GYIGGKYWRDPGSFADGSNAT-----RFKGICFILVTAYFSFGGIELFVLSINEQSNARK 314

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           S P A K +VYRI++ YL T+ L+G  V +N+ +L+ +   S +  ASP+V+A     ++
Sbjct: 315 STPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSG--SAATHASPYVLAASIHKVR 372

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           V+PHI NA +L+ V S  NS LY + R + +LA  G AP+      + G P  AL +  L
Sbjct: 373 VIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCAL 432

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
              + ++  S    + F +   +  +  I +W  I++ +I F KA + QG    +  Y A
Sbjct: 433 VGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKA 492

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAGYKL 548
               +G+Y+ + F IL+  +  F V L     G K D + F  GY+  P++I  + GY L
Sbjct: 493 NTGIWGSYYGVFFNILV-FMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYML 551

Query: 549 IYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRN 590
             K  T +     +DL   + +YD E    R +D+E +E+L+ +
Sbjct: 552 YNKDFTLLNPLDKIDLDFHRRVYDPEIM--RQEDEENKEKLRNS 593

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  244 bits (622), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 160/535 (29%), Positives = 261/535 (48%), Gaps = 28/535 (5%)

Query: 72  DGKDENT-------RLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAF 124
           +GKD +         LK  +K RH++M                       P  ++I Y  
Sbjct: 53  EGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVT 112

Query: 125 VGLLVF-FTMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTA 182
              +++    AC     +Y  L G + +Y +  VD   GFA+   Y  ++  + P +L  
Sbjct: 113 TSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVT 172

Query: 183 AALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXX 242
           A++ ++YW S   VNP V++ IF V ++ I+  G + + E EF  +S K           
Sbjct: 173 ASMTVKYWTSS--VNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMA 230

Query: 243 XXXXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTG 302
                    +   +G +YW DPGAF         +  +F    +V+V + F+Y G E   
Sbjct: 231 ISLTAGAS-EQGYIGGQYWHDPGAFGG-----DRAIDRFKGICSVWVQAAFAYGGSEFIA 284

Query: 303 IVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASP 362
           +  +E  NPR+SVPKA K  +YR++V +L  V L+G  V +N  +LLS +G S S A SP
Sbjct: 285 LTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRA-SP 343

Query: 363 FVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWG 422
           FV+A    G++V+PHI N  +L  V S  NS +Y + R L +LA  G  PKIF    + G
Sbjct: 344 FVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQG 403

Query: 423 VPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 482
            P   LI   LF  +A++  S+    +F +   +  +  + +W  I + ++ F +A R Q
Sbjct: 404 RPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQ 463

Query: 483 GIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLP 537
           G    +  Y A     G+Y+A+ F +++ LI  F + +       + D + F   Y+  P
Sbjct: 464 GRSLGELGYRANTGALGSYYAIFFNVIV-LIAQFWIAIAPIPKHGELDVEFFFQNYLAFP 522

Query: 538 VYILSWAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRN 590
           V ++ + GYKL  +    VI S++VDL + ++I+D  EE    ++ ER+ERL+ +
Sbjct: 523 VLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFD--EEVLLQEEAERKERLRNS 575

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  245 bits (625), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 150/507 (29%), Positives = 252/507 (49%), Gaps = 21/507 (4%)

Query: 73  GKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFT 132
           GK E   LK  +K RH+ M                       P  ++I YA +G  ++  
Sbjct: 118 GKSE--ELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCI 175

Query: 133 MACLGEMASYIP--LDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           +   GEMA      + GF SY S  ++PALGF++ + Y  ++  + P +L  A++ I+YW
Sbjct: 176 IQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYW 235

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
            ++  V+P V++ IF V+I+ IN++G    + E EF+ +S K                  
Sbjct: 236 TTK--VDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGG 293

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
             D   +G RYW DPGAF+        +  +F   V+  V + F++   E+ G+  SE  
Sbjct: 294 AGDDGYIGGRYWHDPGAFRGEH-----AIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQS 348

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRK++P A K  +YRI+  YL +V ++G  V +N  +LL + G  + A  SP+V+A+  
Sbjct: 349 NPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKA--SPYVLAVST 406

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
            G++V+PH  NA +L+ V S  NS  Y SSR L  LA  G APKIF    + G P   + 
Sbjct: 407 HGVRVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMC 466

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           ++ L   +++   S    ++F + + +  +  + +W  I + +I F +A   QG    + 
Sbjct: 467 VAALVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEI 526

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAG 545
            + +    +G+++A    +LI LI  F V +      + D + F   Y+  P+ I  + G
Sbjct: 527 GFKSQCGVWGSWYAFIMMMLI-LIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFG 585

Query: 546 YKLIYKT--KVIKSTDVDLYTFKEIYD 570
           YK+  K     I++ D+DL   ++++D
Sbjct: 586 YKIYTKDWRLFIRAKDIDLDINRDVFD 612

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  244 bits (624), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 150/504 (29%), Positives = 247/504 (49%), Gaps = 25/504 (4%)

Query: 72  DGK--DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 129
           DG+  +  T+L K +K RHI M                       P  ++I Y    +++
Sbjct: 96  DGEFAETETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMI 155

Query: 130 FFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 187
           +  +   GE+   Y  L G +T+Y +  +DPA+GFA+   Y  ++  + P QL  AA+ I
Sbjct: 156 YCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTI 215

Query: 188 QYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 247
           +YW +   VNP +++   LV+++AIN+ G K + E EF+ +  K                
Sbjct: 216 RYWTTN--VNPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINC 273

Query: 248 XXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSE 307
               D + +G +YW+ PGAF             F    AVF Y+ FSY GIE+  +  +E
Sbjct: 274 GGAGDKEYIGVKYWQTPGAFAN----------GFKGVAAVFCYAAFSYGGIEVLVLTANE 323

Query: 308 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 367
             NPRK++P A +  VYR++  Y+ T  ++   V YN P LL +      + ASPFV+A+
Sbjct: 324 QANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAV 383

Query: 368 QNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNA 427
            + G++V+PHI NA +L+ V S  NS LY   R L +L+  G APK F    + G P   
Sbjct: 384 ASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIIC 443

Query: 428 LILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ--GID 485
           +++SV    +A++       ++F + + V  +  I  W++I I ++ F  A R+Q  G+ 
Sbjct: 444 VLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLR 503

Query: 486 -KSKFAYVAPGQRYGAYFALSFCILIALIKNFTVF--LGH--KFDYKTFITGYIGLPVYI 540
            +    Y A     G+  AL+  I I + + +     LGH  + D + F   Y+  PV +
Sbjct: 504 ARDVVEYTAQTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLL 563

Query: 541 LSWAGYKLIYKT--KVIKSTDVDL 562
             +  YK+ ++     I + ++DL
Sbjct: 564 GGYLAYKIWHRDWRLCIPANEIDL 587

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  244 bits (624), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 158/524 (30%), Positives = 271/524 (51%), Gaps = 21/524 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           E+  L+K +K RH+ M                       P  ++I Y+ +G  ++  +  
Sbjct: 118 ESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQA 177

Query: 136 LGEMAS-YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEMA  Y  L+G F +Y S  +DPALGF++ + Y  ++  + P +L  A+L I+YW ++
Sbjct: 178 AGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTTK 237

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
             V+P V++ IF V+I++IN+ G + + E EF+ +  K                    + 
Sbjct: 238 --VDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGND 295

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             LG +YW +PGAF+        +  +F   +  FV + F++   E   +  +E  NPRK
Sbjct: 296 GYLGAKYWHEPGAFRG-----EHAVDRFKGVMDTFVAAAFAFGATEFIALTAAEQSNPRK 350

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           ++P A K  +YRI++ +L ++ +LG  V Y+  +LL + G  + A  SP+V+A+   G++
Sbjct: 351 AIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKA--SPYVLAVSLHGVR 408

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           V+PH  NA +L+ V S  NS  Y SSR L +L+  G APK F    + G P  A+++S L
Sbjct: 409 VVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSAL 468

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  +A+   S     +FN+ + +  +  + +W  I + ++ F  A + QG    +  + +
Sbjct: 469 FGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHS 528

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYKLI 549
               YG+ +A +  IL AL+  F V +      K D + F   Y+ +P+ I  + GYKL 
Sbjct: 529 QTGVYGSLYAATMMIL-ALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLY 587

Query: 550 YK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           Y+     IK+  +DL + ++I+D  E   + +D+E +E+L RNG
Sbjct: 588 YRDWKLYIKADKIDLISHRQIFD--ENILKQEDEEYKEKL-RNG 628

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  243 bits (621), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 160/527 (30%), Positives = 255/527 (48%), Gaps = 23/527 (4%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
            ++  +KK +K+RH+ M                       P  +++ Y  V  + +F + 
Sbjct: 73  SDDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQ 132

Query: 135 CLGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             GEMA   P     F +YAS +V    GFA  + +  ++  + P +L  A++ I+YW  
Sbjct: 133 AAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW-- 190

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
            D +NP V+I IF V ++ I+  GVK +GE EF  +S K                     
Sbjct: 191 NDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGR 250

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G +YW +PGAF   S A      +F     + V   FSY G EL  +  +E +NPR
Sbjct: 251 DGYIGNKYWINPGAFASESPA-----ARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPR 305

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           KS P A K ++YRI++ YL T+ L+G  V ++  +L+   G +  A  SP+V+A    G+
Sbjct: 306 KSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHA--SPYVLAASLHGV 363

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           KV+PH  NA +L+ V S  NS LY S R + +LA  G APK F    + G P  AL +  
Sbjct: 364 KVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICG 423

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           LF  + ++  S    + F +   +  +  + +W +I I +I F  A + QG    +  Y 
Sbjct: 424 LFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYR 483

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGYK 547
           A    +G+ +++ F +L+  I  F V L       K+D + F   Y+  P++++ + GY 
Sbjct: 484 ATTGIWGSVYSVFFNMLV-FIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGY- 541

Query: 548 LIYK---TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           +IY    T +     +DL   + IYD E    R +D E +ERL+ +G
Sbjct: 542 MIYSRDFTFLTPLDKIDLDFHRRIYDPELL--RQEDAETKERLRNSG 586

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  243 bits (620), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 162/533 (30%), Positives = 261/533 (48%), Gaps = 25/533 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            N RLKK +K+RH+ M                       P +++I Y  V  + +F +  
Sbjct: 82  SNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQA 141

Query: 136 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEM  +Y  L G F +Y S ++  + GFA  + +  ++  + P +L  +++ I+YW   
Sbjct: 142 AGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYW--N 199

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D++N  V+I IF V ++ I+  GVK +GE EF  SS K                      
Sbjct: 200 DKINSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVD 259

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G +YWRDPG+F E + A      +F     + V + FS+ GIEL  +  +E  NPRK
Sbjct: 260 GYIGGKYWRDPGSFAEGNGAT-----RFKGICFILVTAYFSFGGIELFVLSINEQSNPRK 314

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           S P A K +VYRI++ YL T+ L+G  V +N+ +L+ +   S +  ASP+V+A     ++
Sbjct: 315 STPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSG--SAATHASPYVLAASIHKVR 372

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           V+PHI NA +L+ V S  NS LY + R + +LA  G APK      + G P  AL +  L
Sbjct: 373 VVPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCL 432

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
              + ++  S    + F +   +  +  + +W  I++ +I F KA + QG    +  Y A
Sbjct: 433 VGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKA 492

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAGYKL 548
               +G+Y+ + F IL+  +  F V L     G K + + F   Y+  P+++  + GY L
Sbjct: 493 NTGIWGSYYGVFFNILV-FMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYML 551

Query: 549 IYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYE 599
             +  T +     +DL   + +YD E     I  QE EE  +R  KN  +F+ 
Sbjct: 552 YERDFTFLNPLDKIDLDYHRRVYDPE-----IIRQENEENKERL-KNSSFFFR 598

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  244 bits (622), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 149/507 (29%), Positives = 258/507 (50%), Gaps = 18/507 (3%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           K+E+  L+K ++ RH+ M                       P  ++I YA +G  ++  +
Sbjct: 121 KEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCII 180

Query: 134 ACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
              GEMA SY  L G F +Y +  VD   GFA+ + Y  ++  + P +L  A++ I YW 
Sbjct: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
           ++  VN  +++ IF V+I+ IN+ G K + E +F+ ++ K                    
Sbjct: 241 TK--VNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAG 298

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
               +G +YW DPGAF+        S  +F   +A F  + F++   E   I  SE  NP
Sbjct: 299 TSGYIGAKYWHDPGAFRG-----DRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNP 353

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
           R+++P A K+ +YRI+  +L ++ L+G  V Y+   L+ +   S    ASP+V+AI + G
Sbjct: 354 RRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSG--SGGTKASPYVLAISSHG 411

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           ++V+PH  NA +L+ V S  NS  Y S R L++L+  G AP+ F    + G P  A+I+S
Sbjct: 412 VRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIIS 471

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
           +LF  +A+   SS   ++F + + +  +  I +W+ I + +I F +A   QG   S+  +
Sbjct: 472 ILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGF 531

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYK 547
            +    +G+ +A +  + +ALI  F V +        D K+F   Y+ +P+ I+ + GYK
Sbjct: 532 RSQLGVWGSVYAATM-LFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYK 590

Query: 548 LIYK--TKVIKSTDVDLYTFKEIYDRE 572
           +  +     I++ ++DL T + I+D E
Sbjct: 591 IYNRDWKLFIRAKNIDLITHRNIFDAE 617

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  243 bits (619), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 158/524 (30%), Positives = 260/524 (49%), Gaps = 21/524 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            N  LKK +K+RH+ M                       P +++I Y  V  + +F +  
Sbjct: 82  SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQA 141

Query: 136 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEM  +Y  L G F +Y S +V  + GFA  + +  ++  + P +L  +++ I+YW   
Sbjct: 142 AGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYW--N 199

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D +N  V+I IF V ++ I+  GVK +GE EF  +S K                      
Sbjct: 200 DTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVD 259

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G  YWR+PG+F + S+A      +F     + V + FS+ GIEL  +  +E  NPRK
Sbjct: 260 GYIGGEYWRNPGSFADGSSAT-----RFKGICFILVTAYFSFGGIELFVLSINEQANPRK 314

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           S P A K ++YRI++ YL T+ L+G  V +++ +L+ +   S +  ASP+V+A    G+K
Sbjct: 315 STPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSG--SSATHASPYVLAASIHGVK 372

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           V+PHI NA +L+ V S  NS LY + R + +LA  G APK      + G P  AL++   
Sbjct: 373 VIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSF 432

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
              + ++  SS   + F +   +  +  I +W  I++ +I F KA + QG    +  Y +
Sbjct: 433 VGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKS 492

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGYKL 548
               +G+Y+ + F IL+  +  F V L       K D ++F   Y+  P++I  + GY +
Sbjct: 493 NTGIWGSYYGVIFNILV-FMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLGYMI 551

Query: 549 IYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRN 590
             K  T +     +DL   + +YD E    R +D+E +ERL+ +
Sbjct: 552 YNKDFTLLNPLDKIDLDFHRRVYDPEIM--RQEDEENKERLRNS 593

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  243 bits (620), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 156/522 (29%), Positives = 257/522 (49%), Gaps = 28/522 (5%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           ++   LK+++K RH+ M                       P  + I YA +G  ++  + 
Sbjct: 97  EKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQ 156

Query: 135 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             GE+A +Y  L G F +Y S  VDPA+ FA    Y  ++  + P ++ +AA+ I+YW  
Sbjct: 157 AAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYW-- 214

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              +NP VW  IF V+I+ IN+ G   + E +F+ ++ K                    D
Sbjct: 215 NTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGD 274

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
              +G +YW DPGAF        G TG  +F + V+  V + F++   E   +  SE  N
Sbjct: 275 SVYIGGKYWNDPGAFN-------GDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQAN 327

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRK++P A K  +YRII  YL ++ L+G  V YN P L+ +   S S  +SP+V+A+ + 
Sbjct: 328 PRKAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSG--SSSVHSSPYVIAVASH 385

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G+KV+P   NA +L+ V S  N   Y SSR L  L+  G APK F    + G P  A+I+
Sbjct: 386 GVKVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIV 445

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
             L  C+ +++ SS    +F + + V  +  + +W  I I ++ F KA + Q     +  
Sbjct: 446 GALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELG 505

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAG 545
           + +    +G+Y+ + F +++  I  F V L         D + F   Y+ +PV++  + G
Sbjct: 506 FRSQVGVWGSYYGI-FMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFG 564

Query: 546 YKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREE 585
           +K+  K     I ++++DL + ++I+D E     I  QE EE
Sbjct: 565 FKIWKKDWRLYIPASEIDLISHRKIFDEE-----ILKQEDEE 601

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  242 bits (618), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 155/521 (29%), Positives = 254/521 (48%), Gaps = 22/521 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            ++ LK+ +K RH++M                       P  ++I YA V ++ +  M  
Sbjct: 79  SSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQA 138

Query: 136 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEMA +Y  L G F +Y+S+ +    GFA  + Y  ++  + P +L  A+L I+YW   
Sbjct: 139 AGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYW--N 196

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
           D +N  V+I IF V I+ I+  G + +GE EF     K                    D 
Sbjct: 197 DSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDR 256

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G +YW DPGAF     A+     KF     V V   FSY G EL  +  +E  NPR+
Sbjct: 257 KYIGAKYWYDPGAF-----AVGSGATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRR 311

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           ++    K  +YRI++ Y+ T+ L+G  V +    L+ + GKS +  ASP+V+A+   G+K
Sbjct: 312 AIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKS-ATHASPYVLAVSLHGVK 370

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           ++PHI NA +L+ V S  NS +Y   R L  LA  G AP+  A   + G P  ALI   +
Sbjct: 371 IVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSV 430

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  LA++  S     +F +   +  +  + +W  I++ ++ F +A R      S+  Y A
Sbjct: 431 FGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKA 490

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGYKL 548
                G+   LSF IL+  I  F V +       K D  +F   Y+  P++++ + GY +
Sbjct: 491 NTGVLGSVLGLSFNILV-FIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMI 549

Query: 549 IYKT-KVIKS-TDVDLYTFKEIYDREEEEGRIKDQEREERL 587
           +++  ++IK   D+DL  ++ IYD++    R+  ++ E ++
Sbjct: 550 VFRNWEIIKPLKDIDLDHYRSIYDQD----RLYQEDLEHKI 586

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  243 bits (620), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 164/528 (31%), Positives = 267/528 (50%), Gaps = 21/528 (3%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           +GK +   LKK +K RH+ M                       P  + I YA +G  ++ 
Sbjct: 117 EGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYC 176

Query: 132 TMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
            +   GEMA +Y  L  GF +Y S  V P LGFA+ + Y  ++  + P +L  A++ I+Y
Sbjct: 177 IIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKY 236

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W ++  VNP V++ IF  +I+ IN+ G + + E EF+ +  K                  
Sbjct: 237 WTTK--VNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGG 294

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
             +   +G +YW DPGAF+    AI     +F    A  V + F++ G E   +  SE  
Sbjct: 295 AGNDGYIGGKYWHDPGAFRG-DKAID----RFKGVAATLVTAAFAFGGSEFIALTASEQS 349

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRK++P A K  +YRII+ +L ++ ++G  V +N  +L+ +   S    ASP+V+AI +
Sbjct: 350 NPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSD--SSKTKASPYVIAISS 407

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
            G++V+PH  NA +L+ V S  NS  Y SSR L +L+  G APK F    + G P  A++
Sbjct: 408 HGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMV 467

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           +  LF  +A+   SS    +F + + +  +  I +W  I + +I F +A   QG    + 
Sbjct: 468 IGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEI 527

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAG 545
            + +    +G+Y+A     L+ LI  F V L     +K D ++F   Y+ + + I  + G
Sbjct: 528 GFKSELGVWGSYYAAGMMFLV-LIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVG 586

Query: 546 YKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           Y    K  T  I++ D+DL   ++I+D  E+  R +D+E +E+L RNG
Sbjct: 587 YMFWKKDWTLFIRAKDIDLDHHRQIFD--EDVLRQEDEETKEKL-RNG 631

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  242 bits (617), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 166/540 (30%), Positives = 264/540 (48%), Gaps = 33/540 (6%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DG      LK+ LKARH+ M                       P+A++I ++  G  +  
Sbjct: 77  DGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVG 136

Query: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           T+  LGE+    P+ G F +Y++R++DP++ F I   Y+ ++F + P ++ A+A+ IQYW
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYW 196

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                ++P VW+ IF  VIV+IN+ G + FGE EF  SS K                   
Sbjct: 197 --NQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGG 254

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           PDHD +G RYW DPG               F   ++V V + +S  G E+  +   E  N
Sbjct: 255 PDHDFVGARYWHDPGCLSH----------GFPGVLSVLVVASYSLGGTEMVCLASGET-N 303

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PR+ +P AIK T +RI+ F+L ++ L+G  V Y +P LL       S   SPFV+AI+  
Sbjct: 304 PRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGS----SVNNSPFVIAIKLH 358

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            IK LP I NA +L+ + S  NS ++ SSR L ++A  G  PK F    + G P   ++ 
Sbjct: 359 HIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILT 418

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + LF  LA++  SS   ++F++ + +  +   + W++I I +I F  A +AQG    +  
Sbjct: 419 NSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELE 478

Query: 491 YVAPGQRYG-AYFAL-SFCILIALIKNFTVFLGHKFDY----KTFITGYIGLPVYILSWA 544
           +V+    +G AY AL +  ILIA        +G   D     KTF   Y+   +    + 
Sbjct: 479 FVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFV 538

Query: 545 GYKLIYKTK------VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFY 598
            +K+ Y+ K      ++    +DL T ++  D +  +  I   ER   LQ +   + W++
Sbjct: 539 CHKVFYRYKTGKWWAIMDLDKIDLETDRKNIDIDVLKQEIA--ERNRHLQASPWYVRWYH 596

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  241 bits (616), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 158/530 (29%), Positives = 262/530 (49%), Gaps = 27/530 (5%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           + K EN  LK+ +K+RH+ M                       P    I +  +GL V+ 
Sbjct: 84  NAKHEN--LKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYC 141

Query: 132 TMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
            +   GE+A  Y  L  GF +Y S  +DPALGFA  + Y  ++  + P +L  A++ I++
Sbjct: 142 VIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKF 201

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W     VNP +++ IF V+I+ IN  G + + E EF+ +S K                  
Sbjct: 202 WPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGA 261

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGST--GKFTSFVAVFVYSLFSYTGIELTGIVCSE 307
                 +G +YWRDPG+       + G T    F   VA  V + FS    E   +  +E
Sbjct: 262 VGTSGYIGGKYWRDPGS-------LGGRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAE 314

Query: 308 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 367
             NPRKS+P A K  +Y+I V +L +V L+G  V  +   L+ +    +    SP+V+A+
Sbjct: 315 QANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHV--SPYVIAV 372

Query: 368 QNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNA 427
           +  G+ V+P   NA +L+ V S  NS  Y SSR L++LA    APKIF    + G P  A
Sbjct: 373 RMHGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMA 432

Query: 428 LILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 487
           +I+S+LF  + ++  S    ++F + + +  +  + +W TI + +I F +A   QG    
Sbjct: 433 MIISILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTD 492

Query: 488 KFAYVAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSW 543
           +  + A     G+Y + +  +++ALI  F V L      + D ++F TGY+ +P+++L +
Sbjct: 493 ELGFKAQTGIIGSYVS-AIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFY 551

Query: 544 AGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ-RN 590
            GYK+  K     I++  +DL + + I+D +     +K ++ E R + RN
Sbjct: 552 FGYKIWNKDWRLFIRADQIDLVSHRRIFDADV----LKQEDIEYRAKLRN 597

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  242 bits (617), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 154/528 (29%), Positives = 264/528 (50%), Gaps = 21/528 (3%)

Query: 69  AIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 128
           A+ D    +++L K L  RH+                         P ++LIA+  +   
Sbjct: 98  AVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTC 157

Query: 129 VFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 187
           +F  +  LGE+AS  P+  GF  Y +R+V+P+ GFA+  +YL ++ +L P +L AA++ I
Sbjct: 158 LFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITI 217

Query: 188 QYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 247
           +YW   +++N   W+ IF V I   N++ VK FGE EF LS  K                
Sbjct: 218 KYW--NNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLIC 275

Query: 248 XXXPDHDRLGFRYWRDPGAFKEYSTAITGST--GKFTSFVAVFVYSLFSYTGIELTGIVC 305
              P    +G +YW DPGAF        G T   +F    +VFV + FSY+G EL G+  
Sbjct: 276 GGGPVGGFIGAKYWHDPGAF-------VGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSA 328

Query: 306 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVV 365
           +E+ NPR ++P+A K + + I   YL  + + G  V  NDPRLL+    S+  AASP V+
Sbjct: 329 AESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGM-SSVDVAASPLVI 387

Query: 366 AIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPY 425
           AI+N GI+ +P + NA +L+ + S  NS +Y  SR + ++A  G  PK+F    + G P 
Sbjct: 388 AIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPL 447

Query: 426 NALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 485
            A++ +++F  L+++  S     IF +   +  +  +  W  I I +I F +A  AQ   
Sbjct: 448 VAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRS 507

Query: 486 KSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILS 542
             +  Y++     G+++  +  + + ++  +T            ++F  GY+  P++++ 
Sbjct: 508 LDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLIC 567

Query: 543 WAGYKLIYKTK---VIKSTDVDLYTFKEIYDREE-EEGRIKDQEREER 586
           +  +KL YK      I +  +D+ + +   D EE +E ++++Q    +
Sbjct: 568 YISHKL-YKRDWRLFIPAGQIDVDSGRRALDIEELKEQKLREQAETAK 614

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  242 bits (617), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 154/526 (29%), Positives = 266/526 (50%), Gaps = 22/526 (4%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           D++  L+K ++ RH+ M                       P A++I Y  +G  ++  + 
Sbjct: 114 DDDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQ 173

Query: 135 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             GEMA  Y  L G F +Y S  VD  + F + + Y  ++  + P +L  A++ I YW +
Sbjct: 174 ACGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTT 233

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
           +  VN  V++ IF V+I  IN  G K + E EF+ +S K                    +
Sbjct: 234 K--VNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGN 291

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G +YW +PGAF+        S  +F   ++ F  + F++   E   I  SE  NPR
Sbjct: 292 DGYIGAKYWHNPGAFRG-----DKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPR 346

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           +++P A K  +YRI+  +L ++ L+G  V Y+   LL +   S S+ ASP+V+A+ + G+
Sbjct: 347 RAIPSAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSG-GSASSQASPYVIAVASHGV 405

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           +V+PH  NA +L+ V S  NS  Y S R LY+LA  G APK F    + G P  A++++ 
Sbjct: 406 RVVPHFINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTT 465

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           +F  +A+ + S     +F + +++  +  + +W  I + +I F +A + QG    +  + 
Sbjct: 466 IFGVIAFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFK 525

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYKL 548
           +    +G+ +A +  +++ALI  F V +        D + F   Y+ +P+ I+ + GYK 
Sbjct: 526 SQVGVWGSGYA-AIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYK- 583

Query: 549 IYKTK---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           IYK      I++ D+DL + + I+D E    R +++E +E+L RNG
Sbjct: 584 IYKKDWKLFIRAKDIDLISHRTIFDGELV--RQEEEEYKEKL-RNG 626

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  240 bits (613), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 151/519 (29%), Positives = 263/519 (50%), Gaps = 16/519 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           E++R  K+L  RH+                         P +++I +  +   +F  +  
Sbjct: 66  EDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNA 125

Query: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           LGE++S  P+  GF  Y SR+V+P+ GFA+   YL ++ +L P +L AA+L I+YW S  
Sbjct: 126 LGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNST- 184

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            +N   W+ IF  +I   N++ VK FGE EF LS  K                   P+  
Sbjct: 185 -INSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGG 243

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G +YW +PGAF   +     S+ +F    +VFV + FSY+G EL  +  +E+ NPR +
Sbjct: 244 YIGGKYWSNPGAFVGNT-----SSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRIT 298

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +PKA K T + I V Y+  + L+G  V  +DPRLL     S+  AASP V+AI+N GIK 
Sbjct: 299 LPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLH-GSSSVDVAASPLVIAIENGGIKG 357

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           LP + NA +L+ V S  NS +Y  SR + ++A  G  PK F+   + G P  A++ +++F
Sbjct: 358 LPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIF 417

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             L+++  S+    +F +   +  +  +  W  I + +I F    + +G    +  +V+ 
Sbjct: 418 GLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSM 477

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLGHK---FDYKTFITGYIGLPVYILSWAGYKLIYK 551
              +G+Y+      ++ ++  +T            ++F   Y+  P+ ++ + G+KL  K
Sbjct: 478 TGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTK 537

Query: 552 T--KVIKSTDVDLYTFKEIYDRE--EEEGRIKDQEREER 586
           +   +  +T++D+ + +   D E  ++E R+++Q   E+
Sbjct: 538 SWRLLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREK 576

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  240 bits (613), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 156/518 (30%), Positives = 263/518 (50%), Gaps = 17/518 (3%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           K   + L+ +LK+RH+ M                       P  +LI +   G ++F  +
Sbjct: 82  KTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMV 141

Query: 134 ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             LGE+A   P+ G F +YA+R++D + GFA  + Y+F++ +  P ++ AA++ + YW +
Sbjct: 142 MALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWET 201

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
             R   G ++ +F +V+V IN+ GV+ +GE EF  S  K                   P 
Sbjct: 202 PVRYTDG-FVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPV 260

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G RYW DPGAF  +S        +F  F +VFV + FS+ G EL GI  +E++NPR
Sbjct: 261 GGYVGGRYWHDPGAFAGHSPG-----RRFKGFCSVFVTAAFSFAGSELVGIASAESKNPR 315

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           KSVP+A K   +RI++FY+  + L+G+ V Y DPRLL + G  + A+ASPFV+AI   GI
Sbjct: 316 KSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSG--VDASASPFVIAIVTHGI 373

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
             LP + N  +L+ V S  NS +Y  SR L AL+  G  PK  A   + G P   + +  
Sbjct: 374 SGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICS 433

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
            F  +A++  S+   ++FN+ + +  +   L+W +I   +I F  A +  G    +  + 
Sbjct: 434 GFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFK 493

Query: 493 APGQRYGAYFALSFCILIALIKNFTVF--LGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           +P    G+Y+ +   +L+ + + +     +G   +   F + Y+  P+ +  +  +KL  
Sbjct: 494 SPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWK 553

Query: 551 KT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
           +    +I   D+D+ T +    RE +   +K +  EE+
Sbjct: 554 RNWKLLIPLKDIDIDTGR----RETDINLLKQEIAEEK 587

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  240 bits (612), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 161/539 (29%), Positives = 261/539 (48%), Gaps = 31/539 (5%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           + RL++ ++ RH++M                       P  ++I YA V ++ +  M   
Sbjct: 76  DGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQAA 135

Query: 137 GEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194
           GEMA +Y  + G F +Y+S ++    GFA  + Y  ++  + P +L  A+L I+YW   D
Sbjct: 136 GEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWT--D 193

Query: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 254
            VN  V+I IF V I+ I+  G + +GE EF     K                    +  
Sbjct: 194 SVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSG 253

Query: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G RYW DPGAF     A+     KF  F  V V   FSY G EL  +  +E  +PR++
Sbjct: 254 YIGARYWHDPGAF-----AVGDPASKFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRA 308

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +  A K  +YRI+V Y+ T+ L+G  V +    L+ + GKS +  ASP+V+A+   G+KV
Sbjct: 309 IHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKS-ATHASPYVLAVSLHGVKV 367

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           +PHI NA +L+ V S  NS +Y   R L ALA  G APK  A   + G P  ALI   + 
Sbjct: 368 VPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVI 427

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             LA++  S     +F +   +  +  + +W  IL+ +I F +A +  G   S+  Y + 
Sbjct: 428 GLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSI 487

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGYKLI 549
              +G+ + + F IL+  +  F V L       K D  +F   Y+  P++ + + GY ++
Sbjct: 488 TGLWGSIYGVCFNILV-FVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGY-MV 545

Query: 550 YKTK--VIKS-TDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRI 605
           Y  +  +++   D+D+  F+ +YD E    RI+ ++ E +      N       +LGR+
Sbjct: 546 YSGEWMILRPLKDIDINHFRCVYDEE----RIEQEKLEHKTMLQNSN-------WLGRL 593

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  240 bits (612), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 156/528 (29%), Positives = 257/528 (48%), Gaps = 21/528 (3%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           D      ++K+ +K+RHI+M                       P  ++I Y     +++ 
Sbjct: 68  DYNATQKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYC 127

Query: 132 TM-ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
            + AC     SY  L G + SY S  VD    FA+ + Y  ++ I+ P +L  +++ I+Y
Sbjct: 128 VIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKY 187

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W   D +NP V++ IF   IV I+  G + + E EF  +S K                  
Sbjct: 188 W--NDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGA 245

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
                 +G +YW  PGAF         +   F    +V+V S F+Y G E   +  +E  
Sbjct: 246 SKS-GYIGGKYWHTPGAFVGEK-----AIDHFKGICSVWVQSAFAYGGSEFIALTAAEQT 299

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRKSVPKA K  +YR+++ +L  + L+G  V Y+ P LL + G++ S A SPFV+A  +
Sbjct: 300 NPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHA-SPFVIAAAS 358

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
            G+KV+PHI NA +L+ V S  NS  Y + R L +LA  G  PK+F    + G P   ++
Sbjct: 359 HGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTML 418

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
              +F  ++++  S     +F +   +VS+  + +W  I + +I F  A + QG    + 
Sbjct: 419 FVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGEL 478

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWA 544
            Y A    +G+++A++F I++ L   F V +     G K D   F   Y+  PV +  + 
Sbjct: 479 GYKANTGYWGSWYAIAFNIIV-LAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYF 537

Query: 545 GYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRN 590
           GYKL Y+     I +  VDL + ++I+D +    + +D E +ER++ +
Sbjct: 538 GYKLWYRDWKLFIPADKVDLESHRKIFDADLI--KQEDFEHKERIRNS 583

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  239 bits (611), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 162/532 (30%), Positives = 259/532 (48%), Gaps = 24/532 (4%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           +  +  LK  LK RH+ M                       P  +LI +   G +++  +
Sbjct: 75  RTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMV 134

Query: 134 ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             +GE++   P+ G FT+YA+R++D + GFA  + Y+ ++  + P ++ AA++ + YW +
Sbjct: 135 MAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGT 194

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
             +   G ++ +F VVIV IN+ GVK +GE EF  S  K                   P+
Sbjct: 195 DPKYRDG-FVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPE 253

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
              +G +Y+ DPGAF        G T   +F    +VFV + FS+ G EL GI  +E+  
Sbjct: 254 GGYIGGKYFHDPGAF-------VGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAE 306

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           PRKSVPKA K   +RI +FY+ ++ ++G+ V Y D RL+     S+ AAASPFV+AI + 
Sbjct: 307 PRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGAS--SVDAAASPFVIAITSH 364

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           GI+ LP + N  +L+ V S  NS +Y  SR L ALA     PKIF    + G P   +  
Sbjct: 365 GIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAF 424

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           +  F  +A++  S    ++F + + +  +  + +W  I   +I F  A  AQG    +  
Sbjct: 425 TSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELP 484

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGYK 547
           + AP   YG+ + L F I++  +  F V L   G K   + F   Y+  PV +  + G+K
Sbjct: 485 FKAPAGIYGSMWGL-FMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHK 543

Query: 548 LIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWF 597
           L  +    +I  + +D+ T      R E +  +  QE  E  Q       W+
Sbjct: 544 LYARNWKLLIPLSKLDIDT-----GRREMDLDVLRQEIAEEKQMMSTRPWWY 590

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  239 bits (609), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 160/540 (29%), Positives = 261/540 (48%), Gaps = 39/540 (7%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DG  +   LK+ LKARH+ M                       P+A++I +A  G  +  
Sbjct: 77  DGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIG 136

Query: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           T+  LGE+    P+ G F +Y++R++DP+L F I   Y+ ++F + P ++ ++A+ +QYW
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYW 196

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                ++P VW+ IF   IV+IN+ G + FGE EF  SS K                   
Sbjct: 197 --NQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGG 254

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           PDHD +G +YW DPG               F   ++V V + +S  G E+  +  +  E 
Sbjct: 255 PDHDFVGAKYWHDPGCLAH----------GFPGVLSVLVVASYSLGGTEM--VCLASGET 302

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
             K +P AIK T +RI+ F+L ++ L+G  V Y +  LL       S   SPFV+AI+  
Sbjct: 303 DPKELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGS----SVNNSPFVIAIKLH 358

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            IKVLP I NA +L+ + S  NS ++ SSR L ++A  G  P+ F    + G P   +I 
Sbjct: 359 QIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIIT 418

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + LF  LA++  SS  +++F++ + +  +   + W++I I +I F  A +AQG    +  
Sbjct: 419 NSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELE 478

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFL-------GHKFDYKTFITGYIGLPVYILSW 543
           +V+    +G+ ++     LI L+  F   L             K F   Y+   + I+ +
Sbjct: 479 FVSAVGIWGSAYSAVINSLI-LVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLF 537

Query: 544 AGYKLIYKTK------VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWF 597
            G+K+ Y+ K      ++    +DL T     DR+  +  I  QE  ER  R+ +   W+
Sbjct: 538 VGHKIFYRYKTGKWWSMLPLNKIDLET-----DRKNIDIEILKQEIAER-NRHLRASPWY 591

>AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR132C (AGP2)
          Length = 566

 Score =  237 bits (605), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 150/504 (29%), Positives = 262/504 (51%), Gaps = 12/504 (2%)

Query: 82  KELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEMAS 141
           ++L+ RH+ +                        V++L+ +A   + +        EM  
Sbjct: 55  RKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPILCITVSTAEMVC 114

Query: 142 YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGV 200
           Y+PL+  F   ASR V+ +L    G+ + F   +  P ++ A   +I YW  RD  +  +
Sbjct: 115 YLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQIPFEIVAVNSIIHYW--RDDYSAAI 172

Query: 201 WITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRY 260
            + + +++ + I++  V+++GE EFWL+SFK                   P  DR GFRY
Sbjct: 173 TLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLFCFTFVTMVGGNPKRDRYGFRY 232

Query: 261 WRDPGAFKEYSTA---ITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPK 317
             +   FK+YS     I+ S G F  F+A  + + F+  G +   ++  E + PRK +P 
Sbjct: 233 IGE-APFKQYSPTMEPISSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVLPV 291

Query: 318 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNSGIKVLP 376
           A K    R+ V +L     +G+  + NDP L +    S   A +SP+V+A+ + GIK+LP
Sbjct: 292 AFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAGSSPYVIAMNHLGIKILP 351

Query: 377 HIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCC 436
            I NA ++   FSA N+  Y SSR+LY LA+DG AP IF + +++GVP  A+ +SV++  
Sbjct: 352 DIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKRCNRFGVPIYAVSVSVMWSV 411

Query: 437 LAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQ 496
           L+ + ++S SA + N+ +++++   ++++  + +VY+YF +A  AQ  +  + ++ +  Q
Sbjct: 412 LSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYFRRAYLAQQDNLPELSFKSWWQ 471

Query: 497 RYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY---KTK 553
            Y AY  L+  +LI +++ +TVF    ++ K F+  Y+ + + I  + GY+ I+   K  
Sbjct: 472 PYTAYVGLTCVLLIVVVQGYTVFYSALWNVKDFLFCYLMVFIDIAIYLGYRYIWRRGKDA 531

Query: 554 VIKSTDVDLYT-FKEIYDREEEEG 576
           VI  T+VDL T   EI   E   G
Sbjct: 532 VIPPTEVDLTTGLLEIELHERHHG 555

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  239 bits (609), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 149/528 (28%), Positives = 261/528 (49%), Gaps = 21/528 (3%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           + +DEN +LK+ +K RH+ M                       P  ++I Y  +G  ++ 
Sbjct: 142 EQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYC 201

Query: 132 TMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
            +   GE+A +Y  ++G F ++ S  VDP   FA+ + Y  ++  + P +L  +++ I+Y
Sbjct: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
           W ++  V+P V++ IF V+I+ IN  G K + E EF+ +  K                  
Sbjct: 262 WTTK--VDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
                 +G +YW DPGAF+  +        +F   +  FV + F++   E   +  +E  
Sbjct: 320 AGTDGYIGAKYWNDPGAFRGQT-----KIERFKGVMDTFVTAAFAFGATEFIALTAAEQS 374

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRK++P A K   YRI++ +L ++ L+G  V YN  +L+ +   S   +ASP+V+A   
Sbjct: 375 NPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSS--SGGNSASPYVLAASL 432

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
            G+ V+ H  NA +L+ V S  NS  Y SSR L  LA  G APK F    + G P  +++
Sbjct: 433 HGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSML 492

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
            + +   +A+   S     +F + + +  +  I +W  I + +I F +  + QG    + 
Sbjct: 493 CAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGEL 552

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAG 545
            + A     G+Y+A +  + +AL+  F V L     H  D + F   Y+ +P+ +  + G
Sbjct: 553 GFRAQTGVLGSYYA-AIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVG 611

Query: 546 YKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           +KL  +     I++ ++DL + + I+D  EE  R +D+E +E+L RNG
Sbjct: 612 FKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKL-RNG 656

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  237 bits (605), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 164/510 (32%), Positives = 252/510 (49%), Gaps = 25/510 (4%)

Query: 74  KDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTM 133
           K EN +L + +K+RH+ M                       P  ++I Y    ++V+F +
Sbjct: 87  KTEN-QLNRSIKSRHLLMISLGTGIGTGLLVGNGQVLAKSGPAGLVIGYGVASIMVYFIV 145

Query: 134 ACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
              GE+   Y  L G +  Y S  VDPALGFAI   Y  ++  + P QL  AA+ I YW 
Sbjct: 146 QAAGELGICYSGLTGNYIRYPSILVDPALGFAISIIYTLQWLTVMPLQLVTAAMTIGYW- 204

Query: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 251
               +NP +++ I LV++V  N  G K + E EF  + FK                    
Sbjct: 205 --TNINPNIFVAIVLVIVVLTNCFGAKGYVEAEFLCNIFKVLMMVGFVLLAILINTGAIG 262

Query: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
               +G  YW++PGAF             F    +VF Y+ FSY GIE+  +  +E ENP
Sbjct: 263 TDGYIGTIYWKNPGAFAN----------GFKGVCSVFCYAAFSYGGIEVLALTAAEQENP 312

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371
            K++P A K TVYRI+  Y+ T  L+G  V Y+ P+L+ +      + +SPFV+AI + G
Sbjct: 313 IKAIPSACKKTVYRILFLYMLTTILIGFLVPYDSPQLMGST-SGGGSHSSPFVIAIASHG 371

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           +KV+PH+ NA +L+ + S  NS  Y S+R L +L+  GK PKIF    K G P+  ++ +
Sbjct: 372 VKVVPHLINAVILISIVSVANSAFYSSTRLLLSLSEQGKIPKIFNYVDKEGRPWYCILFA 431

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
            LF  + ++  S    ++F + + +  +  I  W++I + +I F +A   QG    +  Y
Sbjct: 432 SLFGSIGFVASSPYKEEVFTWLLAISGLSQIFLWMSICLSHIRFRRAMIKQGKSLDEIGY 491

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGY 546
            AP   +G++ ALS   L +LI  F V +       K D   F   Y+  P+ ++++ GY
Sbjct: 492 KAPTGCWGSWIALSIA-LFSLISQFWVAIAPIGKDGKLDVLVFFQNYLAAPIVLIAYLGY 550

Query: 547 KLIYKT--KVIKSTDVDLYTFKEIYDREEE 574
           K  YK     I S  +DL   +EIY  EE+
Sbjct: 551 KTYYKDWRLYIPSDKIDLSYGREIYVPEEQ 580

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  238 bits (606), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 147/530 (27%), Positives = 252/530 (47%), Gaps = 30/530 (5%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
            E   L K +K+RH+ M                       P  +++ Y    ++++  + 
Sbjct: 85  QEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCIIQ 144

Query: 135 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             GE+   Y  L G +T Y S  VDP+LGFA+   Y  ++  + P QL  AA+ ++YW S
Sbjct: 145 AAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTS 204

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              VN  +++ +  + ++ IN+ G + + E EF  +  K                    D
Sbjct: 205 ---VNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGAGD 261

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G  YW +PG F             F     VF Y+ FSY GIE+  +  +E ENP 
Sbjct: 262 RKYIGTEYWHNPGPFAH----------GFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPT 311

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           KS+P A K  VYRI++ Y+ T  L+   V YN   LL +   S S A SPFV+A+ + G+
Sbjct: 312 KSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHA-SPFVIAVASHGV 370

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           KV+PH  NA +L+ V S  NS LY   R L +LA  G  PK  A   + G P    ++S+
Sbjct: 371 KVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSL 430

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
            F C+ ++  S    ++F + + + S+  +  W+++ + +I F  A   QG   ++  Y 
Sbjct: 431 AFGCIGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYK 490

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGYK 547
           A    +G++ A+   +   L+  F V +       K + K F   Y+ +P+ ++++ G+K
Sbjct: 491 AQTGYWGSWLAVLIAVFF-LVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHK 549

Query: 548 LIYKTKV--IKSTDVDLYTFKEIY------DREEEEGRIKDQEREERLQR 589
           + +K+    I +  +DL + + I+      + ++ +  +K+ E +E L+ 
Sbjct: 550 IYFKSWSFWIPADKIDLNSHRNIFVHSTLTEFDKADDDVKEYENQESLEN 599

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  237 bits (605), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 156/535 (29%), Positives = 269/535 (50%), Gaps = 21/535 (3%)

Query: 74  KDENTR-LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFT 132
           KD++ R LKK +K RH+ M                       P  ++I YA +G  ++  
Sbjct: 102 KDDDARELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCI 161

Query: 133 MACLGEMAS-YIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           +   GE+A  Y  L  GF +Y S  +DPA GFA+ + Y  ++  + P +L  A++ I+YW
Sbjct: 162 IQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYW 221

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
            ++  V+P V++ IF  +I+ IN++G    + E EF+ +SFK                  
Sbjct: 222 TTK--VDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGG 279

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
             +   +G R W +PG+F+           +F   V+  V + F++   E  G+  SE  
Sbjct: 280 AGNDGYIGTRLWHNPGSFRG-----DKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQS 334

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NPRK++P A K  +YRII  YL +V ++G  V Y+  +LL + G +  A  SP+V+AI  
Sbjct: 335 NPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKA--SPYVLAISL 392

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
            G++V+PH  NA +L+ V S  NS  Y SSR L +L+  G AP       + G P  A  
Sbjct: 393 HGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYC 452

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           +S L   +A+   S    ++F + + +  +  + +W +I + ++ F +A R QG    + 
Sbjct: 453 VSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEV 512

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYILSWAGY 546
            + +    YG+ ++    +LI + + +T  +     K D + F   Y+ +P++I+ + G+
Sbjct: 513 GFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGF 572

Query: 547 KLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYE 599
           K+  K     I++ D+DL + +EI+D  EE  + +D+E   +L R+G      Y+
Sbjct: 573 KIWKKDWRLFIRAEDIDLVSHREIFD--EELLKQEDEEYRRKL-RDGPMWRRVYD 624

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  237 bits (604), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 150/532 (28%), Positives = 261/532 (49%), Gaps = 20/532 (3%)

Query: 68  FAIADGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGL 127
           F     +   T+LK+ +  RH+ M                       P  ++I YA +G 
Sbjct: 78  FGAEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGS 137

Query: 128 LVFFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 185
            ++  +   GE+A SY  L G F +Y S  ++ A GF++ + Y  ++  + P +L  A++
Sbjct: 138 CLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASI 197

Query: 186 VIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXX 245
            I+YW +   VNP +++ IF V+I+ +N+ G + + E EF+ +  K              
Sbjct: 198 TIKYWTTS--VNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIV 255

Query: 246 XXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVC 305
                 +   +G RYW +PGAF  Y T        F   ++  V + F++   E   +  
Sbjct: 256 NCGGAGNDGYIGGRYWNNPGAF--YGTK---PIHHFKGIISTMVTAAFAFGATEFIALTA 310

Query: 306 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVV 365
           +E  NPR+++P A K  VYRI++ +L  + L+G  V +N P L+ +   S +  ASP+V+
Sbjct: 311 AEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSG--SSATHASPYVI 368

Query: 366 AIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPY 425
           A+ + G++V+PH  NA +L+ V S  NS  Y SSR L ALA    AP       + G P 
Sbjct: 369 AVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPM 428

Query: 426 NALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 485
            A+++S +F  ++++  S     +F + + +  +  + +WI+I + +I F KA   QG  
Sbjct: 429 RAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKP 488

Query: 486 KSKFAYVAPGQRYGAYFA--LSFCILIALIKNFTVFLGH-KFDYKTFITGYIGLPVYILS 542
             +  Y +     G+Y+A  +  CILI         +G  K D  +F   Y+ LP++++ 
Sbjct: 489 IGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVL 548

Query: 543 WAGYKLIYKTK---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           + G+K I+K      I    +DL + ++ +D  EE  + +D E EE ++  G
Sbjct: 549 YFGFK-IWKRDWRLYIPLEQIDLDSHRKTFD--EELLKQEDAEYEENIRNKG 597

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score =  236 bits (602), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 141/505 (27%), Positives = 256/505 (50%), Gaps = 9/505 (1%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           +T  +++L+ RH+ +                       P ++L+A+A   + +       
Sbjct: 75  STETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVST 134

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
            EM  + P+   F   A++ VD +L     + + F   +  P ++ +   +I YW  RD 
Sbjct: 135 AEMVCFFPVSSPFLRLATKCVDESLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDD 192

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
            + G+ + + +V+ + I+I  VK++GE EFWL+SFK                   P HDR
Sbjct: 193 YSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFVTMLGGNPKHDR 252

Query: 256 LGFRYWRDPGAFKEY---STAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
            GFRY+ +   FK+Y      +  S+G F  F+A  + + F+  G E   ++  E + PR
Sbjct: 253 YGFRYYGE-SPFKQYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPR 311

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNSG 371
           K +PKA K    R+   +L +   +G+  + NDP L +   ++   A +SP+V+A+ N  
Sbjct: 312 KVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNMK 371

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           I++LP + N  ++   FSA N+  Y SSR  Y +A+DG APKIF K +K GVP  A+ +S
Sbjct: 372 IRILPDVVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTKCNKHGVPIYAVGIS 431

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
           +++  ++ + ++S SA + N+ +N+++   +++++ + I+Y++F +    Q     K  +
Sbjct: 432 LIWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRTYSIQQDSLPKLPF 491

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            + GQ Y A   L  C+ + +I+ +TVF    ++ + F+  Y+ + + I  + GYK I+K
Sbjct: 492 RSWGQPYTAIIGLVSCLAMIMIQGYTVFFPKLWNSQDFLFSYLMVFIDIGIYVGYKFIWK 551

Query: 552 TKVIKSTDVDLYTF-KEIYDREEEE 575
               K  D     F KE+ + E  E
Sbjct: 552 RGKDKVKDPYKIDFSKELIEIENHE 576

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  236 bits (602), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 143/504 (28%), Positives = 243/504 (48%), Gaps = 24/504 (4%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
            E   L+K +K+RH+ M                       P  +++ Y    ++++  + 
Sbjct: 85  QEKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQ 144

Query: 135 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             GE+   Y  L G +T Y+S  VDP+LGFA+   Y  ++  + P QL  AA+ ++YW +
Sbjct: 145 AAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTN 204

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              VN  +++ +  + ++ IN+ G + + E EF  +  K                    D
Sbjct: 205 ---VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGD 261

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G  YW +PG F             F     VF Y+ FSY GIE+  +  +E ENP 
Sbjct: 262 RRYIGTEYWHNPGPFAH----------GFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPT 311

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           +S+P A K  VYRI++ Y+ T  L+G  V YN   LL +   S  + ASPFV+A+ + G+
Sbjct: 312 ESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSG-SSSGSHASPFVIAVSSHGV 370

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           KV+PH  NA +L+ V S  NS LY   R L +LA  G  PK  A   + G P    ++S+
Sbjct: 371 KVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSL 430

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
            F C+ ++  S+   ++F + + + S+  +  W+++ + +I F  A   QG    +  Y 
Sbjct: 431 AFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYK 490

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGYK 547
           A    +G++ A+   +   L+  F V +       K D K F   Y+ +P+ +L++ G+K
Sbjct: 491 AQTGYWGSWIAVLIAVFF-LVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHK 549

Query: 548 LIYKTKV--IKSTDVDLYTFKEIY 569
           + +K+    I +  +DL + + +Y
Sbjct: 550 MYFKSWRFWIPAEKIDLDSHRNVY 573

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  235 bits (600), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 151/518 (29%), Positives = 253/518 (48%), Gaps = 24/518 (4%)

Query: 80  LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEM 139
           L + LK RH+ M                       P  +LI +     ++      LGE+
Sbjct: 83  LSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGEL 142

Query: 140 ASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNP 198
           A   P+ G + +YA+R++D + GFA  + Y+ +  ++ P ++ AA++ + YW +  +   
Sbjct: 143 AVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKL 202

Query: 199 GVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 258
             ++ +F VVIV+IN+ GV+ FGE E   S  K                   PDH+ +G 
Sbjct: 203 A-FVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGG 261

Query: 259 RYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKA 318
           +YW DPG F          + KF    +VFV + FS+ G EL G+  +E   PRKS+PKA
Sbjct: 262 KYWNDPGPFVG-----NAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKA 316

Query: 319 IKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHI 378
            K   +RI +FY+ ++ ++G+ V  N+  LL+ +   + AA SPFV+A+    I+VLP I
Sbjct: 317 AKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQ--QIDAAHSPFVIAMDMHRIRVLPSI 374

Query: 379 FNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLA 438
            N  +L  V S  NS +Y SSR + ALA  G  PKIF    + G P  A+  + LF  L 
Sbjct: 375 INVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLC 434

Query: 439 YMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRY 498
           ++  +    +IF++ + +  +    +W+TI + ++ F  A +AQG   ++ ++ +P    
Sbjct: 435 FVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFI 494

Query: 499 GAYFALSFCILIALIKNFTVFL--------GHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           G+ +A+   I + L+  F V L          K     F   Y+   V I+ +  +K+  
Sbjct: 495 GSCYAVGL-ICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWS 553

Query: 551 KTK--VIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
           +     IK+ ++D+ T +   D E      K++  +ER
Sbjct: 554 RNWKFFIKAKEMDIDTGRRELDLE----LFKEELAQER 587

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  233 bits (594), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/529 (30%), Positives = 247/529 (46%), Gaps = 24/529 (4%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           D ++ +K+ LK RHIS+                       P+A+L+ +  +GL+ F  M 
Sbjct: 37  DPHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIME 96

Query: 135 CLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            +GE+ +  P  G F + A R+    L    GY Y+  +F +  N+    + ++Q+W   
Sbjct: 97  SIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFW--G 154

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
            +V    +  IF    +   ++GV  FGE E+WL+ FK                   P  
Sbjct: 155 PQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSGGIPGK 214

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +GF+YW++PGA              F     VFV+    Y+G E   +  +E+ NPRK
Sbjct: 215 PPIGFQYWKNPGALSH----------GFRGIAVVFVFCSTFYSGTESVALAATESRNPRK 264

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           +VP A++ T +RI++ YL   F  G+ V YNDP L    G    +  SP  +A+  +G  
Sbjct: 265 AVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTL----GAQTKSLKSPISIALSRAGWA 320

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
              H+ NA +L+   SA NS LY+ SR L  LA +G AP+I A T K GVP  ALI+   
Sbjct: 321 GGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNA 380

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
              ++ MNVS G++  +NY VN+  +   + W  I I ++ F KA  AQG   S+  Y A
Sbjct: 381 LGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRA 440

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK 553
               +   F+L+  I +ALI+ +T  +   F  K F+  YI LP   L + G    +K +
Sbjct: 441 LFYPWTTIFSLAANIFLALIQGWTSLV--PFVAKDFVDAYILLPAAGLLYVGINF-WKNR 497

Query: 554 VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFL 602
             K+ ++     +E   R+ +E    D + E         M+     FL
Sbjct: 498 NFKTVNIHGINLEEGQRRDLDE----DSDDETGTAPKSTRMKAKLSSFL 542

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  233 bits (595), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 157/529 (29%), Positives = 261/529 (49%), Gaps = 38/529 (7%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DG   +  LK++LK+RH+ M                       P+AM+I ++  G  +  
Sbjct: 62  DGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVG 121

Query: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           T+  LGE+    P+ G F +Y++R +DP++ F +   Y+ +++ + P +L A+A+ +Q+W
Sbjct: 122 TIHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFW 181

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
            ++  V+P VW+ IF V++V++N+ GVK FGE EF  S  K                   
Sbjct: 182 TTK--VDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGG 239

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           PDH  +G  YW  PGA              F    +VFV + +S  G E+   +CS   +
Sbjct: 240 PDHRFIGTEYWHHPGALAN----------GFKGVASVFVTASYSLGGSEMV-CLCSAETD 288

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           P K +P AIK   +RI+ F+L ++ L+G  V Y +  LL       S   SPFV+AI+ S
Sbjct: 289 P-KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGS----SVNNSPFVIAIKLS 343

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           GI+VLP I NA +L+ + S  NS ++ SSR L ++A  G  P++F    + G P   +I+
Sbjct: 344 GIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIV 403

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + LF  LA++  S+    +F++ + +  +   + W++I I +I F  A +AQ     +  
Sbjct: 404 NSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELE 463

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFL-------GHKFDYKTFITGYIGLPVYILSW 543
           + +    YG+ ++ +  ILI LI  F + L         +   ++F   Y+   V +  +
Sbjct: 464 FKSSVGVYGSIYSATVNILI-LIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVF 522

Query: 544 AGYKLIYKTKVIKSTD------VDLYTFKEIYDREEEEGRIKDQEREER 586
             +K+ +K    K  D      +DL T     DR+  +  I  QE  ER
Sbjct: 523 VTHKIYFKCSTGKWFDFKPLAEIDLET-----DRKNIDIEIVKQEVRER 566

>YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}
           AGP2High affinity polyamine permease, preferentially
           uses spermidine over putrescine; expression is
           down-regulated by osmotic stress; plasma membrane
           carnitine transporter, also functions as a low-affinity
           amino acid permease
          Length = 596

 Score =  233 bits (594), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 142/518 (27%), Positives = 258/518 (49%), Gaps = 16/518 (3%)

Query: 78  TRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLG 137
           T  +++L+ RH+ +                       P ++L+A+A   + +        
Sbjct: 82  TETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTA 141

Query: 138 EMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRV 196
           EM  + P+   F   A++ VD +L     + + F   +  P ++ +   +I YW  RD  
Sbjct: 142 EMVCFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDY 199

Query: 197 NPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRL 256
           + G+ + + +V+ + I+I  VK++GE EFWL+SFK                   P+HDR 
Sbjct: 200 SAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFTFTFITMLGGNPEHDRY 259

Query: 257 GFR-YWRDPGAFKEY---STAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
           GFR Y   P  FK+Y      +  S+G F  F+A  + + F+  G E   ++  E + PR
Sbjct: 260 GFRNYGESP--FKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPR 317

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNSG 371
           K +PKA K    R+   +L +   +G+  + NDP L +   ++   A +SP+V+A+ N  
Sbjct: 318 KVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLK 377

Query: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431
           I++LP I N  ++   FSA N+  Y SSR  Y +A+DG APKIF + ++ GVP  ++ +S
Sbjct: 378 IRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAIS 437

Query: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491
           +++  ++ + ++S SA + N+ +N+++   +++++ + IVY++F +A   Q     K  +
Sbjct: 438 LVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPF 497

Query: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551
            + GQ Y A   L  C  + LI+ +TVF    ++ + F+  Y+ + + I  + GYK I+K
Sbjct: 498 RSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYLMVFINIGIYVGYKFIWK 557

Query: 552 TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQR 589
                    D +      D  +E   I++ E E   ++
Sbjct: 558 ------RGKDHFKNPHEIDFSKELTEIENHEIESSFEK 589

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  231 bits (590), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 162/526 (30%), Positives = 244/526 (46%), Gaps = 33/526 (6%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           D NT +K+ LK RHIS+                       P+++L+ +  +G++ F  M 
Sbjct: 39  DPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVME 98

Query: 135 CLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            +GEM +  P   GF++ + R+   AL    GY Y+  +F +  N+    + ++Q+W   
Sbjct: 99  SIGEMITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFW--- 155

Query: 194 DRVNPGV----WITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 249
               P V    +I IF V      ++GV  FGEFE+WL+ FK                  
Sbjct: 156 ---GPQVPLYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGG 212

Query: 250 XPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309
             +    GF YW +PGA  +           F     VFV+    Y+G E   +  +E+ 
Sbjct: 213 IKNRPAFGFHYWNNPGALAD----------GFKGIAVVFVFCSSFYSGTESVALAATESR 262

Query: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369
           NP K+VP AIK T +RII+ YL      G  V YND  L    G    A  SP  +AI  
Sbjct: 263 NPGKAVPIAIKQTFWRIIIVYLGIAVFYGATVPYNDTSL----GAHTKALKSPIAIAITR 318

Query: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429
           +G +   H+ NA +L+   SA N  LY+ SR L  LA +G APK    T K GVP  A+ 
Sbjct: 319 AGWEGGVHLVNAFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAIT 378

Query: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489
           L      ++ MNVS G++  ++Y VN+  +   + W  I + ++ F KA   QG   S+ 
Sbjct: 379 LFNALGLVSLMNVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASEL 438

Query: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549
            Y +    +G  F+L+  I + LI+ +T F+   F  K F+  YI LP  ++    Y +I
Sbjct: 439 PYKSLLFPWGPIFSLAANIFLGLIQGWTTFV--PFSAKDFVDAYILLPAAVIL---YIVI 493

Query: 550 YKTKVIKSTDVDLYTFKEIYDREEE---EGRIKDQEREERLQRNGK 592
              K+     VDL T      R E+   +G  +D E ++R  R+ K
Sbjct: 494 SLVKIGGFKLVDLRTVDLEEGRREDLDSDGTDEDSEGKDRSVRSAK 539

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  232 bits (592), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 156/531 (29%), Positives = 261/531 (49%), Gaps = 26/531 (4%)

Query: 70  IADGK---DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVG 126
           + DG+    + T+L++ ++ RH+ M                       P  +LI Y  V 
Sbjct: 50  LEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVS 109

Query: 127 LLVFFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAA 184
           ++ +  M   GEMA +Y  L G F +Y+S ++    GFA  + +  ++  + P +L  A 
Sbjct: 110 IVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITAT 169

Query: 185 LVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXX 244
           +VI+YW  +  VN  V++ IF + I+ I+  G + +GE EF  +  K             
Sbjct: 170 IVIKYW--KVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGIL 227

Query: 245 XXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGST-GKFTSFVAVFVYSLFSYTGIELTGI 303
                  D   +G RYWR+PG+F      ++G+   K      V V + FS+ G+EL  +
Sbjct: 228 INVGAIGDTGYIGDRYWRNPGSF------VSGTPLDKLKGTAYVLVTAYFSFGGMELYAL 281

Query: 304 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPF 363
             +E  NP+ ++P A K  VYRI++ YL T+ ++G  V ++  RL+ +   S     SP+
Sbjct: 282 SVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSG--SNDVHPSPY 339

Query: 364 VVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGV 423
           V+AI+  G+KVLPHI NA +L+ V S  NS +Y + R L ALA  G APK      + G 
Sbjct: 340 VLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGR 399

Query: 424 PYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQG 483
           P  +LIL  +F  +A+   S    KIF +   +  +  + +W +I + +  F +A + QG
Sbjct: 400 PLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQG 459

Query: 484 IDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVY 539
                  Y A   ++G+ +A+ F +L+  I  F V L      K D  +F   Y+  P++
Sbjct: 460 RSLETLGYRAITGQWGSLYAVFFNLLV-FIAQFWVALVPIAKKKVDVLSFFQNYMAFPLW 518

Query: 540 ILSWAGYKLIYKT-KVIKSTD-VDLYTFKEIYDRE---EEEGRIKDQEREE 585
           ++ + GY +  +   ++   D +DL T + +YD E   +EE   K++ R  
Sbjct: 519 LIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNS 569

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  231 bits (589), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 152/524 (29%), Positives = 255/524 (48%), Gaps = 20/524 (3%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
             T+LK+ + +RH+ M                       P  + I YA +G  ++  +  
Sbjct: 75  RETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQA 134

Query: 136 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GEMA SY  L G F +Y S  +DPALGF++ + Y  ++  + P +L  A + I+YW + 
Sbjct: 135 AGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTTA 194

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
             VNP V++ IF V+ V +N+ G + + E EF+ ++ K                    + 
Sbjct: 195 --VNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGND 252

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             LG +YW DPGA   Y T        F   +A  V + F++   E   +  +E  NPR+
Sbjct: 253 GYLGGKYWHDPGAL--YGTK---PIHHFKGIIATMVTAAFAFGATEFIALTAAEQANPRR 307

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIK 373
           ++P A K  VYR+++ +L  + LLG  V YN   L+ + G +  A  SP+V+AI + G+K
Sbjct: 308 AIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHA--SPYVIAIASHGVK 365

Query: 374 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVL 433
           V+PH  NA +L+ V S  NS  Y SSR L +L+    AP       + G P  A+++S +
Sbjct: 366 VVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCI 425

Query: 434 FCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 493
           F  +A++  S     +F + + +  +  + +WI I + +I F KA   QG    +  Y +
Sbjct: 426 FGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKS 485

Query: 494 PGQRYGAYFA--LSFCILIALIKNFTVFLG-HKFDYKTFITGYIGLPVYILSWAGYKLIY 550
                G+Y+A  +  C+L          +G  K D   F   Y+ +P+ I  + GY+ ++
Sbjct: 486 QTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYR-VW 544

Query: 551 KTK---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           K      I    +DL + ++++D  E+  + +D E EE ++ +G
Sbjct: 545 KRDWKLYIPLEQIDLVSHRKVFD--EDLLKQEDAEYEESIRNSG 586

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  231 bits (589), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 151/513 (29%), Positives = 257/513 (50%), Gaps = 19/513 (3%)

Query: 80  LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEM 139
           LK+ LK RH+ M                       P A+++A+   G +V+  +  +GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 140 ASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNP 198
              +P+ G + SY SR++DP+ GFAI Y YL    +  P ++ AA++ + YW    +   
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 199 GVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR-LG 257
           G ++ +F V ++ IN +GVK +GE EF  S  K                    ++   +G
Sbjct: 204 G-FVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIG 262

Query: 258 FRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPK 317
            +YW +PG F             F  F A+FV S FS++G E+  +  +E++NPR+ +PK
Sbjct: 263 TKYWHNPGGFAH----------GFKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPK 312

Query: 318 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPH 377
           A K   +RI +FYL ++ L+G  V Y +  L ++   S+ A+ASPFV+AI+ +GI  LP 
Sbjct: 313 AAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASS--SVDASASPFVIAIKEAGISGLPS 370

Query: 378 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCL 437
           + N  +LV V S  N+ ++ SSR   +LA  G  PK FA   + G P   LILS++F  L
Sbjct: 371 VINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLL 430

Query: 438 AYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQR 497
           ++++ S     +F + + V  +    +W +I + ++ F +  RAQG    + A+ A    
Sbjct: 431 SFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGI 490

Query: 498 YGAYFALSFCILIALIKNFTVF--LGHKFDYKTFITGYIGLPVYILSWAGYKLIYKT--K 553
           +G+ + ++   ++   + +     L        F   Y+ LPV I+ + G+K+  +    
Sbjct: 491 WGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRNWRL 550

Query: 554 VIKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
           VI + ++DL T +   D E  +  IK++    R
Sbjct: 551 VIPAKELDLDTGRREVDLELLKQEIKEENESIR 583

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  231 bits (588), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 158/521 (30%), Positives = 253/521 (48%), Gaps = 30/521 (5%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           DEN  L K +++RH+ M                       P+ ++I Y    L+VF  + 
Sbjct: 80  DEN-DLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQ 138

Query: 135 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             GE+   Y  + G FT Y +  VDPA GFAI + Y  ++ I+ P QL  AA+ IQ+W  
Sbjct: 139 AAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFW-- 196

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              VN  V++    VV+V IN+ G + + E EF+ +  K                   P+
Sbjct: 197 NVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPN 256

Query: 253 HDR--LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
                +G +YWR+PG F             F    +VF Y+ FSY G+E   +  +E +N
Sbjct: 257 GPDGYIGGKYWRNPGLFAN----------GFKGVCSVFCYAAFSYGGVETLVLSAAEQKN 306

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
           P KS+P A K  +YRI+  YL ++ ++   V Y  P L+ +      + +SPFV+AI + 
Sbjct: 307 PLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSS--GSGSHSSPFVIAIASH 364

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
           G+ V+PH+ NA +L+ V S  NS LYV+ R L +LA  G APK      K G P    ++
Sbjct: 365 GVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLV 424

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
            VLF  + ++  S     +F + +++  +  I  WI+I + +I F  A R QG   ++ A
Sbjct: 425 VVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIA 484

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAG 545
           Y A    +G+Y A++  + + L+  F V +       K D   F   Y+  PV + ++ G
Sbjct: 485 YKAQTGYWGSYVAIALALFV-LVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLG 543

Query: 546 YKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQERE 584
           +K+ YK    +I +  ++L   + +Y  EE    ++D+  E
Sbjct: 544 FKVYYKQWQLLIPADKIELDNNRNVYVPEEA---LEDKPLE 581

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  230 bits (587), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 162/545 (29%), Positives = 263/545 (48%), Gaps = 41/545 (7%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DG  + + LK+ LK RH+ M                       P+ +++ +   G  +  
Sbjct: 71  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 130

Query: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           T+  LGE+    P+ G F +Y +R++DP++ F +   Y+ ++F + P ++ AAA+ +QYW
Sbjct: 131 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 190

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
            S   ++P +W+ IF  VIV IN+ G + FGE EF  S+ K                   
Sbjct: 191 NSS--IDPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGG 248

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           PDH+ +G +YW DPG               F   +AV V + +S  GIE+T +  +  E 
Sbjct: 249 PDHEFIGAKYWHDPGCLAN----------GFPGVLAVLVVASYSLGGIEMTCL--ASGET 296

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
             K +P AIK   +RI+ F+L ++ L+G  V Y +  LL       S   SPFV+A++  
Sbjct: 297 DPKGLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGS----SVDNSPFVIAMKLH 352

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            IKVLP I NA +L+ V S  NS ++ SSR L ++A  G  P  F    + G P   ++ 
Sbjct: 353 HIKVLPTIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMA 412

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + LF  LA++  S   A +FN+ + +  +   + W++I + +I F  A +AQG    +  
Sbjct: 413 NSLFGLLAFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELE 472

Query: 491 YVAPGQRYG-AYFALSFCILIALIKNFTVFL-------GHKFDYKTFITGYIGLPVYILS 542
           +V+    +G AY AL  C++  LI  F   L         K   K F   Y+   + +  
Sbjct: 473 FVSAVGIWGSAYSALINCLI--LIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFI 530

Query: 543 WAGYKLIYKTKV-----IKS-TDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEW 596
           +  +K+ YK +      +KS  D+DL T     DR++ +  I  QE  ER + +  +  W
Sbjct: 531 FVVHKIYYKCQTGKWWGVKSLKDIDLET-----DRKDIDIEIIKQEIMER-KMHLDSRPW 584

Query: 597 FYEKF 601
           +  +F
Sbjct: 585 YVRQF 589

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score =  230 bits (587), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 140/508 (27%), Positives = 256/508 (50%), Gaps = 15/508 (2%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           +T  +++L+ RH+ +                       P ++L+A+A   + +       
Sbjct: 82  STETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVST 141

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
            EM  + P+   F   A++ VD +L     + + F   +  P ++ +   +I YW  RD 
Sbjct: 142 AEMVCFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDD 199

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
            + G+ + + +V+ + I+I  VK++GE EFWL+SFK                   P HDR
Sbjct: 200 YSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPRHDR 259

Query: 256 LGFR-YWRDPGAFKEY---STAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
            GFR Y   P  FK+Y      +  S+G F  F+A  + + F+  G E   ++  E + P
Sbjct: 260 YGFRNYGESP--FKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRP 317

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNS 370
           RK +PKA K    R+   +L +   +G+  + NDP L +   ++   A +SP+V+A+ N 
Sbjct: 318 RKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNL 377

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            I++LP I N  ++   FSA N+  Y SSR  Y +A+DG APK+F + ++ GVP  ++ +
Sbjct: 378 KIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVGI 437

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           S+++  ++ + ++S SA + N+ +N+++   +++++ + I+Y++F +A R Q     +  
Sbjct: 438 SLIWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRAYRVQQDSLPRLP 497

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           + + GQ Y A   L  C  + LI+ +TVF    +  + F+  Y+ + + I  + GYK I+
Sbjct: 498 FRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIW 557

Query: 551 ---KTKVIKSTDVDLYTFKEIYDREEEE 575
              K  +    D+D    KE+ + E  E
Sbjct: 558 KRGKDSLKNPHDIDFS--KELTEIENHE 583

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  231 bits (589), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 154/523 (29%), Positives = 252/523 (48%), Gaps = 23/523 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
            N  LK+ LK RH++M                       P  +LI Y  V +  +F +  
Sbjct: 95  SNAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVSVNTYFMVQA 154

Query: 136 LGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GE+A   P     F +Y S+ V    GFA  + +  ++  + P +L A    +++W +R
Sbjct: 155 AGELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMTFAVRFWTTR 214

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
             V+  V++ IF V +  ++ +GV+ +GE EF+L+ FK                    D 
Sbjct: 215 --VDADVFVLIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAICVAAGGAGDS 272

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             +G +YW DPGAF  ++     + G+F     V V + FSY G EL  +  +E ENPRK
Sbjct: 273 GYIGAKYWHDPGAFVSHT-----AEGRFKGVCYVLVSAYFSYGGTELFVLSVNEQENPRK 327

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTK-GKSMSAAASPFVVAIQNSGI 372
           ++P A K T+YRII  YL T+ L+G  V  N PRL+ +   K    + SP+V+A     +
Sbjct: 328 TIPTATKTTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVLAASYHHV 387

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           +VLPH  NA V++ + S  NS +Y + R + +LA  G  PK F    + G P  AL+L  
Sbjct: 388 RVLPHFINAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGRPTRALVLCF 447

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           +   +A+ + S     IF++   +  +  + +W +I++ ++ F  A + QG D ++  Y 
Sbjct: 448 IIGVIAFASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQGKDINELGYK 507

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYILSWAGYK 547
           +    +G+ + + F +L+     F V L     G K     F   Y+ LP+++  + G+ 
Sbjct: 508 SNTGVWGSAYGVFFSLLV-FAAQFWVALSAPNSGGKCSASDFFQSYLALPIWLTFYVGFM 566

Query: 548 LIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ 588
           L  +  T +I    VDL +++  YD E     +  QE EE  Q
Sbjct: 567 LWTRDFTFLIPLNKVDLDSYRRYYDPE-----LLRQEDEEHKQ 604

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  229 bits (584), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 154/527 (29%), Positives = 256/527 (48%), Gaps = 29/527 (5%)

Query: 69  AIADGKDEN---TRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFV 125
           A+ D +D +     L + L  RHI+M                       P ++ I Y  +
Sbjct: 43  AVTDLEDHDKIRESLNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIM 102

Query: 126 GLLVFFTMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAA 184
           G +V+ TM CLGEM++++P+ G F SYA ++   +  FA+   Y F   +   + LTA  
Sbjct: 103 GGVVYLTMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQ 162

Query: 185 LVIQYWISRDRVNPGVWIT--IFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXX 242
           LV+ YW S     P  W    +F V ++ +N++ V+ +GE E+WL+  K           
Sbjct: 163 LVLDYWKSSQHNFP-YWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILA 221

Query: 243 XXXXXXXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTG 302
                   PDH+ +GF+YW    ++KE +  + G    F  FV +FV S FSY G E   
Sbjct: 222 IVVNVGHNPDHEYIGFKYW----SYKE-APFVNG----FKGFVTIFVSSAFSYGGTESIT 272

Query: 303 IVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASP 362
           +   EA NP ++ P+ +K   +RI++FY+ T+F + M + Y+ P  LSTK    S   SP
Sbjct: 273 LTAGEARNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPN-LSTK----SVMTSP 327

Query: 363 FVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKA-PKIFAKTSKW 421
           F +  Q +G K      NA +L  + SA N  L+  SR LY + ++G   PK+  KT+++
Sbjct: 328 FTIIFQMAGTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRY 387

Query: 422 GVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 481
             PY A+IL+     L +     G+  ++ +  N+V +   ++W++I +  I F K    
Sbjct: 388 RAPYVAVILTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQ 447

Query: 482 QGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIL 541
           QG    +  +      YG YF + F  LI L++ ++ F    +    F + Y+ L V+  
Sbjct: 448 QG-KTQELQFKNWTYPYGPYFLVIFVTLIILVQGWSAF--DPWSTSDFFSYYLELFVFPT 504

Query: 542 SWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ 588
            W  + +  + + +K  D+D  T + I   +E    I++ ER + L+
Sbjct: 505 CWLIWWIFKRDRFVKPEDMDFITDRYIQSPQE----IEENERLDNLE 547

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  230 bits (586), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 158/530 (29%), Positives = 256/530 (48%), Gaps = 40/530 (7%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DG  + + LK+ LK RH+ M                       P+ ++I +A  G  +  
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIG 129

Query: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           T+  LGE+    P+ G F +Y +R++DP++ F +   Y+ ++F + P ++ AAA+ +QYW
Sbjct: 130 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                ++P +W+ IF  VIV+IN+ GV+ FGE EF  S+ K                   
Sbjct: 190 --NSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGG 247

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           PDH+ +G +YW DPG               F   ++V V + +S  GIE+T +  +  E 
Sbjct: 248 PDHEFIGAKYWHDPGCLAN----------GFPGVLSVLVVASYSLGGIEMTCL--ASGET 295

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
             K +P AIK   +RI+ F+L ++ L+G  V Y +  LL       S   SPFV+AI+  
Sbjct: 296 DPKGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGS----SVDNSPFVIAIKLH 351

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            IK LP I NA +L+ V S  NS ++ SSR L ++A  G  P  F    + G P   ++ 
Sbjct: 352 HIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMA 411

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + LF  LA++  S   +++FN+ + +  +   + W++I + +I F  A +AQG    +  
Sbjct: 412 NSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELE 471

Query: 491 YVAPGQRYG-AYFALSFCILIALIKNFTVFL-------GHKFDYKTFITGYIGLPVYILS 542
           +V+    +G AY AL  C++  LI  F   L         K   K F   Y+   + +  
Sbjct: 472 FVSAVGIWGSAYSALINCLI--LIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFI 529

Query: 543 WAGYKLIYKTKVIK------STDVDLYTFKEIYDREEEEGRIKDQEREER 586
           +  +K+ YK +  K        D+DL T     DR++ +  I  QE  E+
Sbjct: 530 FIVHKIYYKCQTGKWWGVKALKDIDLET-----DRKDIDIEIVKQEIAEK 574

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  230 bits (586), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 153/530 (28%), Positives = 260/530 (49%), Gaps = 40/530 (7%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DG  + + LKK LKARH+ M                       P+A++I +A  G  +  
Sbjct: 78  DGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIG 137

Query: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           T+  LGE+    P+ G F +Y++R++DP++ F +   Y+ ++F + P ++ ++A+ +QYW
Sbjct: 138 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYW 197

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
              + ++P VW+ IF V IV+IN+ GV+ FGE EF  S+ K                   
Sbjct: 198 --NESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGG 255

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           PDH  +G RYW +PG               F   ++V V + +S  G E+T +   E + 
Sbjct: 256 PDHVYVGSRYWHNPGCLAN----------GFPGVLSVMVVASYSLGGTEMTCLASGETDP 305

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
             K +P AIK   +RI+ F+L ++ L+G  V Y +  LL       S   SPFV+AI+  
Sbjct: 306 --KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGS----SVDNSPFVIAIKIH 359

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            IKVLP I NA +L+ + S  NS ++ SSR L ++A     P  F    + G P   +I 
Sbjct: 360 HIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIIT 419

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + LF  LA++  S   +++F++ + +  +   + W++I + +I F  A +AQG   ++  
Sbjct: 420 NSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELE 479

Query: 491 YVAPGQRYGA-YFALSFCILIALIKNFTVFL-------GHKFDYKTFITGYIGLPVYILS 542
           +V+    +G+ Y A+  C++  L+  F + L         +   K F   Y+   + +  
Sbjct: 480 FVSAVGIWGSVYSAIINCLI--LVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCI 537

Query: 543 WAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGR------IKDQEREER 586
           W G+K+ Y  +  K     ++ F  + + + +EGR      +  QE  ER
Sbjct: 538 WIGHKIYYWRQTGK-----IWAFTPLAEIDLDEGRKNIDLDVLKQEIHER 582

>ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 836

 Score =  234 bits (596), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 155/558 (27%), Positives = 267/558 (47%), Gaps = 60/558 (10%)

Query: 73  GKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFT 132
           G  ++  ++++L+ RHI M                       P   L+ ++  G +V  T
Sbjct: 255 GTGDSHHIQRKLRVRHIQMIGIGACLGVGIFLTSGKAFSIAGPFGTLLGFSLSGSIVLAT 314

Query: 133 MACLGEMASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191
           +    E+++ IPL  GF+  ASR+V+ A GFA+G+TY F   I  P Q+ A    ++Y+ 
Sbjct: 315 LLSFTELSTLIPLSSGFSGLASRFVEDAFGFALGWTYWFSCMITMPTQVVACTFYLKYFD 374

Query: 192 SRDRVNPGV---WITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 248
           S + +N G    + T+F++  V +N++ V+  GE  +     K                 
Sbjct: 375 SLN-LNKGAIAGFATLFMLYAVLVNLLDVRLMGEIVYITGLIKIIISIIMILAMVILNSG 433

Query: 249 XXPDHDRLGFRYWRDP--------GAFKEY----------STAITGSTGKFTSFVAVFVY 290
               +DR+GFR+W           G F+            +  I GS G+F +  +  + 
Sbjct: 434 TGTKYDRVGFRFWDSSKSSSNLTYGLFRPTFDLNDIGDGSTKGIEGSGGRFLALASTMLI 493

Query: 291 SLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRL-- 348
           S F+YTG+E+  +   EA NPRK++P A K T   ++V Y+ T+F + + +   DPRL  
Sbjct: 494 STFAYTGVEMAFVASGEAINPRKTIPSATKRTFCIVLVIYVFTIFSVSINIYCGDPRLQP 553

Query: 349 ----------------------LSTKGKS---------MSAAASPFVVAIQNSGIKVLPH 377
                                 LS K  +         +   +SP+V+A+QN G+     
Sbjct: 554 YFTGSYSARYQAVQRGVGSQWQLSHKCHTNIPYSTKDPVDHNSSPWVLALQNFGLCTFAA 613

Query: 378 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCL 437
           +FN  ++ F   A  S L+ SSR LY++A+  KAP IF + +K GVPY ++I S +F  +
Sbjct: 614 VFNGILIFFTSGAEISSLFSSSRTLYSMAVQRKAPTIFQRCNKRGVPYVSVIFSGMFGVV 673

Query: 438 AYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ----GIDKSKFAYVA 493
            Y+ V SG+ + FN   N+ S    + W+ + + ++ F  A + +      D+  + Y +
Sbjct: 674 GYLAVDSGAVENFNVLSNMSSASTSIIWMGLNVSFLRFYYALKTRRDIISRDEKSYPYRS 733

Query: 494 PGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTK 553
           P Q Y A++ L  C L  +   FT F+ H ++ K+F + Y GL ++++ + GYK+I  +K
Sbjct: 734 PFQPYLAFYGLFGCCLFIIFMGFTNFIHHFWNVKSFFSAYGGLILFVVCYLGYKMIGTSK 793

Query: 554 VIKSTDVDLYTFKEIYDR 571
           + +   +D+ T +   DR
Sbjct: 794 IQRLDQLDMDTGRREMDR 811

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  229 bits (584), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 150/544 (27%), Positives = 253/544 (46%), Gaps = 32/544 (5%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
            E   L + +K+RH+ M                       P  +++ Y    ++++  + 
Sbjct: 85  QERNNLTRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQ 144

Query: 135 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             GE+   Y  L G +T Y+S  VDP+LGFA+   Y  ++  + P QL  AA+ I+YW +
Sbjct: 145 AAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTIKYWTN 204

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
              VN  +++    + ++ IN+ G K + E EF  +  K                    D
Sbjct: 205 ---VNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGFVILAIVINCGGAGD 261

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G +YW +PG F             F     VF Y+ FSY GIE+  +  +E ENP 
Sbjct: 262 RKFIGTKYWHNPGPFAH----------GFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPT 311

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           KS+P A K  VYRI+  Y+ T  L+   V YN   LL +   S  + ASPFV+A+ + G+
Sbjct: 312 KSIPNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSG-SSSGSHASPFVIAVASHGV 370

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           KV+PH  NA +L+ V S  NS LY + R L +LA  G  PK  A   + G P    ++S+
Sbjct: 371 KVVPHFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGRPLLCFLVSI 430

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           +F C+ ++  S    ++F + + + S+  +  W+++ + +I F  A   QG    +  Y 
Sbjct: 431 IFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMDEVGYK 490

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGYK 547
           A    +G++ A+    L  L+  F V +       K D   F   Y+ +P+ + ++ G+K
Sbjct: 491 AQTGYWGSWLAV-LIALFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAMPIVLFAYFGHK 549

Query: 548 LIYKTKV--IKSTDVDLYTFKEIY-------DREEEEGRIKDQEREERLQR-NGKNMEWF 597
           +  K+    I +  +DL + + IY         + ++  +K+ E  E  +  NG     F
Sbjct: 550 IYTKSWKFWIPAEKIDLDSHRTIYVPPILMGTNKIDDDDLKEYETSESSENPNGSGSRKF 609

Query: 598 YEKF 601
           +++ 
Sbjct: 610 FKRM 613

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  228 bits (582), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 152/580 (26%), Positives = 272/580 (46%), Gaps = 41/580 (7%)

Query: 20  NDHDAYYSKQDADNFPVKEQEIYNI-DLEENNVXXXXXXXXXXXXXXXXFAIADGKDENT 78
           + H     ++  D+F   E E+ N  DLE+  V                         +T
Sbjct: 31  DGHRDGLFQRIVDSFKRVEGEVRNSSDLEDGEVTSA---------------------HST 69

Query: 79  RLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGE 138
           +LK+ +K RH+ +                       P  +LI Y FV ++ +  M   GE
Sbjct: 70  KLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQAAGE 129

Query: 139 MA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRV 196
           MA +Y  L G F +Y+S ++    GFA  + +  ++  + P +L  +++V++YW ++  +
Sbjct: 130 MAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTTK--I 187

Query: 197 NPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRL 256
           N  +++ IF + I+ I+  G + +GE EF  +S K                    D   +
Sbjct: 188 NADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDDGYI 247

Query: 257 GFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVP 316
           G +YW +PGAF     A      +F     V V + FSY G+EL  +  +E  NPRK++P
Sbjct: 248 GGKYWHEPGAF-----AAGSGIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPRKAIP 302

Query: 317 KAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLP 376
            A    VYRI++ Y+ T+ ++G  V ++  +LL +   S     SP+V+A+   GIK++P
Sbjct: 303 SACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSG--SSGVHPSPYVLALSLHGIKIVP 360

Query: 377 HIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCC 436
           HI NA +L+ V S  NS +Y   R L +LA  G APKI     + G P  ALI+  +F  
Sbjct: 361 HIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSVFGL 420

Query: 437 LAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQ 496
           +A++  S     IF +   +  +  + +W  I + +  F +A + QG       Y +   
Sbjct: 421 IAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRSTTG 480

Query: 497 RYGAYFALSFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYILSWAGYKLIYKT 552
            +G+ +A+ F + + + + +   +    G KF  K+     + LP+++    GY ++ K 
Sbjct: 481 EWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSCLALPLWLSMAVGYMIVTKN 540

Query: 553 KVIKS--TDVDLYTFKEIYDREEEEGRIKDQEREERLQRN 590
             I +  + + + + +  YD E    + +D E +++++R+
Sbjct: 541 WTILNPLSSISVDSHRRSYDVEVM--KQEDLEYKQKMKRS 578

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  228 bits (582), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 157/529 (29%), Positives = 257/529 (48%), Gaps = 38/529 (7%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DG      LKK LK+RH+ M                       P+A++I +A  G  +  
Sbjct: 70  DGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVG 129

Query: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           T+  LGE+    P+ G F SY +R++DP++ F +   Y+ ++F + P ++ A+A+ +QYW
Sbjct: 130 TIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYW 189

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
              D ++P V++ IF  VIV+IN+ G + FGE EF  S+ K                   
Sbjct: 190 --NDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGG 247

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           PDH+ +G +YW +PG+              F   ++V V + +S  G E+T +   E + 
Sbjct: 248 PDHEYIGAKYWHNPGSLAH----------GFKGVLSVLVVASYSLGGTEMTCLASGETD- 296

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
             K +P AIK   +RI+ F+L ++ L+G  V Y +P LL       S   SPFV+AI+  
Sbjct: 297 -PKELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGS----SVDNSPFVIAIKIH 351

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            IKVLP I NA +LV + S  NS ++ SSR L ++A     P  F    + G P   +I+
Sbjct: 352 NIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIII 411

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + LF  LA++  SS   ++F++ + +  +   + W++I I ++ F  A +AQ     +  
Sbjct: 412 NSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELE 471

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFL---GHKFDY----KTFITGYIGLPVYILSW 543
           +V+    +G+ ++     LI L+  F + L   G   D     K F   Y+   + I+ +
Sbjct: 472 FVSAVGIWGSVYSGIVNALI-LVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVLF 530

Query: 544 AGYKLIYKTKV------IKSTDVDLYTFKEIYDREEEEGRIKDQEREER 586
            G+K+ Y+         I   D+DL T     DR+  +  I  QE  E+
Sbjct: 531 IGHKIYYRVTTGHWWEYIALKDIDLDT-----DRKNVDIEIIKQEIHEK 574

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  229 bits (583), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 159/523 (30%), Positives = 259/523 (49%), Gaps = 25/523 (4%)

Query: 79  RLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGE 138
            LK+ +K RH+ M                       P  ++  YA +G  V+  +   GE
Sbjct: 109 NLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGE 168

Query: 139 MAS-YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRV 196
           MA  Y  L+G F +Y +  V+P          LF         +       +YW +R  V
Sbjct: 169 MAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTR--V 226

Query: 197 NPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRL 256
           +P V++ IF V+I+ IN+ G + + E EF+ +  K                    +   L
Sbjct: 227 DPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYL 286

Query: 257 GFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
           G  YWR+PGAF+       G  G   F   VA  V + F++ G E   +  +E  NPRK+
Sbjct: 287 GNIYWRNPGAFR-------GDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKA 339

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374
           +P A K  +YRI++ YL ++ L+G  V +  P LL +   S + AASP+V+A+ + G++V
Sbjct: 340 IPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSG--SAATAASPYVIAVASHGVRV 397

Query: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434
           +PH  NA +L+ V S  NS  Y SSR L +L+  G APK F    + G P  A+I+S LF
Sbjct: 398 VPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALF 457

Query: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494
             +A+   S    ++F + + +  +  I +WI+I + +I F  A +AQG    +  + A 
Sbjct: 458 GVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQ 517

Query: 495 GQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYKLIY 550
              +G+Y+++ F +++ LI  F V +      +   + F   Y+ +P+ I  + GYK+  
Sbjct: 518 TGIWGSYYSI-FLMILTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWK 576

Query: 551 K--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
           K  T  IK+ D+DL + ++I+D  EE  + +D E +E+L +NG
Sbjct: 577 KDWTLYIKAEDIDLISHRQIFD--EELLKQEDYELKEKL-KNG 616

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  228 bits (580), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 157/545 (28%), Positives = 264/545 (48%), Gaps = 41/545 (7%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DG  + + LK+ LK RH+ M                       P+ +++ +   G  +  
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 129

Query: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           T+  LGE+    P+ G F +Y +R++DP++ F +   Y+ ++F + P ++ AAA+ +QYW
Sbjct: 130 TVHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
            S   ++P +W+ IF  VIV+IN+ G + FGE EF  S+ K                   
Sbjct: 190 NSS--IDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGG 247

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           PDH+ +G +YW DPG               F   ++V V + +S  GIE+T +  +  E 
Sbjct: 248 PDHEFIGAKYWHDPGCLAH----------GFPGVLSVLVVASYSLGGIEMTCL--ASGET 295

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
             K +P AIK   +RII F+L ++ L+G  V Y +  LL       S   SPFV+AI+  
Sbjct: 296 DPKGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGS----SVDNSPFVIAIKLH 351

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            IKVLP I NA +L+ V S  NS ++ SSR L ++A  G  P  F    + G P   ++ 
Sbjct: 352 HIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMA 411

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + LF  LA++  S   +++FN+ + +  +   + W++I + ++ F  A +AQG    +  
Sbjct: 412 NSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELE 471

Query: 491 YVAPGQRYGA-YFALSFCILIALIKNFTVFL-------GHKFDYKTFITGYIGLPVYILS 542
           +V+    +G+ Y AL  C++  LI  F   L         K   K F   Y+   + +  
Sbjct: 472 FVSAVGIWGSVYSALINCLI--LIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFI 529

Query: 543 WAGYKLIYKTKVIK------STDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEW 596
           +  +K+ Y+ ++ K        D+DL T     DR++ +  I  QE  E+ ++   +  W
Sbjct: 530 FVIHKIYYRCQMGKWWGVKELKDIDLET-----DRKDIDIEIVKQEIAEK-KKYLDSRPW 583

Query: 597 FYEKF 601
           +  +F
Sbjct: 584 YVRQF 588

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  229 bits (583), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 153/523 (29%), Positives = 264/523 (50%), Gaps = 25/523 (4%)

Query: 76  ENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMAC 135
           +   LK+++  RH+                         P  +LI YA +G  V+  +  
Sbjct: 113 KKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQA 172

Query: 136 LGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 193
            GE+  +Y  L  GF +Y +  V P+  F++G+ Y  ++  + P +L  A+L I+YW ++
Sbjct: 173 AGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTK 232

Query: 194 DRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 253
             V+P V++ IF ++I+ IN  G K + E +F+ +  K                      
Sbjct: 233 --VDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHD 290

Query: 254 DRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 313
             LG +YW +PGAF+        +   F    +VFV S F++ G E   +  SE  NPRK
Sbjct: 291 GYLGGKYWHNPGAFRGEK-----AIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRK 345

Query: 314 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLL-STKGKSMSAAASPFVVAIQNSGI 372
           S+P A KL +YRII  YL ++ +LG  V ++ P+L  S+ GK      SP+VVAI   G+
Sbjct: 346 SIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKK----TSPYVVAIAMHGV 401

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           KV+PH+ NA +L+ V S  NS  + SSR L +L+  G APK F    + G P  A+++S 
Sbjct: 402 KVVPHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISA 461

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           LF  + +   S     +F++ + +  +  I ++ +I + +I    A + QG    +  + 
Sbjct: 462 LFGVICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFR 521

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYILSWAGYKL 548
           +    YG+++A    ++++L+  F V L      K D ++F   Y+  P+ I+ + GY +
Sbjct: 522 SQVGTYGSFYA-CLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGY-M 579

Query: 549 IYKTK---VIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ 588
           I+K      I+S D+DL   ++++D  E+  + +D+E  E+++
Sbjct: 580 IWKKDFRIFIRSKDIDLDFKRQVFD--EDLIKQEDEEYAEQMR 620

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  227 bits (579), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 153/562 (27%), Positives = 264/562 (46%), Gaps = 17/562 (3%)

Query: 36  VKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAIADGKDENTRLK------KELKARHI 89
           VK Q++   DL+                      + D +D ++ L       + LK RH+
Sbjct: 12  VKFQQLDTNDLDSVRTTIVESSVKPAKKTDWLGCVTDDEDSSSDLLYSTQTFRRLKNRHV 71

Query: 90  SMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACLGEMASYIPLDG-F 148
            +                       P  +LIA+A   + +        EM  ++P+   F
Sbjct: 72  QLIAISGVIGTALFVAIGKALYKGGPAFLLIAFALWCVPILCITVSTAEMVCFLPVSSPF 131

Query: 149 TSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVV 208
              A+R  D +L     + + F   +  P ++ +   +I YW  RD  +  + + + +V+
Sbjct: 132 LRLAARCADDSLAVMASWNFWFLQCVQIPFEIVSVNTIIHYW--RDDYSAAIPLVVQIVL 189

Query: 209 IVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWRDPGAFK 268
              I+I  VK++GE EFWL+SFK                   P HDR GFRY+ +   FK
Sbjct: 190 YFLISICAVKYYGETEFWLASFKIILALGLFLFTFITMLGGNPKHDRYGFRYYGET-PFK 248

Query: 269 EY----STAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVY 324
           +Y          S G F  F+A  + + F+  G E   ++  E + PRK +P+A K   Y
Sbjct: 249 KYYPNGDKDAGASVGYFQGFLACLIQASFTIAGGEYISMLAGEVKLPRKVLPRAFKQVFY 308

Query: 325 RIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNSGIKVLPHIFNACV 383
           R+   +L +   +G+  + NDP L +   +S   A +SP+V+A+ N GIKVLP I NA +
Sbjct: 309 RLTFLFLGSCLCVGIICSANDPALTAAIDESRPGAGSSPYVIAMNNLGIKVLPDIVNAAL 368

Query: 384 LVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLAYMNVS 443
           +   FSA N+  Y SSR LY +A+DG AP+IF + +K GVP  ++++S+L+  ++ + ++
Sbjct: 369 ITAAFSAGNAYTYCSSRTLYGMALDGYAPRIFTRCNKHGVPIYSVLISLLWGLISLLQLN 428

Query: 444 SGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFA 503
             SA + N+ +N+++   ++++  + I+Y++F +A         K  + + GQ Y A   
Sbjct: 429 DNSAVVLNWLINLITASQLINFTVLCIIYLFFRRAYLLHKDILPKLPFKSWGQPYTAIVG 488

Query: 504 LSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKVIKSTDVDLY 563
           L     + LI+ +TVF    +  + F+  Y+ + + I  + GYK I++    K  D    
Sbjct: 489 LVSATAMILIQGYTVFFPSLWTVRDFLFCYLMVFIDIGIYIGYKFIWRRGRDKFKDPKTV 548

Query: 564 TFKEIYDREEEEGRIKDQEREE 585
            F +  D +E E    D   E+
Sbjct: 549 DFSK--DLKEIESHEVDHSFEK 568

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  228 bits (581), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 152/526 (28%), Positives = 247/526 (46%), Gaps = 21/526 (3%)

Query: 75  DENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMA 134
           +E+T LKK +K+RH+ M                       P  ++I Y  V  + +F + 
Sbjct: 92  NESTELKKAMKSRHVVMMSLGTGIGTGLLVANAKGLAISGPAPLVIGYGLVSFITYFMIQ 151

Query: 135 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 192
             GE+  +Y  L G F  Y    V    GFA  +    ++  + P +L   A+ I+YW  
Sbjct: 152 AAGELGVTYASLPGNFNVYFGTLVSRPFGFATVWLASVQWLTVIPLELITCAITIKYW-- 209

Query: 193 RDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 252
            ++VN  +++ I  V ++ I+I GVK +GE EF  ++ K                    +
Sbjct: 210 TEKVNGDIFVLIIYVFLLFIHIFGVKAYGEAEFLFNTCKILMIAGFIILSIVINVGGAGN 269

Query: 253 HDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPR 312
              +G  YW +PGAF   + A      +F S   + V   FSY G EL  +  +E ENPR
Sbjct: 270 DGYIGGSYWNNPGAFASDNAA-----SRFKSICYILVTGYFSYGGTELFVLSVNEQENPR 324

Query: 313 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 372
           KS P+A K ++YRI+V YL T+ L+G  V ++  +L+ + G S  A ASP+V+A    G+
Sbjct: 325 KSTPQAAKHSIYRILVIYLLTMILIGFNVPHDSDQLMGSAGSS--AHASPYVLAASLHGV 382

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
           KV+PH  NA +L+ + S  NS LY + R + +LA  G APK      + G P   + +  
Sbjct: 383 KVVPHFINAVILIALISVANSSLYAAPRMMVSLAQQGFAPKFLTYVDREGRPLLGIAVCA 442

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
           +F  + +   S     +F +   +  +  + +W    + +I F +A + QG +  +  Y+
Sbjct: 443 VFGVIGFAASSDKEEDVFTWLAAIAGLSELFTWSAFFLSHIRFRQAMKVQGKNIKECGYL 502

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYILSWAGYK 547
           +    +G+   L F IL+  I  F V L       K D + F   Y+  P+++  + G  
Sbjct: 503 SVTGIWGSIIGLCFNILV-FIAQFWVALSPIGNDGKCDAQAFFQSYLAFPIWLAFYFGCM 561

Query: 548 LIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
             YK  T +     +DL   + IYD EE   + +D   +  L+R G
Sbjct: 562 FYYKDYTLLNPLESIDLDDHRRIYDPEEL--KKEDLATKAELKRRG 605

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  227 bits (579), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 158/524 (30%), Positives = 251/524 (47%), Gaps = 39/524 (7%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           N   +K L  RH+SM                       P A+LI Y  VG  +F  +   
Sbjct: 67  NQPYQKVLHQRHLSMIAIGGTLGTGLFIGLGAALTSG-PAALLIGYLLVGTSMFCVIQSA 125

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
            E+A   P+ G + S+ SR+VD +LGF +   Y   + +L P++L   +L I YW S   
Sbjct: 126 AELACQFPVSGSYASHVSRFVDESLGFTVATNYTLAWLVLFPSELIGCSLTISYWNSS-- 183

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
           +NP VW++IFLV ++ IN+ GV+ F E EF LS  K                   PD   
Sbjct: 184 INPAVWVSIFLVFVLWINLFGVRIFAETEFILSIIKVLAIIIFIIIGIVLIAGGGPDPGG 243

Query: 256 -LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G +YW DPG F +           F +    FV + FS+ G E+  +  +E++N   S
Sbjct: 244 YIGTKYWHDPGPFAK---------PVFKNLCQTFVAAAFSFGGTEMVLLTGTESKN-VSS 293

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI-- 372
           + +A K T YRI +FY+ TV ++G  V YNDPRLLS    S   +ASPFV+A+ N+G   
Sbjct: 294 IARAAKGTFYRIAIFYVTTVVVIGCLVPYNDPRLLSAS-SSEDISASPFVIALSNTGSMG 352

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
             + H  NA +LV V S CNS +Y SSR + AL   G+ PKIF    + G P   + +S 
Sbjct: 353 AKVSHFMNAVILVAVVSVCNSTVYASSRLIQALGTAGQLPKIFGYMDRKGRPLVGIAVSA 412

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
            F  L ++  +   +++F +   + S+   ++W +I +  + +  A RA+       AY 
Sbjct: 413 TFGLLGFLVATKKQSEVFTWLFALCSVAAFVTWFSICLAQVRYRMAMRARKRSLDSIAYK 472

Query: 493 APGQRYGAYFALSFCILIALIKNFTVFLGHKF------DYKTFITGY----IGLPVYILS 542
           +    +G         ++  I NF +  G  +      + K+   G+    + +P+ I+ 
Sbjct: 473 SILGIWGG--------VVGCIVNFLLVAGEVYVSAFPANAKSSAEGFFKYTLSIPIMIVV 524

Query: 543 WAGYKLI---YKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQER 583
           + G+K+    +    +K  D+DL T   I D E  + + + ++R
Sbjct: 525 FLGHKIHRNDWGNWYVKRKDMDLDTGCSIEDFELFQAQKEAEKR 568

>SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {ON}
           similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 558

 Score =  226 bits (576), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 152/518 (29%), Positives = 259/518 (50%), Gaps = 15/518 (2%)

Query: 71  ADGKDEN--TRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 128
           A  +D +  T   ++L+ RH+ +                       PV +L+ ++   + 
Sbjct: 33  AKDRDSSIPTSTHRKLQNRHVQLIGISGVIGTALFVSIGRALYHGGPVFLLLGFSLWCIP 92

Query: 129 VFFTMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 187
           +        EM  Y+P    F   ASR VD +L     + + F   +  P ++ A   +I
Sbjct: 93  ILCITVSTAEMVCYMPFSSPFLRIASRCVDNSLAIMASWNFWFLECVQIPFEIVAVNTMI 152

Query: 188 QYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 247
            YW  RD  +  + + + +V+ +AI++  V+++GE EFWL+SFK                
Sbjct: 153 HYW--RDDYSAAIPLVVQVVLYLAISVFAVRYYGEMEFWLASFKIFLAIGLFFFTFITML 210

Query: 248 XXXPDHDRLGFRYWRDPGAFKEY----STAITGSTGKFTSFVAVFVYSLFSYTGIELTGI 303
              P HDR GFR ++D   FKEY       +  S G F  F+A  + + F+  G +   +
Sbjct: 211 GGNPKHDRYGFRNFKDL-PFKEYFPNNDKTVGSSAGYFQGFLACLIQASFTIAGPDYVSM 269

Query: 304 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASP 362
           +  E   PRK +P A K    R+ V +L     +G+  + NDP L +   +    A ASP
Sbjct: 270 IAGETLLPRKVLPIAFKQVFVRLTVLFLGGCLCIGIVCSANDPNLTAAITEDRPGAGASP 329

Query: 363 FVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWG 422
           +V+A+ N GIKVLP I NA ++   FSA N+  Y SSR LY +A+DG APK+F++ ++ G
Sbjct: 330 YVIAMNNLGIKVLPDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPKVFSRCNRHG 389

Query: 423 VPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 482
           VP  A+ +S+L+  L+ + +   SA + N+ VN+++   ++++  + +VY++F +A  AQ
Sbjct: 390 VPIFAVAVSLLWALLSLLQLGKNSAVVLNWLVNLITASQLINFGVLCVVYLFFRRAYMAQ 449

Query: 483 GIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILS 542
             +  +  + +  Q Y A   L    ++ +++ +TVF    ++Y++F+  Y+ + V I  
Sbjct: 450 RDNLPELPFKSWWQPYPAIIGLVSVSVMTIVQGYTVFFKTLWNYESFLFSYLMIFVDIFI 509

Query: 543 WAGYKLIY---KTKVIKSTDVDLYT-FKEIYDREEEEG 576
           + G+K +    K  V +  DVDL T   EI   E E G
Sbjct: 510 YLGHKFVINYGKDPVKRPQDVDLITGLYEIEIHELENG 547

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  226 bits (576), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 157/544 (28%), Positives = 265/544 (48%), Gaps = 41/544 (7%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DG  + + LK+ LK+RH+ M                       P+A++I +   G  +  
Sbjct: 55  DGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVG 114

Query: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           T+  LGE+    P+ G F  Y++R++DP++ F +   Y+ ++F + P ++ A+A+ IQYW
Sbjct: 115 TIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYW 174

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
                ++P VW+ IF  VIV+IN+ G + FGE EF  S+ K                   
Sbjct: 175 --NSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGG 232

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           PDH+ +G +YW DPGA              F   ++V V + +S  G E+T +   E + 
Sbjct: 233 PDHEFIGAKYWHDPGALAH----------GFPGVLSVLVVASYSLGGTEMTCLASGETDP 282

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
             K +P AIK   +RI+ F+L ++ L+G  V Y +  LL       S   SPFV+AI+  
Sbjct: 283 --KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGS----SVDNSPFVIAIKLH 336

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            IK LP I NA +L+ + S  NS ++ SSR L ++A  G  P+ F    + G P   ++ 
Sbjct: 337 HIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVT 396

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + LF  LA++  SS  +++F++ + +  +   + W++I + +I F  A +AQ     +  
Sbjct: 397 NSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELE 456

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFL---GHKFDY----KTFITGYIGLPVYILSW 543
           +V+    +G+ ++    +LI LI  F + L   G   D     K F   Y+   + +L +
Sbjct: 457 FVSAVGIWGSAYSALINVLI-LIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIF 515

Query: 544 AGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGR-------IKDQ--EREERLQRNGKNM 594
             +K+ Y+    K  DV     K + D + E GR       IK +  ER+  L++    +
Sbjct: 516 CIHKVYYRVSFGKWWDV-----KPLKDIDLETGRKNVDIDVIKAEIAERKMYLKKKPWIV 570

Query: 595 EWFY 598
            W++
Sbjct: 571 RWYH 574

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  226 bits (576), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 145/532 (27%), Positives = 262/532 (49%), Gaps = 33/532 (6%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           DG  +   LK+ LK+RH+ M                       P+A+LI +   G  +  
Sbjct: 60  DGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVG 119

Query: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190
           T+  LGE+    P+ G F +Y++R++DP++ F +   Y+ ++F + P ++ A+A+ +++W
Sbjct: 120 TIHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFW 179

Query: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 250
            +   V+P VW+ +F  +I++IN+ GV++FG+ +F  S  K                   
Sbjct: 180 TTS--VDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGG 237

Query: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310
           P H+ +G RYW DPGA              F    AV V + +S  G E+T +   E + 
Sbjct: 238 PTHEFIGARYWHDPGALAN----------GFKGVAAVMVTASYSLGGSEMTCLASGETDP 287

Query: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370
             K +P AIK   +RII F+L ++ L+G  V Y + +LL       +   SPFV+AI+  
Sbjct: 288 --KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGS----NVNNSPFVIAIKMH 341

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            I+VLPHI N  +LV + S  NS ++ SSR L ++A  G  P+IF    + G P   ++ 
Sbjct: 342 NIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILT 401

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           + LF  LA++  SS +  +F + + V  +   + W++I + +I F  A +AQG    +  
Sbjct: 402 NSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELE 461

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYK-------TFITGYIGLPVYILSW 543
           +V+    +G+ ++    +++ L+  F V L     +K        F   Y+   + +  +
Sbjct: 462 FVSAVGMWGSVYSGVMNVVV-LVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMF 520

Query: 544 AGYKLIYKT------KVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQR 589
             +K+ Y++      K++   ++DL + ++  D E  +  +  +++    QR
Sbjct: 521 VAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKKYISEQR 572

>Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON}
           YBR132C (REAL)
          Length = 598

 Score =  226 bits (576), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 139/506 (27%), Positives = 252/506 (49%), Gaps = 11/506 (2%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           +T  +++L+ RH+ +                       P ++L+A+A   + +       
Sbjct: 83  STETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVST 142

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
            EM  + P+   F   A++ VD +      + + F   +  P ++ +   +I YW  RD 
Sbjct: 143 AEMVCFFPVSSPFLRLATKCVDDSFAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDD 200

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
            + G+ + + +V+ + I+I  VK++GE EFWL+SFK                   P HDR
Sbjct: 201 YSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPKHDR 260

Query: 256 LGFR-YWRDPGAFKEY---STAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311
            GFR Y   P  FK+Y      +  S+G F  F+A  + + F+  G E   ++  E + P
Sbjct: 261 YGFRNYGESP--FKKYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRP 318

Query: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNS 370
           RK +PKA K    R+   +L +   +G+  + NDP L +   ++   A +SP+V+A+ N 
Sbjct: 319 RKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNL 378

Query: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430
            I++LP I N  ++   FSA N+  Y SSR  Y +A+DG APK+F + ++ GVP  ++ +
Sbjct: 379 KIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVAI 438

Query: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490
           S+++  ++ + ++S SA + N+ +N+++   +++++ + I Y++F +A   Q     K  
Sbjct: 439 SLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCITYLFFRRAYHVQQDSLPKLP 498

Query: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550
           + + GQ Y A   L  C  + LI+ +TVF    +  + F+  Y+ + + I  + GYK I+
Sbjct: 499 FRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIW 558

Query: 551 KTKVIKSTDVDLYTF-KEIYDREEEE 575
           K    K  +     F KE+ + E  E
Sbjct: 559 KRGKDKFKNPHEIDFSKELVEIENHE 584

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  225 bits (574), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 155/518 (29%), Positives = 244/518 (47%), Gaps = 28/518 (5%)

Query: 77  NTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFFTMACL 136
           N   KK L  RH++M                       P ++LI +  VG  +   + C 
Sbjct: 66  NQPYKKVLDQRHLTMIAIGGTLGTGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCG 124

Query: 137 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 195
            E++   P+ G +  +ASR++DP++GF+IG  YL  + I  P++L   +L I YW     
Sbjct: 125 AELSCQYPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYW--APS 182

Query: 196 VNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 255
           VNP  W+ I  V+ + +N+ G + F E EF++S FK                   PD   
Sbjct: 183 VNPAAWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTG 242

Query: 256 -LGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314
            +G +YW DPG+F         +   F +    FV + +S++G E+  +  +EA +   S
Sbjct: 243 YIGTKYWHDPGSF---------AVPVFKNLCNTFVSAAYSFSGTEMVVLTSTEARS-VSS 292

Query: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI-- 372
           V +A K T +RII+FY+ TV ++G  V YNDPRL+S    S    ASPFV+A+ N+G   
Sbjct: 293 VSRAAKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGS-SSEDITASPFVIALSNTGAMG 351

Query: 373 KVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSV 432
             + H  NA +L+ VFS CNS +Y SSR +  LA  G+ PKI A   + G P   + +  
Sbjct: 352 TRVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICG 411

Query: 433 LFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 492
            F  L ++ VS     +F +   + S+    +W  I    + F  A +AQG  K    Y 
Sbjct: 412 AFGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYR 471

Query: 493 APGQRYGAYFA--LSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI- 549
           +    YG  F   L+  ++I  I      +G       F    + +P+ I  + G+++  
Sbjct: 472 STLGIYGGIFGCILNVLLVIGEIYVSAAPVGSPSSAANFFEYCMSIPIMIAVYIGHRIYR 531

Query: 550 --YKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREE 585
             ++   IK  D+DL +   + D E  +      ER+E
Sbjct: 532 RDWRHWYIKRMDIDLDSGHSLEDFEATK-----LERDE 564

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  227 bits (578), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 158/532 (29%), Positives = 249/532 (46%), Gaps = 22/532 (4%)

Query: 72  DGKDENTR--LKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 129
           +G  E  R  LKK +K+RH+ M                       P  ++I Y  V ++ 
Sbjct: 133 NGHREKPRAQLKKTMKSRHVVMMSLGTGIGTGLLVSNASCLSLSGPAPLVIGYGLVSIIT 192

Query: 130 FFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 187
           +  +   GEM  +Y  L G F +Y S ++   +GFA  +    ++  + P +L AA++ I
Sbjct: 193 YLLIQAAGEMGVAYPTLPGNFNTYISTFLSRPIGFATIWLSSIQWLTVVPLELIAASMTI 252

Query: 188 QYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 247
           +YW +   ++P V++ IF V +  I+  G   +GE EF  +  K                
Sbjct: 253 KYWTTS--ISPDVFVVIFYVFLNFIHFFGTAAYGETEFIFNLCKILMIIGFIILSIVINC 310

Query: 248 XXXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSE 307
                   +G +YW  PGAF   ++A      +F     + V + FSY G EL  +  +E
Sbjct: 311 GGAGHDGYIGGKYWHTPGAFVGKNSA-----SRFKDVCYILVTAFFSYGGTELFVLTINE 365

Query: 308 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLS-TKGKSMSAAASPFVVA 366
             NPRKS P A K T+YRI++ YL T+ LLG  V Y++  L S T     S + SP+V+A
Sbjct: 366 QPNPRKSTPTAAKTTIYRILIVYLLTMILLGFNVPYDNKNLFSATSSNGDSISISPYVLA 425

Query: 367 IQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYN 426
               G+KV+PH  NA VL+ + S  NS  Y + R + +LA  G APK  A   + G P  
Sbjct: 426 ASIHGVKVVPHFINAVVLIALISVANSATYAAPRMMASLAQQGMAPKFLAYIDREGRPIY 485

Query: 427 ALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK 486
            L++  L   + +   S    ++F +   +  +  +  W    + +I F  A + QG D 
Sbjct: 486 GLLICSLLGVIGFAAASDKEQEVFVWLAAIAGLATLFLWECFFLSHIRFRWAMKVQGKDI 545

Query: 487 SKFAYVAPGQRYGAYFALSFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIL 541
           ++  Y A    +G+     F +L+ LI NF V L     G     K F    + LP++I 
Sbjct: 546 NEVGYKAACGIWGSIIGACFNVLV-LIANFWVSLTPPGQGSNVSAKNFFEQMLALPIWIF 604

Query: 542 SWAGYKLIYKTKVIKS--TDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG 591
              GY +I K  VI +    +DL   ++IYD E+   + +D+E  ER++  G
Sbjct: 605 FAVGYMVIKKDWVIWNPIESIDLDYCRKIYDPEQL--KREDEENRERIRNAG 654

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  227 bits (579), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 154/534 (28%), Positives = 263/534 (49%), Gaps = 26/534 (4%)

Query: 72  DGKDENTRLKKELKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFF 131
           +   ++  LKK +K RH+ M                       P  ++I +  +G  ++ 
Sbjct: 150 NDNSKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYC 209

Query: 132 TMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189
            +  +GE+A +Y  L  GF +Y S  VD A  FA+ + Y  ++  + P +L  A++ I+Y
Sbjct: 210 IIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKY 269

Query: 190 WISRDRVNPGVWITIFLVVIVAINIVG-VKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 248
           W ++  V+P +++ IF ++I+ IN++G    + E EF  +S K                 
Sbjct: 270 WTTK--VDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICG 327

Query: 249 XXPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEA 308
                  +G +YW DPGA +  +     S  +F   +A  V + F++   E  G+  SE 
Sbjct: 328 GAGTDGYIGAKYWHDPGALRGDT-----SIQRFKGCMATLVNAAFAFGMSEFIGVTASEQ 382

Query: 309 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 368
            NPRK++P A K  +YRI+  +L ++ ++G  V YN  +LL + G  + A  SP+V+AI 
Sbjct: 383 SNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKA--SPYVLAIS 440

Query: 369 NSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNAL 428
             G++V+PH  NA +L+ V S  NS  Y SSR L +LA  G APKI++   + G P   +
Sbjct: 441 THGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGM 500

Query: 429 ILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 488
             + +F  +A+   S    ++F + + +  +  + +W+ I I +I F +A   QG    +
Sbjct: 501 ATAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGE 560

Query: 489 FAYVAPGQRYGAYFA--LSFCILIA----LIKNFTVFLGHKFDYKTFITGYIGLPVYILS 542
             + +    YG+ +A  + F ILIA     +      L  K D K F   Y+ +P+ +  
Sbjct: 561 LGFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAF 620

Query: 543 WAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRIKDQERE--ERLQRNGK 592
           + GYK+  K     I++ ++DL + + I+D E     IK +E E  ERL+   K
Sbjct: 621 YFGYKIWKKDWKLFIRAKNIDLISHRNIFDEE----LIKQEEDEYRERLRTGPK 670

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.142    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,812,732
Number of extensions: 2292427
Number of successful extensions: 10891
Number of sequences better than 10.0: 396
Number of HSP's gapped: 9239
Number of HSP's successfully gapped: 416
Length of query: 606
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 491
Effective length of database: 40,294,809
Effective search space: 19784751219
Effective search space used: 19784751219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)