Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.472na 1ON35335318520.0
YPL264Cna 1ON35335317930.0
Suva_16.41na 1ON35335317540.0
Skud_16.13na 1ON35335316810.0
YMR253C8.804ON41433611831e-161
Skud_13.4258.804ON42434711731e-160
Smik_13.4678.804ON41933611671e-159
Suva_13.4388.804ON41833611671e-159
Kpol_2002.22na 2ON40334510881e-147
TDEL0B009308.804ON37035110651e-144
NDAI0K006608.804ON48735210621e-142
KNAG0J005008.804ON39133810501e-142
CAGL0H02519g8.804ON38435110431e-141
NCAS0C006308.804ON46034010251e-137
KLTH0C04752g8.804ON37235710111e-136
ZYRO0G13288g8.804ON37335710061e-135
KNAG0J00490singletonON4393509901e-132
Kwal_27.104338.804ON3823549791e-131
Kpol_543.758.804ON3943369801e-131
SAKL0D02442g8.804ON3803519731e-130
TBLA0B026908.804ON4553329731e-129
TPHA0E03870na 2ON4323449661e-128
KAFR0B038308.804ON3893209131e-121
TPHA0G010508.804ON3143258141e-107
KNAG0B035605.551ON40565840.062
YML018C5.551ON393125840.069
TDEL0A041405.551ON382155820.12
TBLA0D014805.551ON44076810.14
Smik_13.1335.551ON393125790.25
SAKL0G05456g5.551ON39472790.27
CAGL0M04499g8.348ON46992790.28
KLLA0B01177g5.551ON41456780.34
ZYRO0D13090g5.551ON37063750.70
NCAS0F012005.551ON36773750.71
Skud_13.1335.551ON393122750.71
TPHA0D025005.551ON45056750.89
Suva_13.1415.551ON40053731.3
AER331C5.551ON44465731.6
NDAI0C009405.551ON44765721.8
Ecym_42248.348ON46676721.9
Kpol_2000.601.88ON103355722.1
KAFR0C055105.551ON40392712.6
CAGL0G07018g5.551ON39163702.9
KNAG0A028808.348ON52478703.6
KLTH0G04312g5.551ON40853693.9
KAFR0I008605.551ON35467694.4
NCAS0H026805.551ON42365694.7
TDEL0F047208.348ON47983676.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.472
         (353 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.472 Chr6 (776811..777872) [1062 bp, 353 aa] {ON} YPL264C ...   717   0.0  
YPL264C Chr16 complement(43283..44344) [1062 bp, 353 aa] {ON} Pu...   695   0.0  
Suva_16.41 Chr16 complement(58881..59942) [1062 bp, 353 aa] {ON}...   680   0.0  
Skud_16.13 Chr16 complement(22375..23436) [1062 bp, 353 aa] {ON}...   652   0.0  
YMR253C Chr13 complement(775946..777190) [1245 bp, 414 aa] {ON} ...   460   e-161
Skud_13.425 Chr13 complement(749944..751218) [1275 bp, 424 aa] {...   456   e-160
Smik_13.467 Chr13 complement(759048..760307) [1260 bp, 419 aa] {...   454   e-159
Suva_13.438 Chr13 complement(755253..756509) [1257 bp, 418 aa] {...   454   e-159
Kpol_2002.22 s2002 complement(44306..45517) [1212 bp, 403 aa] {O...   423   e-147
TDEL0B00930 Chr2 (174436..175548) [1113 bp, 370 aa] {ON} Anc_8.8...   414   e-144
NDAI0K00660 Chr11 (143969..145432) [1464 bp, 487 aa] {ON} Anc_8....   413   e-142
KNAG0J00500 Chr10 (79669..80844) [1176 bp, 391 aa] {ON} Anc_8.80...   409   e-142
CAGL0H02519g Chr8 (229511..230665) [1155 bp, 384 aa] {ON} simila...   406   e-141
NCAS0C00630 Chr3 (100913..102295) [1383 bp, 460 aa] {ON} Anc_8.804    399   e-137
KLTH0C04752g Chr3 (410449..411567) [1119 bp, 372 aa] {ON} simila...   394   e-136
ZYRO0G13288g Chr7 complement(1062258..1063379) [1122 bp, 373 aa]...   392   e-135
KNAG0J00490 Chr10 (78039..79358) [1320 bp, 439 aa] {ON}               385   e-132
Kwal_27.10433 s27 (342780..343928) [1149 bp, 382 aa] {ON} YMR253...   381   e-131
Kpol_543.75 s543 complement(184341..185525) [1185 bp, 394 aa] {O...   382   e-131
SAKL0D02442g Chr4 (193585..194727) [1143 bp, 380 aa] {ON} simila...   379   e-130
TBLA0B02690 Chr2 (618919..620286) [1368 bp, 455 aa] {ON} Anc_8.8...   379   e-129
TPHA0E03870 Chr5 (815023..816321) [1299 bp, 432 aa] {ON}              376   e-128
KAFR0B03830 Chr2 (792859..794028) [1170 bp, 389 aa] {ON} Anc_8.8...   356   e-121
TPHA0G01050 Chr7 (210214..211158) [945 bp, 314 aa] {ON} Anc_8.80...   318   e-107
KNAG0B03560 Chr2 complement(687312..688529) [1218 bp, 405 aa] {O...    37   0.062
YML018C Chr13 complement(234771..235952) [1182 bp, 393 aa] {ON} ...    37   0.069
TDEL0A04140 Chr1 (737337..738485) [1149 bp, 382 aa] {ON} Anc_5.5...    36   0.12 
TBLA0D01480 Chr4 complement(363558..364880) [1323 bp, 440 aa] {O...    36   0.14 
Smik_13.133 Chr13 complement(223651..224832) [1182 bp, 393 aa] {...    35   0.25 
SAKL0G05456g Chr7 (448553..449737) [1185 bp, 394 aa] {ON} simila...    35   0.27 
CAGL0M04499g Chr13 (494202..495611) [1410 bp, 469 aa] {ON} highl...    35   0.28 
KLLA0B01177g Chr2 (94268..95512) [1245 bp, 414 aa] {ON} similar ...    35   0.34 
ZYRO0D13090g Chr4 (1102902..1104014) [1113 bp, 370 aa] {ON} simi...    33   0.70 
NCAS0F01200 Chr6 (234603..235706) [1104 bp, 367 aa] {ON} Anc_5.5...    33   0.71 
Skud_13.133 Chr13 complement(221096..222277) [1182 bp, 393 aa] {...    33   0.71 
TPHA0D02500 Chr4 (515403..516755) [1353 bp, 450 aa] {ON} Anc_5.5...    33   0.89 
Suva_13.141 Chr13 complement(225107..226309) [1203 bp, 400 aa] {...    33   1.3  
AER331C Chr5 complement(1245399..1246733) [1335 bp, 444 aa] {ON}...    33   1.6  
NDAI0C00940 Chr3 complement(180857..182200) [1344 bp, 447 aa] {O...    32   1.8  
Ecym_4224 Chr4 complement(468353..469753) [1401 bp, 466 aa] {ON}...    32   1.9  
Kpol_2000.60 s2000 (119866..122967) [3102 bp, 1033 aa] {ON} (119...    32   2.1  
KAFR0C05510 Chr3 (1102100..1103311) [1212 bp, 403 aa] {ON} Anc_5...    32   2.6  
CAGL0G07018g Chr7 (668453..669628) [1176 bp, 391 aa] {ON} simila...    32   2.9  
KNAG0A02880 Chr1 complement(344974..346548) [1575 bp, 524 aa] {O...    32   3.6  
KLTH0G04312g Chr7 (343552..344778) [1227 bp, 408 aa] {ON} simila...    31   3.9  
KAFR0I00860 Chr9 (167141..168205) [1065 bp, 354 aa] {ON} Anc_5.5...    31   4.4  
NCAS0H02680 Chr8 (529371..530642) [1272 bp, 423 aa] {ON} Anc_5.551     31   4.7  
TDEL0F04720 Chr6 (887597..889036) [1440 bp, 479 aa] {ON} Anc_8.3...    30   6.7  

>Smik_6.472 Chr6 (776811..777872) [1062 bp, 353 aa] {ON} YPL264C
           (REAL)
          Length = 353

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/353 (100%), Positives = 353/353 (100%)

Query: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMS 60
           MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMS
Sbjct: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMS 60

Query: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI
Sbjct: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180
           TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV
Sbjct: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180

Query: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI
Sbjct: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV
Sbjct: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300

Query: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFELDELED 353
           LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFELDELED
Sbjct: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFELDELED 353

>YPL264C Chr16 complement(43283..44344) [1062 bp, 353 aa] {ON}
           Putative membrane protein of unknown function;
           physically interacts with Hsp82p; YPL264C is not an
           essential gene
          Length = 353

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/353 (95%), Positives = 350/353 (99%)

Query: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMS 60
           MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTK+LENDPL+TSQ RINPLQILLVRMS
Sbjct: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKVLENDPLETSQSRINPLQILLVRMS 60

Query: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITYCCTLVYMHWNK+SVPDIPWGPA CRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI
Sbjct: 61  ITYCCTLVYMHWNKQSVPDIPWGPAPCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180
           TFMSPTLTIFLSFLLLGEPFSKLEALGS+ISFSGVVLIIRPTFLFG+QTQGQ++ QDDIV
Sbjct: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGEQTQGQQSPQDDIV 180

Query: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           ETQNPKLRL+AIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGV+LI
Sbjct: 181 ETQNPKLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVLLI 240

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM+LQLPHSWKQWGLFLNLG+SGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV
Sbjct: 241 PSMSLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300

Query: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFELDELED 353
           LFHHWPNIWTWCGMAVIV+STIWVINMRASKQNVVAT+ELLSTSDFELD+LED
Sbjct: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATAELLSTSDFELDDLED 353

>Suva_16.41 Chr16 complement(58881..59942) [1062 bp, 353 aa] {ON}
           YPL264C (REAL)
          Length = 353

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/353 (94%), Positives = 343/353 (97%)

Query: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMS 60
           MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILEN+PL+ SQ RINPLQILLVRMS
Sbjct: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMS 60

Query: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITYCCTLVYMHWNK+SVPDIPWGP   RKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI
Sbjct: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180
           TFMSPTLTIFLSFLLLGEPFSKLEALGS+ISFSGVVLIIRPTFLFGQ  + QE S+D+IV
Sbjct: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180

Query: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           ETQNP LRL+AIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI
Sbjct: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV
Sbjct: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300

Query: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFELDELED 353
           LFHHWPNIWTWCGMAVIV+STIWVINMRASKQNVVATS+LLSTSDFELDELED
Sbjct: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFELDELED 353

>Skud_16.13 Chr16 complement(22375..23436) [1062 bp, 353 aa] {ON}
           YPL264C (REAL)
          Length = 353

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/353 (91%), Positives = 344/353 (97%)

Query: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMS 60
           M LQRISKDYLKPNYGL+LLIVSYFFNSSMVVSTK+LE+DPL+TSQ RINPLQILLVRMS
Sbjct: 1   MILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMS 60

Query: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITYCCTL YM WNK+++PDIPWG  SCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI
Sbjct: 61  ITYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180
           TFMSPTLTIFLSFLLLGEPFSK EALGS+ISFSGVVLIIRPTFLFGQQ+Q QE+SQ+D V
Sbjct: 121 TFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGQQSQDQESSQNDSV 180

Query: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           ET+NPKLRL+AIGVSLLGVCGLSSVYIIIR+IGNKAHAIMSVSYFSLVTTVVAALGV+LI
Sbjct: 181 ETKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLI 240

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           P++TLQLPHSWKQWGLFLNLG+SGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV
Sbjct: 241 PALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300

Query: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFELDELED 353
           LFHHWPN+WTWCGMAVIV+STIWVINMRASKQN+VAT+ELLSTSDFELDELED
Sbjct: 301 LFHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLSTSDFELDELED 353

>YMR253C Chr13 complement(775946..777190) [1245 bp, 414 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern; YMR253C is not an essential gene
          Length = 414

 Score =  460 bits (1183), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 225/336 (66%), Positives = 273/336 (81%), Gaps = 3/336 (0%)

Query: 2   TLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPR-INPLQILLVRMS 60
           TLQRISKDYLKPN GL+LL VSYFFNS+MVVSTK+LENDP   +  R I PLQILLVRM 
Sbjct: 56  TLQRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLENDPDDIANDRQIKPLQILLVRMV 115

Query: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM+ NK ++ D+P+G    RKWL+LRG  GFFGVFGMY+SLMYL+ISDAVLI
Sbjct: 116 ITYIGTLIYMYINKSTISDVPFGKPEVRKWLVLRGCTGFFGVFGMYYSLMYLTISDAVLI 175

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180
           TF++P+LTIFLS+++L E F+K+EALGS+IS  GVVLI+RP+FLFG       +SQ  IV
Sbjct: 176 TFLAPSLTIFLSWVILRERFTKVEALGSLISLLGVVLIVRPSFLFGTPELTDSSSQ--IV 233

Query: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           E+ +PK RL+A  V L GV G+S VYIIIRYIG +AHAIMSVSYFSL+T +V+ +G+  I
Sbjct: 234 ESSDPKSRLIATLVGLWGVLGMSCVYIIIRYIGKRAHAIMSVSYFSLITAIVSFIGINTI 293

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM  Q+PHS KQW LF NLGVSGFI Q+LLTMGIQRERAGRGSLMTYTQ++YAVFWDV 
Sbjct: 294 PSMKFQIPHSKKQWILFGNLGVSGFIFQLLLTMGIQRERAGRGSLMTYTQLLYAVFWDVA 353

Query: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVA 336
           L+ HWPNIW+W GM +I+++T+WVI +RA+     A
Sbjct: 354 LYKHWPNIWSWIGMIIIISATLWVIRIRAANNETTA 389

>Skud_13.425 Chr13 complement(749944..751218) [1275 bp, 424 aa] {ON}
           YMR253C (REAL)
          Length = 424

 Score =  456 bits (1173), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 225/347 (64%), Positives = 273/347 (78%), Gaps = 4/347 (1%)

Query: 2   TLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPR-INPLQILLVRMS 60
           TLQRISKDYLKPN GL+LL VSYFFNS+MVVSTK+LENDP   +  R I PLQILLVRM 
Sbjct: 67  TLQRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLENDPEDIANDRQIKPLQILLVRMV 126

Query: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM+ NK ++P++P+G    RKWLILRG  GFFGVFGMY+SLMYL+ISDAVLI
Sbjct: 127 ITYIGTLIYMYINKSTIPNVPFGKPEVRKWLILRGCTGFFGVFGMYYSLMYLTISDAVLI 186

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180
           TF+SP+LTIFLS+++L E F+K+EALGS+IS  GVVLI+RP+FLFG       +    IV
Sbjct: 187 TFLSPSLTIFLSWVILRERFTKVEALGSLISLMGVVLIVRPSFLFGTPEMTDSSR---IV 243

Query: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           E+ +PK RLVA  V L GV G+S VYIIIRYIG +AHAIMSVSYFSL+T +V+ +G+  I
Sbjct: 244 ESSDPKSRLVATLVGLWGVLGMSCVYIIIRYIGKRAHAIMSVSYFSLITAIVSFIGINTI 303

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM  Q+PHS KQW LF NLGVSGFI Q+LLT+GIQRERAGRGSLM YTQ++YAVFWDV 
Sbjct: 304 PSMKFQIPHSRKQWILFGNLGVSGFIFQLLLTLGIQRERAGRGSLMAYTQLLYAVFWDVT 363

Query: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFE 347
           L+ HWPN+W+W GM VI+++T+WVI +RA+    +         D E
Sbjct: 364 LYKHWPNVWSWVGMIVIISATLWVIRIRAANSEAMNKDPAPVIDDEE 410

>Smik_13.467 Chr13 complement(759048..760307) [1260 bp, 419 aa] {ON}
           YMR253C (REAL)
          Length = 419

 Score =  454 bits (1167), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 221/336 (65%), Positives = 273/336 (81%), Gaps = 3/336 (0%)

Query: 2   TLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPR-INPLQILLVRMS 60
           TL RISKDYLKPN GL+LL VSYFFNS+MVVSTK+LENDP   +  R I PLQILLVRM 
Sbjct: 61  TLHRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLENDPDDIANERQIKPLQILLVRMV 120

Query: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM+ NK ++ D+P+G    RKWLILRG  GFFGVFGMY+SLMYL+ISDAVLI
Sbjct: 121 ITYVGTLIYMYINKNTISDVPFGKPEVRKWLILRGCTGFFGVFGMYYSLMYLTISDAVLI 180

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180
           TF++P+LTIFLS+++L E F+K+EALGS+IS  GVVLI+RP+F+FG       +SQ  I+
Sbjct: 181 TFLAPSLTIFLSWIILRERFTKVEALGSLISLMGVVLIVRPSFIFGTPESTDSSSQ--II 238

Query: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           E+ +PK RL+A  V L GV G+S VYIIIRYIG +AHAIMSVSYFSL+T +V+ +G+  I
Sbjct: 239 ESSDPKSRLIATLVGLWGVLGMSCVYIIIRYIGKRAHAIMSVSYFSLITAIVSFIGINTI 298

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM  Q+PHS KQW LF NLGVSGFI Q+LLT+GIQRERAGRGSLMTYTQ++YAVFWDV 
Sbjct: 299 PSMKFQIPHSKKQWILFGNLGVSGFIFQLLLTLGIQRERAGRGSLMTYTQLLYAVFWDVS 358

Query: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVA 336
           L+ HWP+IW+W GM +I+++T+WVI +RA+    +A
Sbjct: 359 LYKHWPSIWSWIGMIIIISATLWVIRIRAANSETIA 394

>Suva_13.438 Chr13 complement(755253..756509) [1257 bp, 418 aa] {ON}
           YMR253C (REAL)
          Length = 418

 Score =  454 bits (1167), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 221/336 (65%), Positives = 273/336 (81%), Gaps = 3/336 (0%)

Query: 2   TLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLK-TSQPRINPLQILLVRMS 60
           TLQRISKDYLKPN GL+LL VSYFFNS+MVVSTK+LENDP    +  +I PLQILLVRM 
Sbjct: 60  TLQRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLENDPEDIANDTQIKPLQILLVRMV 119

Query: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM+ N+ ++ D+P+G    RKWLILRG  GFFGVFGMY+SLMYL+ISDAVLI
Sbjct: 120 ITYIGTLIYMYINRSTISDVPFGKPEVRKWLILRGCTGFFGVFGMYYSLMYLTISDAVLI 179

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180
           TF+SP+LTIFLS+L+L E F+K+EALGS++S  GVVLI+RP+FLFG       +SQ  IV
Sbjct: 180 TFLSPSLTIFLSWLILRERFTKVEALGSLVSLMGVVLIVRPSFLFGVPEMTDSSSQ--IV 237

Query: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           E+ +P+ RL+A  V L GV G+S VYIIIRYIG +AHAIMSVSYFSL+T +V+ +G+  I
Sbjct: 238 ESSDPRSRLIATLVGLWGVFGMSCVYIIIRYIGKRAHAIMSVSYFSLITALVSFVGINTI 297

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM  Q+PHS KQW LF NLG+SGFI Q+LLT+GIQRERAGRGSLM YTQ+IYAVFWDV 
Sbjct: 298 PSMKFQIPHSKKQWILFGNLGISGFIFQLLLTLGIQRERAGRGSLMAYTQLIYAVFWDVA 357

Query: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVA 336
           L+ HWPN+W+W GM +I+T+T+WVI +R++    +A
Sbjct: 358 LYKHWPNMWSWFGMIIIITATLWVIRIRSANNEAIA 393

>Kpol_2002.22 s2002 complement(44306..45517) [1212 bp, 403 aa] {ON}
           complement(44306..45517) [1212 nt, 404 aa]
          Length = 403

 Score =  423 bits (1088), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/345 (60%), Positives = 264/345 (76%), Gaps = 5/345 (1%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMSIT 62
           L+R + ++L PN GL+LL  +Y FNS MVVSTK++E DP K  + RI PLQIL+VRM IT
Sbjct: 48  LKRFADEHLMPNLGLVLLSGAYLFNSIMVVSTKVMETDPDKLKEDRIKPLQILVVRMVIT 107

Query: 63  YCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITF 122
           Y  TL+YM+W +  +  +P+GP   RKWL+LRG +GFFGVFGMYFSLMYL+ISDAVLITF
Sbjct: 108 YIGTLIYMYWKRDVIEHVPFGPPELRKWLLLRGCVGFFGVFGMYFSLMYLTISDAVLITF 167

Query: 123 MSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIVET 182
           +SP+LTI L++L+L E  ++ E +GSIIS  GVVLI+RP FLFG +    +   +D VET
Sbjct: 168 LSPSLTIILAWLILREKITRFEVMGSIISLFGVVLIVRPCFLFGARVNLSQI--NDHVET 225

Query: 183 QNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPS 242
            NP+ RLVA  V+LLGV G S VYIIIR+IGN+AHAIMSVSYFSLVTTVV+ +G++ IPS
Sbjct: 226 SNPQERLVATLVALLGVIGASCVYIIIRFIGNRAHAIMSVSYFSLVTTVVSLVGILTIPS 285

Query: 243 MTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLF 302
           +  Q+P S K+W LF NLG+ GFI Q+LLTMGIQRERAGRGSLM Y Q+IYA+FWDV ++
Sbjct: 286 IRFQIPSSLKEWLLFGNLGICGFIFQLLLTMGIQRERAGRGSLMQYVQLIYAIFWDVSIW 345

Query: 303 HHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFE 347
             WP+ W+WCGM +IV STIWV+N+   K ++ A  + L   D E
Sbjct: 346 KRWPSFWSWCGMVLIVGSTIWVVNI---KNSLAAQKDTLHMQDLE 387

>TDEL0B00930 Chr2 (174436..175548) [1113 bp, 370 aa] {ON} Anc_8.804
           YMR253C
          Length = 370

 Score =  414 bits (1065), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 203/351 (57%), Positives = 274/351 (78%), Gaps = 12/351 (3%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDP--LKTSQPRINPLQILLVRMS 60
           ++RIS++YLKPN GL+LL+VSYFFNS MVV+TK+LE D   ++  +P I PLQILLVRMS
Sbjct: 30  VRRISREYLKPNIGLVLLVVSYFFNSGMVVATKVLETDHEGVEDREP-IKPLQILLVRMS 88

Query: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM  N+K++ ++P+GP   RKWLILRG+MGF GVFG+Y SL+YLSISDA+LI
Sbjct: 89  ITYVGTLLYMLKNRKTIENVPFGPPEVRKWLILRGLMGFLGVFGLYSSLVYLSISDAILI 148

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180
           TF++PT+T+ L++++L E F+ +EA+GS++SF GV+LI+RP+FLFG  T   +A+     
Sbjct: 149 TFLTPTVTVILAWIVLRERFTVIEAVGSLLSFGGVILIVRPSFLFGTATTSTDAA----- 203

Query: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           E++N + RL+A  +SL+GV G SSVYIIIR+IG +AHAI+SVSYFSL+ T+++  GV L+
Sbjct: 204 ESENTRDRLIATIMSLVGVFGASSVYIIIRHIGQRAHAILSVSYFSLIVTIISIAGVALV 263

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM +Q+P + KQW LF NLG+ GFI Q LLTMGIQRERAGRGS+M YTQ+IYAVFWDV 
Sbjct: 264 PSMHIQMPSNTKQWLLFANLGICGFIFQYLLTMGIQRERAGRGSVMAYTQLIYAVFWDVA 323

Query: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFELDEL 351
           L+H+WP +W+W GM +IV ST+ VI  +  +       E     ++ELDE+
Sbjct: 324 LWHNWPKLWSWLGMLIIVGSTLAVIKFKPKESASPPDEE----ENYELDEI 370

>NDAI0K00660 Chr11 (143969..145432) [1464 bp, 487 aa] {ON} Anc_8.804
          Length = 487

 Score =  413 bits (1062), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 201/352 (57%), Positives = 269/352 (76%), Gaps = 4/352 (1%)

Query: 2   TLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPR-INPLQILLVRMS 60
           T+QRI+KDYLKPN GL+LL ++  FNS MV STK+LE DP   +  + I PLQILLVRM 
Sbjct: 92  TIQRINKDYLKPNVGLLLLTLAQLFNSLMVTSTKVLETDPYDIAHDQQIKPLQILLVRMV 151

Query: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM  N+ ++  +P+G    RKWLILRG +GFFGVFGMYFSLMYLSISDAVLI
Sbjct: 152 ITYLGTLIYMFINRHTIQFVPFGDPKIRKWLILRGCVGFFGVFGMYFSLMYLSISDAVLI 211

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180
           TF++P++TI +S+++L E F+K EA+G I+S  GVVLI+RPTF+FG           ++V
Sbjct: 212 TFLAPSVTIIMSWVILRERFTKTEAIGCIVSLFGVVLIVRPTFIFGVPDDDDGKIDPEMV 271

Query: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           E++NP+ RL+A  V LLGV G+S VY++IR+IG +AHAIMSVSYFSL+TT+++ LG++ +
Sbjct: 272 ESKNPEERLIATFVGLLGVVGMSMVYVVIRFIGKRAHAIMSVSYFSLITTIISFLGIVFL 331

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM   +PHS KQW LF NLG  GFI Q+LLT+GIQ+ERAGRGSL++YTQ+IYA+FWDV 
Sbjct: 332 PSMKFHVPHSLKQWLLFANLGFCGFIFQLLLTLGIQKERAGRGSLISYTQLIYAIFWDVT 391

Query: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQ---NVVATSELLSTSDFELD 349
           L+ HWPNIW+WCGM +I+ +T+ ++ ++  +    NV+ T  + S S  + D
Sbjct: 392 LYRHWPNIWSWCGMLIIIGTTLLIVKLKPKQDENGNVIETKSMTSLSSSKTD 443

>KNAG0J00500 Chr10 (79669..80844) [1176 bp, 391 aa] {ON} Anc_8.804
           YMR253C
          Length = 391

 Score =  409 bits (1050), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/338 (57%), Positives = 259/338 (76%), Gaps = 4/338 (1%)

Query: 7   SKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMSITYCCT 66
            + Y+ PN GLILL+VSYFF+SSMVVSTK+LE DP   S+ +I PLQIL VRMSITY   
Sbjct: 53  KEKYIDPNVGLILLVVSYFFSSSMVVSTKVLETDP--GSETKIQPLQILAVRMSITYLGC 110

Query: 67  LVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMSPT 126
           L+YM+ N+ ++PD+P+G  S RKWLILRG MGFF VFG YFSLMYLSISD+ LI F+ P+
Sbjct: 111 LLYMYINRNTIPDVPFGERSVRKWLILRGCMGFFSVFGTYFSLMYLSISDSTLIMFLEPS 170

Query: 127 LTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIVETQNPK 186
           L I +++L L E   ++E +G ++S  GVVLI+RP FLFG  T   ++ Q   VE++NP+
Sbjct: 171 LIIVMAWLFLNERIQRMEIVGCVVSLIGVVLIVRPPFLFGPATFDPDSDQS--VESRNPR 228

Query: 187 LRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPSMTLQ 246
            RL+A  V++ G  G+ SVYIIIR+IG++AHAIM+VSYFSLVT VV+ +G+++IPSM  Q
Sbjct: 229 ERLLATLVAVWGTVGMGSVYIIIRHIGDRAHAIMNVSYFSLVTFVVSIVGILVIPSMRFQ 288

Query: 247 LPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFHHWP 306
           +PH+WK+W LF NLGVSGF HQ LLT+GIQRERAGRGSL+TYT ++YA+FWD+ L+HH+P
Sbjct: 289 IPHTWKEWILFANLGVSGFYHQFLLTLGIQRERAGRGSLITYTLLVYALFWDIFLYHHFP 348

Query: 307 NIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTS 344
            +W+WCGM +IV ST++V+ M+        T E L  +
Sbjct: 349 PLWSWCGMFLIVGSTVYVVKMKMDDAEQDGTGEALEMT 386

>CAGL0H02519g Chr8 (229511..230665) [1155 bp, 384 aa] {ON} similar
           to uniprot|Q04835 Saccharomyces cerevisiae YMR253c and
           similar to uniprot|Q08980 Saccharomyces cerevisiae
           YPL264c
          Length = 384

 Score =  406 bits (1043), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 200/351 (56%), Positives = 266/351 (75%), Gaps = 6/351 (1%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDP--LKTSQPRINPLQILLVRMS 60
           + R++++YLKPN GLI LIVS  FNS MVVSTK+LE D   L+  +P I PLQILLVRM 
Sbjct: 34  VARLNQEYLKPNVGLIFLIVSQLFNSLMVVSTKVLELDREGLEPDEPSIQPLQILLVRMI 93

Query: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITY  TL+YM  N  S+  +P+G  + R WLI+RG MGFFGVFGMYFSLMYL+ISDAVLI
Sbjct: 94  ITYIGTLIYMKINSSSIEYVPFGNPAVRPWLIMRGAMGFFGVFGMYFSLMYLTISDAVLI 153

Query: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180
           TF++P++TI L++++L E FSK E +GS +S +GVVLI+RPTFLFG  T     S  DI 
Sbjct: 154 TFLAPSVTIILAWIILRESFSKAEGIGSFVSLAGVVLIVRPTFLFGNPT----TSDGDID 209

Query: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
           ET +P  RL+A  V+L GV G+SSV+IIIRYIG +AHAI++VSYFSL+T ++A  G++ +
Sbjct: 210 ETTDPHKRLIATLVALWGVVGISSVWIIIRYIGKRAHAIINVSYFSLITGLIALFGILFV 269

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PS+  Q P + KQW LF NLG+ GF HQ+LLT+GIQ+ERAGRG+LM+YT +IYAVFWDV+
Sbjct: 270 PSVHFQTPRTLKQWLLFANLGICGFCHQLLLTIGIQKERAGRGTLMSYTNLIYAVFWDVL 329

Query: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFELDEL 351
           LF HWP+ W+ CGM +I  ST++++ M+A+     A +     ++F+L++L
Sbjct: 330 LFGHWPSFWSICGMILITGSTLYIVKMKANDAKPQAVNNNSIQTEFDLEDL 380

>NCAS0C00630 Chr3 (100913..102295) [1383 bp, 460 aa] {ON} Anc_8.804
          Length = 460

 Score =  399 bits (1025), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 201/340 (59%), Positives = 259/340 (76%), Gaps = 10/340 (2%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPL-KTSQPRINPLQILLVRMSI 61
           LQRI+K+YLKPN GLILLI +  FNS MV STK+LE DP  K     I P QILLVRM+I
Sbjct: 66  LQRINKEYLKPNIGLILLIFAQLFNSLMVTSTKVLETDPEDKALGTSIKPFQILLVRMAI 125

Query: 62  TYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           TY  TL+YM+ N+ ++  +P+G    RKWLILRG +GF+GVFGMYFSLMYLSISDAVLIT
Sbjct: 126 TYLGTLIYMYLNRSTIDYVPFGDPKVRKWLILRGCVGFWGVFGMYFSLMYLSISDAVLIT 185

Query: 122 FMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQ-TQGQEASQD--- 177
           F++PT+TI L++++L E F+K+EA G+++S  GVVLI+RPTFLFG   T   +   D   
Sbjct: 186 FLAPTVTIILAWIILRERFTKVEAAGALVSLLGVVLIVRPTFLFGSDMTTPSDVELDVDL 245

Query: 178 ----DIVETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVA 233
               D  E+ NP  RL+A  V L GV G+SSVYIIIR+IG +AHAIMSVSYFSL+T +++
Sbjct: 246 NPMRDQAESSNPADRLMASIVGLCGVLGMSSVYIIIRFIGKRAHAIMSVSYFSLITLIIS 305

Query: 234 ALGVILIPSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIY 293
            + +I++PSM LQ PHS KQW LF NLG  GF  Q+LLT+GIQ+ERAGRGSLM+YTQ++Y
Sbjct: 306 TVCIIVMPSMRLQFPHSLKQWLLFANLGFCGFFFQLLLTLGIQKERAGRGSLMSYTQLVY 365

Query: 294 AVFWDVVLFHHWPNIWTWCGMAVIVTSTIWVINMRASKQN 333
           A+FWDV L+ +WP+IW+W GM +I+ ST+ V+ ++  KQN
Sbjct: 366 AIFWDVTLYKNWPSIWSWLGMIIIIGSTLVVMRLKP-KQN 404

>KLTH0C04752g Chr3 (410449..411567) [1119 bp, 372 aa] {ON} similar
           to uniprot|Q04835 Saccharomyces cerevisiae YMR253C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 372

 Score =  394 bits (1011), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 193/357 (54%), Positives = 260/357 (72%), Gaps = 12/357 (3%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMSIT 62
           LQR+S +YLKPN GL+ L++S  FNS MVVSTK+LE DP +  +P I PLQIL+VRM IT
Sbjct: 19  LQRLSSEYLKPNIGLLYLLISNLFNSVMVVSTKLLETDP-ELEEP-ITPLQILVVRMFIT 76

Query: 63  YCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITF 122
           Y  TL+YM +N+  +  +PWGP   RKWLILRG  GFFGVFGMY+SLMYLS+ DA +ITF
Sbjct: 77  YIGTLIYMLYNRDRIDHVPWGPPDMRKWLILRGCTGFFGVFGMYYSLMYLSVPDATIITF 136

Query: 123 MSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIVET 182
           + P+ T  L++ +L E +SK+EA G+++S  GV+LI+RP+FLFG              E+
Sbjct: 137 LGPSFTGLLAWAILRERYSKVEATGALVSLMGVILIVRPSFLFGSSATDDSGGT---AES 193

Query: 183 QNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPS 242
           ++P  RLVA  V+L+GV G S+VYIIIRYIG +AHAIMSVSYF+L+   V+ +G+ +IPS
Sbjct: 194 RDPHARLVATIVALVGVIGASNVYIIIRYIGQRAHAIMSVSYFALIACCVSLVGICVIPS 253

Query: 243 MTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLF 302
           M  Q+P + KQW LF  +G SGF  Q+LLTMGIQRERAGRG++M+Y+Q+IYA+FWDV ++
Sbjct: 254 MGFQIPQTSKQWFLFTLIGFSGFFMQLLLTMGIQRERAGRGAIMSYSQIIYAIFWDVFIW 313

Query: 303 HHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVAT------SELLSTSDFELDELED 353
           HH P +W+WCG+ VI+ S IWV+  +  K   +AT      S+++   DFE+ + ED
Sbjct: 314 HHLPGLWSWCGIIVILGSAIWVVKCKP-KSEFIATATTDQESQVIQMEDFEIHDDED 369

>ZYRO0G13288g Chr7 complement(1062258..1063379) [1122 bp, 373 aa]
           {ON} similar to uniprot|Q04835 Saccharomyces cerevisiae
           YMR253C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 373

 Score =  392 bits (1006), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 197/357 (55%), Positives = 263/357 (73%), Gaps = 17/357 (4%)

Query: 2   TLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPR-------INPLQI 54
           +LQR S+DYLKPN GL+ LI +  FNS MVVSTK+LE D  KT  P        I PLQI
Sbjct: 27  SLQRFSQDYLKPNLGLVYLIAAQLFNSLMVVSTKVLETD--KTIDPNTGDPLKPIKPLQI 84

Query: 55  LLVRMSITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSI 114
           LL RMSITY   L+YM  N++S+PD P+G    R WL LRG +GFFGVFG+YFSLMYL++
Sbjct: 85  LLSRMSITYAGALLYMLINRRSIPDAPFGAPGLRIWLFLRGAVGFFGVFGLYFSLMYLTV 144

Query: 115 SDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEA 174
           SDAVLITF++PT+T+ L+ L+L E F++ EA+G+++S  GVVLI+RP+FLFGQ     + 
Sbjct: 145 SDAVLITFLTPTVTVVLAALILKERFTRAEAVGTLVSLLGVVLIVRPSFLFGQP----DD 200

Query: 175 SQDDIVETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAA 234
             +   E+ +P  RL+A  V LLGV G S+VYI++RYIG++AHAI+SV+YFSL  T+V++
Sbjct: 201 PDNSPAESADPAKRLLATLVGLLGVLGASTVYIVLRYIGDRAHAIISVAYFSLTVTIVSS 260

Query: 235 LGVILIPSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYA 294
           +G+++IPSM    PH  +QW L +NLGV GFI Q+LLTMGIQRERAGRGS M+YTQ++YA
Sbjct: 261 IGILVIPSMQFSWPHGSRQWFLLINLGVCGFIFQLLLTMGIQRERAGRGSAMSYTQLVYA 320

Query: 295 VFWDVVLFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFELDEL 351
           V WDV+L+HHWP++W+W GM VIV +T+ V   + SK+ +    EL      EL+++
Sbjct: 321 VIWDVMLWHHWPSMWSWLGMLVIVGATVAVARYK-SKEPI---PELPLEESMELEDI 373

>KNAG0J00490 Chr10 (78039..79358) [1320 bp, 439 aa] {ON} 
          Length = 439

 Score =  385 bits (990), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 195/350 (55%), Positives = 260/350 (74%), Gaps = 4/350 (1%)

Query: 4   QRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMSITY 63
           Q+  + Y+  N GLILL+V+ FFN+ M+VSTK+LE +P+     +I PLQIL+VRM+ITY
Sbjct: 78  QQFKEKYVDTNVGLILLVVAQFFNTLMIVSTKLLETNPVAGQ--KIKPLQILVVRMAITY 135

Query: 64  CCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFM 123
              LVYM+ N+ +V  +P+G    RKWLILRG  GFFGVFG YFSLMYLSISD+VLI+F+
Sbjct: 136 IGCLVYMYVNRATVKYVPFGDPKVRKWLILRGCTGFFGVFGSYFSLMYLSISDSVLISFL 195

Query: 124 SPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIVETQ 183
           SP++TI L++ +L E   + E  G  +S  GVVLIIRP FLFG       A     VE+ 
Sbjct: 196 SPSITILLAWAVLRERIHRYEVAGCFVSLLGVVLIIRPPFLFGVDALDSSADPSP-VESH 254

Query: 184 NPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPSM 243
           +P+ RL+A  V+LLG  G+S VYIIIR+IG++AHAIMSVSYFSL+T +V+ +GV+ IPSM
Sbjct: 255 HPRDRLIATLVALLGCFGMSCVYIIIRFIGDRAHAIMSVSYFSLITLIVSIIGVLTIPSM 314

Query: 244 TLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFH 303
             Q+PHS K+W LF NLG+SGF  Q++LTMGIQRERAGRGSL+TYTQ++YA+FWDV L+H
Sbjct: 315 KFQMPHSSKEWLLFANLGISGFCFQLMLTMGIQRERAGRGSLITYTQLVYAIFWDVWLYH 374

Query: 304 HWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLST-SDFELDELE 352
           H P+IW+ CGM +I+ ST++V+ ++ S   V   ++  ST S+ + DELE
Sbjct: 375 HPPSIWSVCGMFIIIGSTLYVVRLKNSGPTVSDDADTPSTVSEQDGDELE 424

>Kwal_27.10433 s27 (342780..343928) [1149 bp, 382 aa] {ON} YMR253C -
           1:1 [contig 36] FULL
          Length = 382

 Score =  381 bits (979), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 183/354 (51%), Positives = 259/354 (73%), Gaps = 12/354 (3%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDP-LKTSQPRINPLQILLVRMSI 61
           LQR+S DYLKPN GL+ L++S  FNS M+VSTK+LE DP L+T    I PLQIL+VRM I
Sbjct: 26  LQRLSDDYLKPNIGLMYLLISNLFNSLMIVSTKLLETDPELETP---ITPLQILVVRMFI 82

Query: 62  TYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           TY  TL+YM+W + S+ ++PWGP   RKWLILRG  GFFGVFG+Y+SLMYLS+ DA +IT
Sbjct: 83  TYLGTLIYMYWKRNSIGNVPWGPPEMRKWLILRGCTGFFGVFGLYYSLMYLSVPDATVIT 142

Query: 122 FMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIVE 181
           F++P+ T  L++ +L E +SK+EA+G++ S  GV+LI+RP FLFGQ +          VE
Sbjct: 143 FLAPSFTGMLAWAVLRERYSKVEAMGALTSLFGVILIVRPAFLFGQSSMDTATGS---VE 199

Query: 182 TQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIP 241
           + NP+ R +A  ++LLGV G+ +VYIIIRYIG +AHA+MSVSYF+L+  +V+ +G+ +IP
Sbjct: 200 SSNPRDRFIATLIALLGVVGVCNVYIIIRYIGQRAHAVMSVSYFALIVCIVSLVGICVIP 259

Query: 242 SMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVL 301
           SMT Q+P + +QW LF  +G SGF  Q+LLTMGIQ+ERAGRG+L++Y+Q+I+A+FWD+++
Sbjct: 260 SMTFQVPQTTRQWFLFSVIGFSGFFMQLLLTMGIQKERAGRGALVSYSQIIFALFWDMLI 319

Query: 302 FHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVV-----ATSELLSTSDFELDE 350
           +HH P  W+WCG+  I+ S   V+  +   +  V       S+++   DFE+ +
Sbjct: 320 WHHLPGFWSWCGIITILGSAFCVLKYKPKPEPTVLITDDQESQIIQMQDFEIPD 373

>Kpol_543.75 s543 complement(184341..185525) [1185 bp, 394 aa] {ON}
           complement(184341..185525) [1185 nt, 395 aa]
          Length = 394

 Score =  382 bits (980), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 189/336 (56%), Positives = 249/336 (74%), Gaps = 6/336 (1%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMSIT 62
             R+   Y +PN G+ LLIVSYFFNS M VSTK+LE    K  + RI PLQILL+RM IT
Sbjct: 43  FNRLKDQYWEPNAGIFLLIVSYFFNSVMQVSTKVLETFGDKPDEDRIKPLQILLIRMVIT 102

Query: 63  YCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITF 122
               +VY++ N++++P +P+G    R+WLILRGI GF GVFGMYFSLMYL+ISDAVLI+F
Sbjct: 103 SIGIIVYVYMNRRTIPYVPFGNPQVRQWLILRGIFGFIGVFGMYFSLMYLTISDAVLISF 162

Query: 123 MSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIVET 182
           M+P+ T+FL++ +LGEPFSKLE +GSI+S +GV+ I+RP+F+FG   +  E S D  + T
Sbjct: 163 MAPSFTLFLAWFVLGEPFSKLEGVGSILSLTGVLFIVRPSFIFGGSIE-NEKSHDLSIAT 221

Query: 183 QNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPS 242
              + R +A  ++L G   LS VYI+IR+IG KAHAIM+VSYFS+VT +V+ LGV+ IPS
Sbjct: 222 G--RTRFIATTIALFGAASLSGVYIVIRFIGAKAHAIMNVSYFSVVTGIVSLLGVLFIPS 279

Query: 243 MTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLF 302
           M  Q+P    +W LF  +GV GFIHQ+LLTMGIQ+ RAG+GSLM+YTQVIYA+FWDV L+
Sbjct: 280 MKFQVPEGSTEWILFCTIGVCGFIHQLLLTMGIQKVRAGKGSLMSYTQVIYAIFWDVTLW 339

Query: 303 HHWPNIWTWCGMAVIVTSTIWVINMRA---SKQNVV 335
             WPN W+  GM +I+ STIWVI ++    S+Q+ V
Sbjct: 340 GRWPNAWSIFGMFLIIGSTIWVIRLKEQEVSRQSTV 375

>SAKL0D02442g Chr4 (193585..194727) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04835 Saccharomyces cerevisiae YMR253C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 380

 Score =  379 bits (973), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 265/351 (75%), Gaps = 10/351 (2%)

Query: 5   RISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMSITYC 64
           RIS++YLKPN GL+ L+ S+FFNS MVVSTK+LE DPL   +P I PLQIL+VRM IT+ 
Sbjct: 25  RISEEYLKPNIGLLFLMTSHFFNSIMVVSTKLLETDPL-LEEP-IKPLQILVVRMFITFI 82

Query: 65  CTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMS 124
            TL+YM  NK  +P +P+GP   RKWLILRG  GFFGVFG+YFSLMYLS+SDAV+ITF++
Sbjct: 83  GTLIYMQLNKDKIPHVPFGPPEVRKWLILRGFTGFFGVFGLYFSLMYLSVSDAVMITFLA 142

Query: 125 PTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIVETQN 184
           P+ T  L++++L E +SK+EALG ++S  GV+LIIRPTF+FG Q++          E+ +
Sbjct: 143 PSFTGLLAWMILHERYSKIEALGGLVSLFGVILIIRPTFMFGAQSRTSSDES---FESSD 199

Query: 185 PKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPSMT 244
           P+ RLVA  VSLLGV G+SSVYIIIRYIG++AHAIMSV+YF+ +T +++  G++LIPSM 
Sbjct: 200 PRDRLVATLVSLLGVLGVSSVYIIIRYIGHRAHAIMSVTYFAFITCMISLFGILLIPSMI 259

Query: 245 LQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFHH 304
            Q+P + KQW LF  +GVSGF  Q+LLT+GIQRERAGRG+LM Y Q+IYA+FWD++++HH
Sbjct: 260 FQIPKTPKQWFLFFLIGVSGFFMQLLLTLGIQRERAGRGALMAYGQMIYAIFWDILIWHH 319

Query: 305 WPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLST-----SDFELDE 350
            P +W+ CGM +I+ ST+ VI  +  ++  V   E   T      DFE+D+
Sbjct: 320 PPGLWSLCGMTIIIASTVTVIKFKPKQEEAVINDEENGTQVYHMEDFEIDD 370

>TBLA0B02690 Chr2 (618919..620286) [1368 bp, 455 aa] {ON} Anc_8.804
           YMR253C
          Length = 455

 Score =  379 bits (973), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 190/332 (57%), Positives = 247/332 (74%), Gaps = 8/332 (2%)

Query: 6   ISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMSITYCC 65
           ++KDYLK N GLILLI++  FNS M+VSTK+LE +P ++ +  I PLQ+LLVRMSITY  
Sbjct: 103 VNKDYLKANTGLILLIIAELFNSIMIVSTKLLETNPSRSEEDTIKPLQVLLVRMSITYLF 162

Query: 66  TLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMSP 125
           TL+YM+ NK  VP  P+G  S R  LI RG  GF GVFG+YFSLMYL+ISDA+LI F+ P
Sbjct: 163 TLIYMYINK--VPHAPFGEKSIRHLLIFRGCTGFIGVFGLYFSLMYLTISDAILIRFIVP 220

Query: 126 TLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIVETQNP 185
           T+T+FL+F++L E FS  E +GSIISF GV+LIIRP  +FG+ +  + A   D  E  NP
Sbjct: 221 TITVFLAFIVLRERFSFKEMVGSIISFCGVILIIRPKSIFGKYSDTESALGSD-GENDNP 279

Query: 186 -----KLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240
                  RLVAI V+L GV G S+VYIIIRYIG +AHA++SV+YFSL+TT+V+ LG++ I
Sbjct: 280 VTSDYNQRLVAIMVALFGVVGASNVYIIIRYIGKRAHAVLSVAYFSLLTTIVSFLGILTI 339

Query: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PSM  Q P   K+W L  NLG+ GFI+Q+LLTMGIQRERA RGSL++Y Q+++A+ WDV 
Sbjct: 340 PSMRFQAPRDLKEWLLMGNLGLCGFIYQLLLTMGIQRERAARGSLISYLQLLFAIMWDVS 399

Query: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQ 332
           L+  WPN ++W GM VI++STIWVI  +  +Q
Sbjct: 400 LWDKWPNFFSWMGMVVIISSTIWVIRAKQERQ 431

>TPHA0E03870 Chr5 (815023..816321) [1299 bp, 432 aa] {ON} 
          Length = 432

 Score =  376 bits (966), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 188/344 (54%), Positives = 266/344 (77%), Gaps = 6/344 (1%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMSIT 62
           L++ + + LKPN GL++L +++F NS M+VSTK+L  +P ++S+ RI PLQILLVRM +T
Sbjct: 68  LRKFTSESLKPNIGLVILALAFFCNSLMIVSTKVLVTNPERSSEERIKPLQILLVRMVLT 127

Query: 63  YCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITF 122
           Y  TL+YM+ N+ ++P++P+GP   RKWL+LRG  GFFGVFGMYFSLMYL +SDA++ITF
Sbjct: 128 YIGTLIYMYLNRATIPNVPFGPPEVRKWLLLRGACGFFGVFGMYFSLMYLCLSDALIITF 187

Query: 123 MSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDI-VE 181
           +SP++TI L++++L E  +K E   S+IS  GVVLIIRP F+FG  ++G  +  +D+ V 
Sbjct: 188 LSPSVTIILAWVVLRENLTKYEVTSSLISLLGVVLIIRPEFIFG--SRGMSSDGNDLSVV 245

Query: 182 TQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIP 241
           + +P  RL+A  V L GV G S VYI+IR+IGNKAHAIMSVSYFS+VT V++ +G+I+IP
Sbjct: 246 SSDPHERLIASLVGLAGVFGASIVYIVIRFIGNKAHAIMSVSYFSMVTAVISLIGIIIIP 305

Query: 242 SMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVL 301
           SMT Q+P S K+W LF NLGV GF  Q+LLT+GIQ+E+AGRG+LM YTQ+IYA+FWDV+L
Sbjct: 306 SMTFQIPSSLKEWLLFANLGVCGFFFQLLLTLGIQKEKAGRGTLMQYTQIIYAIFWDVLL 365

Query: 302 FHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSD 345
           +  WPNIW+W GM +I+ ST+++  +   K++V  + + L+ S+
Sbjct: 366 WDVWPNIWSWGGMVLIIGSTLFMFIL---KKSVSKSEQALNDSE 406

>KAFR0B03830 Chr2 (792859..794028) [1170 bp, 389 aa] {ON} Anc_8.804
           YMR253C
          Length = 389

 Score =  356 bits (913), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 171/320 (53%), Positives = 239/320 (74%), Gaps = 9/320 (2%)

Query: 11  LKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMSITYCCTLVYM 70
           +K N G++ L ++ FFNS+M+VSTK+LE     T + +I PLQ+L+VRM ITY   L+YM
Sbjct: 53  IKSNIGIVFLAIAQFFNSTMIVSTKVLE-----TGESKIKPLQVLVVRMVITYLGCLIYM 107

Query: 71  HWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIF 130
           + ++ ++ +IP+G    RKWL+LRG+ GFFGVFGMY+SL +LSIS+A+LITF++P+LTI 
Sbjct: 108 YLHRDTIKNIPFGDPPVRKWLLLRGMTGFFGVFGMYYSLQHLSISNAILITFLAPSLTIV 167

Query: 131 LSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIVETQNPKLRLV 190
           L+ + L E  +  E  GS+ S  GV+LIIRP FLFGQ     E   ++  E+ NP+ RLV
Sbjct: 168 LAAMFLHERINLWEIAGSLTSLFGVILIIRPPFLFGQT----EGGANEKAESSNPEERLV 223

Query: 191 AIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILIPSMTLQLPHS 250
              + LLG  G+S VYIIIR IG +AHAIM+V+YFSLVT V++  G+I IPSM+ Q+P +
Sbjct: 224 GSMIGLLGTLGISCVYIIIRRIGKRAHAIMNVAYFSLVTAVISLFGIIFIPSMSFQIPQT 283

Query: 251 WKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFHHWPNIWT 310
             +W LF NLG  GF +Q++LT+GIQ+ERAGRGSL+TYTQ+IYA+FWD+VL+H WP+IW+
Sbjct: 284 LTEWLLFSNLGFCGFFYQLILTIGIQKERAGRGSLLTYTQLIYALFWDLVLYHFWPSIWS 343

Query: 311 WCGMAVIVTSTIWVINMRAS 330
           W GM +I+ ST+ V+  ++S
Sbjct: 344 WSGMFLIIGSTLVVLKFKSS 363

>TPHA0G01050 Chr7 (210214..211158) [945 bp, 314 aa] {ON} Anc_8.804
           YMR253C
          Length = 314

 Score =  318 bits (814), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 162/325 (49%), Positives = 227/325 (69%), Gaps = 14/325 (4%)

Query: 30  MVVSTKILENDPLKTSQPRINPLQILLVRMSITYCCTLVYMHWNKKSVPDIPWGPASCRK 89
           M VSTK+LE    KT + RI PLQILL+RM +T    +VYM++N++++P +P+G  + R 
Sbjct: 1   MQVSTKVLETMGDKTEEDRIKPLQILLLRMVVTSIALVVYMYYNRRTIPYVPFGNPAVRG 60

Query: 90  WLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSI 149
           WLILRGI GF GVFGMY+SLMYL+ISDAVLI+FM+P+ TI  ++L+L E  S +E +GS 
Sbjct: 61  WLILRGIFGFIGVFGMYYSLMYLTISDAVLISFMAPSFTIISAWLVLHESISPIECMGSA 120

Query: 150 ISFSGVVLIIRPTFLFGQQTQGQEASQDDIVETQNPKLRLVAIGVSLLGVCGLSSVYIII 209
           +S SGV+LI+RPTF+FG      ++   D     +P  R +AI  +L G   LS VYI+I
Sbjct: 121 LSLSGVILIVRPTFIFG---AANDSGNSDSTFNHDPAGRCIAIVFALFGAMSLSGVYIVI 177

Query: 210 RYIGNKAHAIMSVSYFSLVTTVVAALGVILIPSMTLQLPHSWKQWGLFLNLGVSGFIHQI 269
           R+IG++AHAIM+V+YFS VT VV+  G+++IP    Q   ++K   LFL +G+ GFIHQ+
Sbjct: 178 RFIGDRAHAIMNVNYFSFVTGVVSFFGILVIPGFKFQKIDNFKGLNLFLLIGICGFIHQL 237

Query: 270 LLTMGIQR-ERAGRGSLMTYTQVIYAVFWDVVLFHHWPNIWTWCGMAVIVTSTIWVINMR 328
           LL+MGIQR  +A +GSLM+YTQ+IYA+FWDV+++  WPN+++  GM +I+ STI VI M+
Sbjct: 238 LLSMGIQRVTKASKGSLMSYTQLIYAIFWDVIIWGKWPNVFSIIGMILIIGSTITVIKMK 297

Query: 329 ASKQNVVATSELLSTSDFELDELED 353
                     E LS    E  EL++
Sbjct: 298 ----------EKLSERQSEYIELQE 312

>KNAG0B03560 Chr2 complement(687312..688529) [1218 bp, 405 aa] {ON}
           Anc_5.551 YML018C
          Length = 405

 Score = 37.0 bits (84), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 36/65 (55%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGV 155
           I+ F   F    +L Y S+S   +++  S   T+F+  L   E  ++L+ +G++ISF G+
Sbjct: 150 ILWFLANFATNAALAYTSVSSQTILSSTSSFFTLFIGALCNVESINRLKLIGAVISFVGI 209

Query: 156 VLIIR 160
            L+ R
Sbjct: 210 TLVTR 214

>YML018C Chr13 complement(234771..235952) [1182 bp, 393 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the membrane
           of the vacuole; physical interaction with Atg27p
           suggests a possible role in autophagy; YML018C is not an
           essential gene
          Length = 393

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 12/125 (9%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQ 167
           SL + S++   +++  S   T+F+  +   E  SK + LGS ISF G++++ +       
Sbjct: 147 SLAFTSVASQTILSTTSSFFTLFIGAICHVESLSKSKVLGSFISFVGIIMVTKSDSHQRY 206

Query: 168 QTQGQEASQDDIVETQNPKLRLVAIGVSLLGVCG--LSSVY--IIIRYIGNKAHAIMSVS 223
           Q    + S DD    Q      V IG +LL + G  L  VY  ++ R +G++    M + 
Sbjct: 207 QRHIADVSGDDNDAVQ------VLIG-NLLALAGAVLYGVYSTLLKREVGDETRVNMKI- 258

Query: 224 YFSLV 228
           +F  V
Sbjct: 259 FFGFV 263

>TDEL0A04140 Chr1 (737337..738485) [1149 bp, 382 aa] {ON} Anc_5.551
           YML018C
          Length = 382

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 72/155 (46%), Gaps = 16/155 (10%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIR----PTF 163
           SL Y S++   +++  S   T+F+  L   E  SK++ +GS++SF G++L+ R    PT 
Sbjct: 135 SLSYTSVASQTILSSTSSFFTLFVGALCRVEKISKVKVIGSMVSFFGILLVTRSDSKPTH 194

Query: 164 LFGQQTQGQEASQDDIVETQNPKLRLVAIGVSLLGVCGLSSVY--IIIRYIGNKAHAIMS 221
           +  +   G      DI++  N   + +   +  L    L  VY  ++ R + +++   M 
Sbjct: 195 I--KPLPGSR----DILDQNNDAFKTLIGNILALLGALLYGVYSTLLKRKVKDESRVNMK 248

Query: 222 VSYFSLVTTVVAALGVILIPSMTLQLPHSWKQWGL 256
           V +F  V        + L PSM L     W+ + L
Sbjct: 249 V-FFGFVGLFTL---IFLWPSMILLHYMGWETFEL 279

>TBLA0D01480 Chr4 complement(363558..364880) [1323 bp, 440 aa] {ON}
           Anc_5.551 YML018C
          Length = 440

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 40/76 (52%)

Query: 99  FFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLI 158
           F   F    SL Y S++   +++  S   T+F+  L   E  +K++  GS++SF G++L+
Sbjct: 173 FVANFATNASLAYTSVASQTILSSTSSFFTLFVGGLFHVECVTKIKVFGSVVSFVGILLV 232

Query: 159 IRPTFLFGQQTQGQEA 174
            +  ++    ++  +A
Sbjct: 233 TKTDYVSMVNSESVKA 248

>Smik_13.133 Chr13 complement(223651..224832) [1182 bp, 393 aa] {ON}
           YML018C (REAL)
          Length = 393

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 61/125 (48%), Gaps = 12/125 (9%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQ 167
           SL + S++   +++  S   T+F+  +   E  +K + LGS ISF G++++ +       
Sbjct: 147 SLAFTSVASQTILSTTSSFFTLFIGAICHVESLNKSKILGSFISFVGIIMVTKSDSDQHY 206

Query: 168 QTQGQEASQDDIVETQNPKLRLVAIGVSLLGVCG--LSSVY--IIIRYIGNKAHAIMSVS 223
           Q    + S DD     N  +R  A+  +LL + G  L  VY  ++ R +G++    M + 
Sbjct: 207 QRHIVDVSGDD-----NDTMR--ALMGNLLALAGAVLYGVYSTLLKREVGDETRVNMKI- 258

Query: 224 YFSLV 228
           +F  V
Sbjct: 259 FFGFV 263

>SAKL0G05456g Chr7 (448553..449737) [1185 bp, 394 aa] {ON} similar
           to uniprot|Q03730 YML018C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 394

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 38/72 (52%), Gaps = 6/72 (8%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQ 167
           SL Y S++   +++  S   T+ +  L   E  ++++ +GSI+SF G+VL+ R       
Sbjct: 142 SLSYTSVASQTILSSTSSFFTLLVGALCHAEVINRIKVIGSIVSFIGIVLVTR------S 195

Query: 168 QTQGQEASQDDI 179
            +    A+ D++
Sbjct: 196 DSTASAATSDNV 207

>CAGL0M04499g Chr13 (494202..495611) [1410 bp, 469 aa] {ON} highly
           similar to uniprot|P09368 Saccharomyces cerevisiae
           YLR142w PUT1 Proline oxidase
          Length = 469

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 49/92 (53%), Gaps = 4/92 (4%)

Query: 3   LQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMSIT 62
           +Q + K+  K  YG  L++ S+ + S M+ +TKIL++ P    +  I   Q+L +  ++T
Sbjct: 353 IQDLLKNGTKSYYGH-LVVASHNYGSQML-ATKILKDAPENVGKANIVLGQLLGMSDNVT 410

Query: 63  YCCTLVYMHWNKKSVPDIPWGPASCRKWLILR 94
           +   L+  H  K  +  +PWGP    K  +LR
Sbjct: 411 H--DLITKHGAKNIIKYVPWGPPLETKDYLLR 440

>KLLA0B01177g Chr2 (94268..95512) [1245 bp, 414 aa] {ON} similar to
           uniprot|Q03730 YML018C Saccharomyces cerevisiae
          Length = 414

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 34/56 (60%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTF 163
           SL Y S++   +++  S   T+ +S L   E  +K++ LGSI+SF G++++ +  +
Sbjct: 161 SLSYTSVASQTILSSTSSFFTLLVSALCHVESVNKIKVLGSIVSFIGIIMVTKSDY 216

>ZYRO0D13090g Chr4 (1102902..1104014) [1113 bp, 370 aa] {ON} similar
           to uniprot|Q03730 YML018C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 370

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGV 155
           I+ F   F    SLMY S++   +++  S   T+F+  L   E  +K + +GS++SF G+
Sbjct: 125 IIWFLANFVTNASLMYTSVASQTILSSTSSFFTLFVGSLCNVESVNKAKVVGSLVSFMGI 184

Query: 156 VLI 158
           +L+
Sbjct: 185 MLV 187

>NCAS0F01200 Chr6 (234603..235706) [1104 bp, 367 aa] {ON} Anc_5.551
           YDR438W
          Length = 367

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 5/73 (6%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGV 155
           I+ F   F    SL + SIS   +++  S   T+F+S LL  E  + L+ +G ++SF G+
Sbjct: 120 ILWFMANFMTNSSLQFTSISSQTILSSTSSFFTLFISALLKIEKINNLKIVGLLLSFFGI 179

Query: 156 VLIIR-----PTF 163
           +++ +     PTF
Sbjct: 180 IILTKSDNNSPTF 192

>Skud_13.133 Chr13 complement(221096..222277) [1182 bp, 393 aa] {ON}
           YML018C (REAL)
          Length = 393

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 6/122 (4%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQ 167
           SL + S++   +++  S   T+F+  +   E  +K + LGS ISF G++++ +       
Sbjct: 147 SLAFTSVASQTILSTTSSFFTLFIGAICHVESLNKSKILGSFISFIGIIMVTKSDSHQRY 206

Query: 168 QTQGQEASQDDIVETQNPKLRLVAI-GVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFS 226
           Q    + S DD    Q     L+A+ G  L GV       ++ R +G++    M + +F 
Sbjct: 207 QRHIADISSDDNDTMQVLMGNLLALAGAVLYGVYST----LLKREVGDETRVNMKI-FFG 261

Query: 227 LV 228
            V
Sbjct: 262 FV 263

>TPHA0D02500 Chr4 (515403..516755) [1353 bp, 450 aa] {ON} Anc_5.551
           YML018C
          Length = 450

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 33/56 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTF 163
           SL Y S++   +++  S   T+F+ ++   E  +K + LGS++SF G++L+    +
Sbjct: 180 SLAYTSVASQTILSSTSSFFTLFIGYIWNIEKITKSKTLGSLVSFIGIILVTHSDY 235

>Suva_13.141 Chr13 complement(225107..226309) [1203 bp, 400 aa] {ON}
           YML018C (REAL)
          Length = 400

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIR 160
           SL + S++   +++  S   T+F+  L   E  S+ + LGS ISF G++++ R
Sbjct: 147 SLAFTSVASQTILSTTSSFFTLFIGALCHVESLSRSKILGSFISFIGIIMVTR 199

>AER331C Chr5 complement(1245399..1246733) [1335 bp, 444 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML018C and
           YDR438W
          Length = 444

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGV 155
           ++ F   F    SL + S+  A +++  S   T+ L  L+  E  S L+ LGS++S  G+
Sbjct: 194 VLWFVANFVTNASLGFTSVGSATILSSTSSFFTLLLGVLMKTESASVLKVLGSVVSSLGI 253

Query: 156 VLIIR 160
           VL+ +
Sbjct: 254 VLVTK 258

>NDAI0C00940 Chr3 complement(180857..182200) [1344 bp, 447 aa] {ON}
           Anc_5.551
          Length = 447

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGV 155
           I+ F   F    SL Y S++   +++  S   T+F+  L   E  + L+ +GS +SF G+
Sbjct: 185 ILWFLANFATNASLAYTSVASQTILSSTSSFFTLFIGALFHVEMINPLKVIGSTVSFIGI 244

Query: 156 VLIIR 160
           + +I 
Sbjct: 245 MSVIE 249

>Ecym_4224 Chr4 complement(468353..469753) [1401 bp, 466 aa] {ON}
           similar to Ashbya gossypii AGL165W
          Length = 466

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 19  LLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMSITYCCTLVYMHWNKKSVP 78
           +++ S+ ++S M+ +  ++ +D    S  + N +   L+ MS      L+Y H  K  + 
Sbjct: 366 MVVASHNYHSQMLATMLLVSSD---GSYGKANVVLAQLLGMSDNVTHDLIYNHGAKNIIK 422

Query: 79  DIPWGPASCRKWLILR 94
            +PWGP    K  +LR
Sbjct: 423 YVPWGPPEETKDYLLR 438

>Kpol_2000.60 s2000 (119866..122967) [3102 bp, 1033 aa] {ON}
           (119866..122967) [3102 nt, 1034 aa]
          Length = 1033

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 27  NSSMVVSTKILENDPLKTSQPRINPLQILLVRMSITYCCTLVYMHWNKKSVPDIP 81
           N    ++ K++EN P K S P +  +  +L+  S  +   L Y++W +K +P+ P
Sbjct: 864 NGQASITNKVVEN-PEKKSSPYLYYIYAILLYSSRGFLSALQYLNWLEKDIPNDP 917

>KAFR0C05510 Chr3 (1102100..1103311) [1212 bp, 403 aa] {ON}
           Anc_5.551 YML018C
          Length = 403

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 3/92 (3%)

Query: 70  MHWNKKSVPDIPWGPASCRKWLILRG---IMGFFGVFGMYFSLMYLSISDAVLITFMSPT 126
           +H N   + +I     S ++ + L     I+ F        SL Y S++   +++  S  
Sbjct: 121 IHDNNHILTNISTQRLSLKETIRLSAQFCILWFLANLATNASLAYTSVASQTILSSTSSF 180

Query: 127 LTIFLSFLLLGEPFSKLEALGSIISFSGVVLI 158
            T+F+  L   E  +  + +GSIISF G++L+
Sbjct: 181 FTLFIGALCQVETLNHSKIVGSIISFGGIILV 212

>CAGL0G07018g Chr7 (668453..669628) [1176 bp, 391 aa] {ON} similar
           to uniprot|Q03730 Saccharomyces cerevisiae YML018c
          Length = 391

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQ 167
           SL Y S++   +++  S   T+F+      E   +++ +GS+ISF G++L+ +      Q
Sbjct: 154 SLGYTSVASQTILSSTSSFFTLFIGAAFRVETIDRVKVIGSLISFIGILLVTKSDVHIPQ 213

Query: 168 QTQ 170
            T 
Sbjct: 214 NTH 216

>KNAG0A02880 Chr1 complement(344974..346548) [1575 bp, 524 aa] {ON}
           Anc_8.348 YLR142W
          Length = 524

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 6/78 (7%)

Query: 19  LLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQIL--LVRMSITYCCTLVYMHWNKKS 76
           L+I S+ ++S ++ +T IL+      S   +N   IL  L+ M+      LV+ H  K  
Sbjct: 422 LVIASHNYHSQLI-ATNILDT---HKSNKFVNANVILGQLLGMADNVTYDLVHTHHVKNI 477

Query: 77  VPDIPWGPASCRKWLILR 94
           +  +PWGPA+  K  +LR
Sbjct: 478 IKYVPWGPANETKDYLLR 495

>KLTH0G04312g Chr7 (343552..344778) [1227 bp, 408 aa] {ON} similar
           to uniprot|Q03730 YML018C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 408

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIR 160
           SL Y S++   +++  S   T+ +  L   E  ++++ LGS+ISF G+V + +
Sbjct: 163 SLSYTSVASQTILSSTSSFFTLLIGSLFHVESVNRVKVLGSVISFVGIVFVTK 215

>KAFR0I00860 Chr9 (167141..168205) [1065 bp, 354 aa] {ON} Anc_5.551
           YML018C
          Length = 354

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%)

Query: 93  LRGIMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISF 152
           L  ++ F   F   FSL Y +++   +++  S   T+F+  LL  E     +  G ++SF
Sbjct: 109 LFAVLWFSAAFTSNFSLSYTTVASQTILSSTSSFFTLFIGVLLSIESIDSTKLFGLVVSF 168

Query: 153 SGVVLII 159
            G+V+++
Sbjct: 169 MGIVILV 175

>NCAS0H02680 Chr8 (529371..530642) [1272 bp, 423 aa] {ON} Anc_5.551
          Length = 423

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGV 155
           I+ F   F    SL Y S++   +++  S   T+F+  L   E  ++ + +GSIISF G 
Sbjct: 161 ILWFLANFVTNASLAYTSVASQTILSSTSSFFTLFIGSLCHVEQINRSKIIGSIISFLGT 220

Query: 156 VLIIR 160
           +L+ +
Sbjct: 221 MLVTK 225

>TDEL0F04720 Chr6 (887597..889036) [1440 bp, 479 aa] {ON} Anc_8.348
           YLR142W
          Length = 479

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 4/83 (4%)

Query: 12  KPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMSITYCCTLVYMH 71
           K  YG  L++ S+ ++S M+ +TK+LE       +  +   Q+L +  ++TY   L+  H
Sbjct: 371 KSTYGH-LVVASHNYHSQML-ATKLLEEKGSAAGKHNVVLGQLLGMADNVTY--DLITNH 426

Query: 72  WNKKSVPDIPWGPASCRKWLILR 94
             K  +  +PWGP    K  +LR
Sbjct: 427 GVKNIIKYVPWGPPLETKDYLLR 449

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,434,661
Number of extensions: 1302439
Number of successful extensions: 4217
Number of sequences better than 10.0: 72
Number of HSP's gapped: 4284
Number of HSP's successfully gapped: 72
Length of query: 353
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 242
Effective length of database: 40,753,473
Effective search space: 9862340466
Effective search space used: 9862340466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 66 (30.0 bits)