Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.4716.10ON65159427690.0
YPL263C (KEL3)6.10ON65159426660.0
Suva_16.426.10ON65459726060.0
Skud_16.146.10ON65259725680.0
TPHA0M002006.10ON63460015300.0
Kpol_1045.776.10ON65060915240.0
NCAS0D021906.10ON64560115050.0
ZYRO0F00484g6.10ON64359914940.0
ACR016W6.10ON64060414810.0
TBLA0G011106.10ON63860714680.0
KLLA0D00836g6.10ON64060214600.0
CAGL0A01067g6.10ON64160214600.0
TDEL0G046106.10ON63360014560.0
SAKL0E00880g6.10ON63660014540.0
NDAI0I027506.10ON66358314350.0
KAFR0B065006.10ON63660114220.0
KNAG0E027806.10ON65060414170.0
Kwal_56.223506.10ON65859913830.0
KLTH0C11528g6.10ON64260413551e-180
Kpol_1050.695.88ON10842591502e-09
NCAS0F005205.88ON10862601493e-09
KLTH0C01474g5.88ON10562551467e-09
Skud_8.2225.88ON11692511442e-08
Smik_8.2425.88ON11682511432e-08
Smik_16.685.88ON8942931386e-08
YHR158C (KEL1)5.88ON11642521387e-08
Suva_15.3575.88ON11722531387e-08
Kwal_14.10195.88ON9782601388e-08
TPHA0H010805.88ON8282671371e-07
YGR238C (KEL2)5.88ON8822931371e-07
KAFR0B043205.88ON9862631361e-07
KNAG0K005605.88ON11042531352e-07
KLLA0E15511g5.88ON9052591262e-06
SAKL0H02618g5.88ON10852061262e-06
CAGL0F07997g5.88ON9362631234e-06
Suva_7.5305.88ON8942601225e-06
ZYRO0B08228g5.88ON12932671225e-06
Ecym_20615.88ON13622061227e-06
TBLA0C065305.88ON11722541182e-05
Skud_7.5725.88ON8832541182e-05
NDAI0D026005.88ON11671491172e-05
Kpol_1010.625.88ON9732571153e-05
ADL149W5.88ON12112061136e-05
TDEL0G011205.88ON10092621128e-05
CAGL0I02090g5.88ON11362581092e-04
TPHA0A051705.88ON10162631055e-04
SAKL0C13530g3.15ON697112960.006
YOL141W (PPM2)3.15ON69577920.021
Smik_15.133.15ON71977890.045
TBLA0D021208.157ON1479118860.12
Suva_8.1755.440ON45394830.22
Suva_15.193.15ON70880820.28
Skud_15.133.15ON69581800.49
KNAG0D021008.157ON168788780.88
ZYRO0C00550g7.9ON84859771.2
KNAG0A011803.15ON67691771.2
Smik_1.97.9ON87457771.3
KAFR0C049107.9ON87861771.4
Suva_1.107.9ON89258761.5
ADR414C7.9ON78472752.2
NDAI0A088607.9ON85689742.8
ZYRO0G19426g8.157ON1594118742.8
Kpol_495.28.157ON151179742.9
CAGL0K02101g8.157ON1633116734.0
ZYRO0G05148g2.92ON109066724.8
YAL056W (GPB2)7.9ON88057725.4
KNAG0E041807.9ON81928716.1
TBLA0A043207.9ON83863707.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.471
         (651 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...  1071   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...  1031   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...  1008   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   993   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   593   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   591   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   584   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   580   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   575   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   570   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   566   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   566   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   565   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   564   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   557   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   552   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   550   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   537   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   526   e-180
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    62   2e-09
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    62   3e-09
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    61   7e-09
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    60   2e-08
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    60   2e-08
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    58   6e-08
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    58   7e-08
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    58   7e-08
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    58   8e-08
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    57   1e-07
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    57   1e-07
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    57   1e-07
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    57   2e-07
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    53   2e-06
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    53   2e-06
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    52   4e-06
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    52   5e-06
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    52   5e-06
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    52   7e-06
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    50   2e-05
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    50   2e-05
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    50   2e-05
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    49   3e-05
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    48   6e-05
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    48   8e-05
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    47   2e-04
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    45   5e-04
SAKL0C13530g Chr3 complement(1192946..1195039) [2094 bp, 697 aa]...    42   0.006
YOL141W Chr15 (56452..58539) [2088 bp, 695 aa] {ON}  PPM2AdoMet-...    40   0.021
Smik_15.13 Chr15 (24574..26733) [2160 bp, 719 aa] {ON} YOL141W (...    39   0.045
TBLA0D02120 Chr4 (535081..539520) [4440 bp, 1479 aa] {ON} Anc_8....    38   0.12 
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...    37   0.22 
Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W (...    36   0.28 
Skud_15.13 Chr15 (21709..23796) [2088 bp, 695 aa] {ON} YOL141W (...    35   0.49 
KNAG0D02100 Chr4 (351677..356740) [5064 bp, 1687 aa] {ON} Anc_8....    35   0.88 
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    34   1.2  
KNAG0A01180 Chr1 (9765..11795) [2031 bp, 676 aa] {ON} Anc_3.15 Y...    34   1.2  
Smik_1.9 Chr1 (22221..24845) [2625 bp, 874 aa] {ON} YAL056W (REAL)     34   1.3  
KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9...    34   1.4  
Suva_1.10 Chr1 (16429..19107) [2679 bp, 892 aa] {ON} YAL056W (REAL)    34   1.5  
ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}...    33   2.2  
NDAI0A08860 Chr1 complement(2037552..2040122) [2571 bp, 856 aa] ...    33   2.8  
ZYRO0G19426g Chr7 complement(1614527..1619311) [4785 bp, 1594 aa...    33   2.8  
Kpol_495.2 s495 complement(6278..9313,9316..10815) [4536 bp, 151...    33   2.9  
CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} simi...    33   4.0  
ZYRO0G05148g Chr7 complement(413934..417206) [3273 bp, 1090 aa] ...    32   4.8  
YAL056W Chr1 (39259..41901) [2643 bp, 880 aa] {ON}  GPB2Multiste...    32   5.4  
KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {O...    32   6.1  
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    32   7.5  

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score = 1071 bits (2769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/594 (88%), Positives = 527/594 (88%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY
Sbjct: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC
Sbjct: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
           VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY
Sbjct: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237

Query: 238 KWSKIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPD 297
           KWSKIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPD
Sbjct: 238 KWSKIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPD 297

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357
           PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH
Sbjct: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357

Query: 358 LELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXXXXX 417
           LELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKS           
Sbjct: 358 LELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDDENDD 417

Query: 418 YTATGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVWELGE 477
           YTATGSNSI                 ITISNQLPHPRFNAATCVVGDSLFIYSGVWELGE
Sbjct: 418 YTATGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWELGE 477

Query: 478 KDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXXXXXX 537
           KDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLG                        
Sbjct: 478 KDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEEDDEDQSEEE 537

Query: 538 XXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN 597
             AGLL             GQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN
Sbjct: 538 QDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN 597

Query: 598 NRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDVTTKPSKRR 651
           NRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDVTTKPSKRR
Sbjct: 598 NRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDVTTKPSKRR 651

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/594 (85%), Positives = 515/594 (86%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F+KKQ ELEHVDIT+VE+PSCRTHPLMFANPQHNKHELFIFGGEFTD ETKLTHFYNDLY
Sbjct: 58  FSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC
Sbjct: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
           VERKF KLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIS Y
Sbjct: 178 VERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTY 237

Query: 238 KWSKIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPD 297
           KW+K+ETNSKPDARSGHCFIPTDNSAILMGGYCK IAKNNKNLMKGKILNDAWKLNLTPD
Sbjct: 238 KWTKLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPD 297

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357
           PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH
Sbjct: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357

Query: 358 LELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXXXXX 417
           LELNKWSKLRIK QRQT+++NSPATSKRKSNKDQEKELQDLLNSILAKS           
Sbjct: 358 LELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDDDNDD 417

Query: 418 YTATGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVWELGE 477
            + TG NSI                 ITISNQLPHPRFNAATCVVGDSLFIYSGVWELGE
Sbjct: 418 NSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWELGE 477

Query: 478 KDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXXXXXX 537
           KDYPINSFYSIDLNKLDGVKVYWE+LSAIEEAKRLG                        
Sbjct: 478 KDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDDEEDEDDGEEE 537

Query: 538 XXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN 597
             AG L              QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN
Sbjct: 538 QDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISN 597

Query: 598 NRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDVTTKPSKRR 651
           NRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERD TTKPSKRR
Sbjct: 598 NRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDTTTKPSKRR 651

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/597 (83%), Positives = 510/597 (85%), Gaps = 3/597 (0%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           FTKKQTELEHVDITAVERPSCR HPLMFANPQHNKHELFIFGGEFTD ETKLTHFYNDLY
Sbjct: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SYSIKNNSWKKYVSQNAPLPRSS AVAVH SGIALLHGGEFSSPKQSKFYHYSDTWLFDC
Sbjct: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
            E+KF KLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLG+GQTSYLNDLWCFDISNY
Sbjct: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237

Query: 238 KWSKIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPD 297
           KW+K+ETN+KPDARSGHCF+PTDNSAILMGGYCKTIAKNNKNLMKGKILND+WKL LTPD
Sbjct: 238 KWTKLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPD 297

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357
           PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESL+S+FYNDLYMFH
Sbjct: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFH 357

Query: 358 LELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXXXXX 417
           LELNKWSKLRIK QR T+NRN+PATSKRKSNKDQEKELQDLLNSILAKS           
Sbjct: 358 LELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLNDEEDDNDD 417

Query: 418 YTA--TGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVWEL 475
            TA  TG+NS                  ITISNQLPHPRFNAATCVV DSLFIYSGVWEL
Sbjct: 418 STATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 477

Query: 476 GEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXXXX 535
           GEKDYPINSFYSIDLNKLDGVKVYWE+LS +EEAKRLG                      
Sbjct: 478 GEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDEDDDEDDDE 537

Query: 536 XXXXAG-LLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 594
                  LL             GQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS
Sbjct: 538 EEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 597

Query: 595 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDVTTKPSKRR 651
           ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERD T KPSKRR
Sbjct: 598 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDATAKPSKRR 654

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/597 (83%), Positives = 509/597 (85%), Gaps = 5/597 (0%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           FTKKQTELEHVDITAVER SCRTHPLMFANPQHNK ELFIFGGEFTD ETKLTHFYNDLY
Sbjct: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SYSIKNNSWKKYVS+NAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC
Sbjct: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
            ERKF KLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY
Sbjct: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237

Query: 238 KWSKIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPD 297
           KW+K+ETN+KP+ARSGHCFIPTDNSAILMGGYCK IAKNNKNLMKGKILNDAWKLNLTPD
Sbjct: 238 KWTKLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPD 297

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357
           PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH
Sbjct: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357

Query: 358 LELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXXXXX 417
           LELNKWSKLRIK QRQT+N+N+P TSKRKSNKDQEKELQDLLNSILAKS           
Sbjct: 358 LELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLNDDDDDDN- 416

Query: 418 YTATGSNSIXXXXXXXXXXXXXXX-XXITISNQLPHPRFNAATCVVGDSLFIYSGVWELG 476
            T TGSNSI                  ITISNQLPHPRFNAATCVV DSLFIYSGVWELG
Sbjct: 417 -TTTGSNSIDGDDEGEDDDSDLDNPENITISNQLPHPRFNAATCVVDDSLFIYSGVWELG 475

Query: 477 EKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXX--XXXXXXXXXXXXXXXXXXX 534
           EKDYPINSFYSIDLNKLDGV VYWE+LS IEEAKRLG                       
Sbjct: 476 EKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDDDDDGEDND 535

Query: 535 XXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 594
                  LL             GQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS
Sbjct: 536 EEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 595

Query: 595 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDVTTKPSKRR 651
           ISNN++LKGK LKTKSFE+CEDRWWERRDQVTLEEERLEDTGGIIERD TTK SKRR
Sbjct: 596 ISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGGIIERDTTTKISKRR 652

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/600 (51%), Positives = 386/600 (64%), Gaps = 27/600 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F K+Q + E +++ +V++P+ R +  M ANP H K EL +FGGE T  E  +THFYNDLY
Sbjct: 56  FKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYNDLY 115

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +++  N+ WKK  SQN+P+PRSSAA+A HPSGIALLHGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 116 TFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDC 175

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             R++ K+E   + + PSARSGHRI  WKNYFIL GGFRDLG+  TSYLND W FDI++Y
Sbjct: 176 TTREWTKVE---QKNGPSARSGHRITVWKNYFILHGGFRDLGS-TTSYLNDSWLFDITSY 231

Query: 238 KWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           KW +IE    +  PDARSGH  IPT   A+L GGYCK   K  K L KGKIL D W L +
Sbjct: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCK--VKAGKGLQKGKILGDCWYLKM 289

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESL+S+FYNDL+
Sbjct: 290 KADPSAVRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSIFYNDLF 348

Query: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXX 414
            + +E N+W  L+++SQR+   R        KS+K++E ELQ++LN IL K+        
Sbjct: 349 SYQIESNRWYALQLRSQRKKVVR-----LNNKSSKEKELELQNILNEILEKANLKDDDED 403

Query: 415 XXXYTATGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVWE 474
                   SN +                   + NQLPH RFNA+T VV D+LFIY GVWE
Sbjct: 404 ANEL----SNGLGSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWE 459

Query: 475 LGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXXX 534
           LGEKDY I+S YSIDLNKLDGV VYWE L  IE+AK LG                     
Sbjct: 460 LGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEEDEDDEDDDEEE 519

Query: 535 XXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 594
                                     MEIPD R WLPHPK FE+LR FY+R GA+FL W+
Sbjct: 520 TVDQKL----VAEEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWA 575

Query: 595 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTKPSKRR 651
           ISNN++ +GK LKTKSFELC+DRWWERRDQV +EE++LE+ GG   +IE+D TTK +KRR
Sbjct: 576 ISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKD-TTKSTKRR 634

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/609 (50%), Positives = 387/609 (63%), Gaps = 28/609 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F K+Q   E ++I +VERPS R +P M  NP H K EL +FGGE T+ +T  T F+NDLY
Sbjct: 55  FKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFFNDLY 114

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SY+ +N+ W++Y S+N+P+PRSSAA+A HPSG+AL+HGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 115 SYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTWLLDC 174

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++ K+E   + + PSARSGHRI  WKNYF+L GGFRDLG   T+YLND W FDI+NY
Sbjct: 175 STKEWTKVE---QKNGPSARSGHRISIWKNYFMLHGGFRDLGTS-TTYLNDCWLFDITNY 230

Query: 238 KWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           KW +IE    +  PDARSGH FIPT   A+L GGYCK   K  K L KGKIL D W L +
Sbjct: 231 KWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCK--VKAGKGLQKGKILTDCWYLKM 288

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESL+S+FYNDL+
Sbjct: 289 KADPTAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSMFYNDLF 347

Query: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXX 414
            + +E+N+W  L+++ QR+   R +      KS+KD+EKELQDLLN IL K+        
Sbjct: 348 SYQIEINRWFALQLRPQRKKVVRLN-----NKSSKDKEKELQDLLNQILEKANLNDKDDK 402

Query: 415 XXXYTATG--------SNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSL 466
                           ++                     +  QLPHPRFNA   VV D+L
Sbjct: 403 DQEDEDAKAIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTL 462

Query: 467 FIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXX 526
           FIY GVWELGEKDY I+SFYSIDLN+ DGV V WE+LS IE AK  G             
Sbjct: 463 FIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGD 522

Query: 527 XXXXXXXXXXXXXAGLLXXXXXXXXXXXXXGQA-QMEIPDERSWLPHPKPFETLRAFYLR 585
                          L+              Q  +MEIPD   WLPHPKPFE+LR FY+R
Sbjct: 523 SDDEDDGEEEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVR 582

Query: 586 EGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGI---IERD 642
            GA FL W+ISNNR+ +GK LK KSF+LC+DRWW+RRDQV +EE+++E+ GGI   IE+D
Sbjct: 583 TGATFLEWAISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKD 642

Query: 643 VTTKPSKRR 651
            T+K +KRR
Sbjct: 643 -TSKSTKRR 650

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/601 (50%), Positives = 383/601 (63%), Gaps = 18/601 (2%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F  +Q + EHV++ ++ +P+ R +  M   P H+K EL IFGGEFT+ ET +THFYN+L 
Sbjct: 56  FKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYNELI 115

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +YS  N  W+K  SQN+P+PRSSAA+  HPSGIALLHGGEFSSPKQ+ FYHYSDTWL D 
Sbjct: 116 TYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDT 175

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++ K++       P  RSGHRI  WKNYFIL GGF+DLG+  TSY ND WCFDI+ Y
Sbjct: 176 HTKEWTKMDSA---KGPPGRSGHRITIWKNYFILSGGFKDLGHS-TSYFNDCWCFDITTY 231

Query: 238 KWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           KW +IE    +  PDARSGH +IPT+   IL GGYCK   K  K L KGKILND W L +
Sbjct: 232 KWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKV--KAGKGLQKGKILNDCWYLKM 289

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D  + +WE+ K    QPSPRVG S   + + + + FGGVYD +ETEESLES+FYNDL+
Sbjct: 290 KSDLSQVRWERRKKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESIFYNDLF 348

Query: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSX-XXXXXX 413
            +++E N+W  L ++  ++   +    +S  KS+K++EKELQDLLN IL K+        
Sbjct: 349 SYNVESNRWFSLSLRKAQKF--KKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDD 406

Query: 414 XXXXYTATGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVW 473
                                         +T+ +QLPHPRFNAAT VV DSLFIY G+W
Sbjct: 407 DEISTGTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIW 466

Query: 474 ELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXX 533
           E+GEKDY I+S YSIDLNKLDGV  YWE+L  IE+AK +G                    
Sbjct: 467 EMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEE 526

Query: 534 XXXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 593
                   L+                +MEIPD R WLPHPKPFE+LRAFY+REGA FL W
Sbjct: 527 EIEDKK--LVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEW 584

Query: 594 SISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED---TGGIIERDVTTKPSKR 650
           +ISNN++++GK LK KSF+LCEDRWWERRDQV +EE++LE+    G +IE+D +   SKR
Sbjct: 585 AISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKR 644

Query: 651 R 651
           R
Sbjct: 645 R 645

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/599 (48%), Positives = 379/599 (63%), Gaps = 18/599 (3%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F K+Q + E V + +V++PS R +P + +NP H K EL +FGGE+T+     THFYN+L+
Sbjct: 57  FKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELF 116

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +++  N+ W+K  SQNAP+PRSSAA+A HPSGIALLHGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 117 TFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDC 176

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++ KL+   + + P++RSGHR+  WKN+FI++GGFRDLG   T+YLND W FDI+ +
Sbjct: 177 TTKEWTKLD---QKNGPASRSGHRMTVWKNFFIMYGGFRDLGTS-TTYLNDCWLFDITTH 232

Query: 238 KWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           KW+++E    +  PDARSGH FIP    AIL GGYCK   K  K L KGKIL D W L +
Sbjct: 233 KWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCK--VKAGKGLQKGKILTDCWYLKM 290

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
              P   +WE+ K    QPSPRVG S  +  + + V FGGVYD +ETEESL+S FYNDL+
Sbjct: 291 NSTPSAIRWERRKKQGFQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLDSNFYNDLF 349

Query: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXX 414
            F ++ N+W  L ++ QR+   + S     + S KDQEKELQD LN IL ++        
Sbjct: 350 TFQIKTNRWYSLSLRPQRKKQVKIS-----KSSTKDQEKELQDHLNRILQQAQLYDQDED 404

Query: 415 XXXYTATGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVWE 474
                A                        TIS QLPHPRFN +  VV D+LFIY G+WE
Sbjct: 405 KEDDKAIREQFEDENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWE 464

Query: 475 LGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXXX 534
           LG+KDY I+SFY IDLNK+DGV VYWE L+ IE+AK+L                      
Sbjct: 465 LGDKDYNIDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDD 524

Query: 535 XXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 594
                  +L              + +MEIPD R WLPHPK FE+LRAFY+R G  FL W+
Sbjct: 525 EEEVRDQVLVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWA 584

Query: 595 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTKPSKR 650
           ISNNR+ +GK LK KSF+LC+DRWWERRDQV +EE+++E+ GG   I+ER+   K  +R
Sbjct: 585 ISNNRDARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/604 (48%), Positives = 384/604 (63%), Gaps = 28/604 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F ++Q E E V++  VERP  R+   + ANP HNK EL +FGGE+T+  T +THFYNDL+
Sbjct: 55  FKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDLF 114

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
            YS+  + WKKY SQN+P+PRSSAA+A HPSG+ L+HGGEFSSPKQ+ FYHYSDTWLFDC
Sbjct: 115 IYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDC 174

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
              ++ K+E   + + PS+RSGHR+  WKNY IL GGFRDLG   T+YLND W FDI+ Y
Sbjct: 175 ATHEWTKIE---QKNGPSSRSGHRMTVWKNYIILHGGFRDLGTS-TTYLNDCWLFDITTY 230

Query: 238 KWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           KW +++    +  PDARSGH  +PT   AIL GGYCK   K  K L KGKIL D W L +
Sbjct: 231 KWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCK--VKAGKGLQKGKILTDCWYLKM 288

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D    +WE+ K    QPS R G S  +  + + + FGGVYD +ETEE L+S+FYNDL+
Sbjct: 289 KSDVTAIRWERRKKQGFQPSSRAGCSM-VHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347

Query: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXX 414
            +H+E N+W  + +++QR +  +++P     KSN+D++KEL+D+LN+IL K+        
Sbjct: 348 TYHIETNRWYSVSLRAQRHSKVKSAP-----KSNRDKDKELEDMLNAILKKANLDDDDGD 402

Query: 415 XXXYTATGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVWE 474
               T      +                   I  +LPHPRFNA+T +V D+LFI+ GVWE
Sbjct: 403 EDGKTI--EEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWE 460

Query: 475 LGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXXX 534
            GEKDY I+SFYSID+NK+DGVKVYWE+++A+E AK LG                     
Sbjct: 461 QGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDDEE 520

Query: 535 XXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 594
                  +               +   EIPD R WLPHPK FE+LRAFY+R GA+FL W+
Sbjct: 521 EHSDRKLV---AEEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWA 577

Query: 595 ISNNRN----LKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTKP 647
           I+N  N     KGK LK  SF+LC++RWWERR+QV +EE++LE+ GG   +IE+D  TKP
Sbjct: 578 ITNKHNTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDF-TKP 636

Query: 648 SKRR 651
           +KRR
Sbjct: 637 TKRR 640

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/607 (49%), Positives = 388/607 (63%), Gaps = 37/607 (6%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F K+Q + E ++I  V +P+ R +  M +NP H K+EL +FGGE T + T    FYNDL+
Sbjct: 56  FKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTSTTTT---FYNDLF 112

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +Y+ +N+ WKKY SQN+P+PRSS+A+  HP+GIALLHGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 113 TYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDC 172

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             ++++K+E     + PSARSGHR+  WKN+ IL GGFRDLG   T+YL DLW FD++ Y
Sbjct: 173 ATKEWSKVE---NKNGPSARSGHRMTVWKNFIILHGGFRDLGTS-TTYLKDLWLFDVTKY 228

Query: 238 KWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           KW+++E    ++ PDARSGH  IPT + A+L GGYCK   K  K L KGKIL+D W L +
Sbjct: 229 KWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCK--VKAGKGLQKGKILSDCWYLKM 286

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESL+S+FYNDL+
Sbjct: 287 KSDVSGIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLDSLFYNDLF 345

Query: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAK-------SX 407
            + +E+N+W  L ++SQR+ + +  P T+     KD+EKELQD+LNSIL K       S 
Sbjct: 346 TYQIEINRWFSLSMRSQRKKTIKIGPKTT-----KDKEKELQDILNSILKKNNLTDDDSE 400

Query: 408 XXXXXXXXXXYTATGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLF 467
                          SNS                    + NQLPH RFNA T VV D+L+
Sbjct: 401 DPNAIEEELKINDDESNS------EDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLY 454

Query: 468 IYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXX 527
           I+ G WELGEKDY I+SFYSIDLNKLDGV VYWE++  IE AK LG              
Sbjct: 455 IFGGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEE 514

Query: 528 XXXXXXXXXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREG 587
                          L              + +MEIPD R WLPHPKPFETLRAFY+R G
Sbjct: 515 DEDDGEEEIVDQK--LVAEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTG 572

Query: 588 ANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVT 644
           A FL W+ISNNR+ KGK LK KSFEL EDRWWERRDQV +EE+++E+ GG   I+ERD T
Sbjct: 573 ATFLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERD-T 631

Query: 645 TKPSKRR 651
           T+ +KRR
Sbjct: 632 TQVNKRR 638

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/602 (48%), Positives = 380/602 (63%), Gaps = 23/602 (3%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F ++Q   E +++  V+RP  R +P MF NP H K EL +FGGE T  ET  THFYNDL+
Sbjct: 54  FKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYNDLF 113

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
            YS+  ++WK+Y SQN+P+PRSSAAVA HP+G+AL+HGGEFSSPKQ+ FYHYSD+WLFDC
Sbjct: 114 VYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDC 173

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++ K+E   + + PSARSGHR+  WKN+ IL GGFRDLG   T+YLNDLW FDI+NY
Sbjct: 174 SSKEWTKVE---QKNGPSARSGHRMAIWKNFIILHGGFRDLGTS-TTYLNDLWVFDITNY 229

Query: 238 KWSKIETNSK---PDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E  +    PDARSGH  I T   A+L GGY K   K  K L KGKIL+D W L +
Sbjct: 230 KWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTK--VKAGKGLQKGKILSDCWYLKM 287

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D    +WE+ K   +QPSPRVG S  +  + + V FGGVYD +ETEESL S+FYN+LY
Sbjct: 288 KSDLGSIRWERRKKQGSQPSPRVGCSM-VHHKGRGVLFGGVYDFEETEESLRSIFYNELY 346

Query: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXX 414
            + +E N+W  + ++ QR+  N       + KSN++++KEL+D+LN IL K+        
Sbjct: 347 TYQIENNRWYAMSLRPQRKKKN-----FVQSKSNRNKDKELEDILNQILDKANLRDAEDD 401

Query: 415 XXXYTATG--SNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGV 472
                     +                        + LPH RFNAAT VV D+LFI+ G 
Sbjct: 402 DESKVIEEQLNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGT 461

Query: 473 WELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXX 532
            E+GEKDYPI+SFYSID+NKLDGVKVYWEEL  +E A++LG                   
Sbjct: 462 VEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDG 521

Query: 533 XXXXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLT 592
                     L              + + EIPD R WLPHPK FETLRAFY+R G  FL 
Sbjct: 522 EEEIVDSK--LEAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLE 579

Query: 593 WSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTKPSK 649
            +IS+NR+ KGK LKTKSFELC+DRWWERR+QV +EE++LE+ GG   +IE+D T+K  +
Sbjct: 580 LAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKD-TSKTQR 638

Query: 650 RR 651
           RR
Sbjct: 639 RR 640

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/602 (50%), Positives = 385/602 (63%), Gaps = 21/602 (3%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQ--HNKHELFIFGGEFTDSETKLTHFYND 115
           F K+Q + E V + +V++ + R +P M  NP    +K EL +FGGEFT+ +T  T FYND
Sbjct: 53  FKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTTFYND 112

Query: 116 LYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF 175
           L++++ +NN WK+Y SQNAP+PRSSAA+A HPSGIALLHGGEFSSPKQ+ FYHYSDTW+ 
Sbjct: 113 LHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWIL 172

Query: 176 DCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIS 235
           DC  +++ K++       PSARSGHRI  WKN+FIL GGFRDLG   T+YL+D W FDI+
Sbjct: 173 DCNTKEWAKVD---AKVGPSARSGHRITVWKNFFILHGGFRDLGTS-TTYLSDCWLFDIT 228

Query: 236 NYKWSKIETNSK---PDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKL 292
            YKW ++E  S    PDARSGH FIPT   AIL GGYCK  A N K   KGKIL+D W L
Sbjct: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKA-NKKGYQKGKILSDCWYL 287

Query: 293 NLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYND 352
            +  D    +WE+ +    QPSPRVG S   + + + + FGGVYD +ETEESLES F+ND
Sbjct: 288 KMKSDISGIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESNFFND 346

Query: 353 LYMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXX 412
           L+ +H+E N+W  L I+S++  SN N+ A    K++K+QEKEL+ LL+SIL K+      
Sbjct: 347 LFSYHIESNRWYSLSIRSRK--SNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKS 404

Query: 413 XXXXXYTATGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGV 472
                      N+                   TI  QLPHPRFNA T V+ D+LFI+ G+
Sbjct: 405 DDDEDDEEI--NTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGI 462

Query: 473 WELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXX 532
           WELG+K++ I+S YSIDLNKLDGV +YWE+L  IE AK LG                   
Sbjct: 463 WELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDDEDDD 522

Query: 533 XXXXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLT 592
                                    + ++E PD R WLPHPKPFETLRAFY+REGA FL 
Sbjct: 523 EEDDNEKD--EGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLE 580

Query: 593 WSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTKPSK 649
           W+ISNN+N KGK LK  SF+LC++RWWERRDQ+ +EE++LE+ GG   IIERD +   SK
Sbjct: 581 WAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSAS-SK 639

Query: 650 RR 651
           RR
Sbjct: 640 RR 641

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/600 (50%), Positives = 371/600 (61%), Gaps = 28/600 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F K+Q + E V +  +ERPS R +P M ANP H K EL +FGGE T   T  THF+NDL 
Sbjct: 56  FKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLV 115

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
            +S  N  WK+  SQN+P+PRSSAA+  HPSG+ALLHGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 116 VFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDC 175

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++ K+E   + + PSARSGHR+  WKN+ IL GGFRDLG   T+YLND W FDI+ Y
Sbjct: 176 ATKEWTKIE---QKNGPSARSGHRMAVWKNFIILHGGFRDLGTS-TTYLNDCWLFDITTY 231

Query: 238 KWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E    +  PDARSGH  I     AIL GGYCK   K  K L KGKIL D W L +
Sbjct: 232 KWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCK--VKAGKGLQKGKILTDCWYLKM 289

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
           + +    +W++ K    QPSPRVG S  +  + + V FGGVYD +ETEESLES FYND++
Sbjct: 290 SSNTSAIRWDRKKRQGFQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348

Query: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXX 414
            + + +N+W  L ++ QR+            +S KDQEKEL+DLLN IL  +        
Sbjct: 349 TYQINMNRWYSLSLRPQRKKQ-----VKLNNRSTKDQEKELEDLLNKILRNAQLDDQGEE 403

Query: 415 XXXYTATGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVWE 474
                A  S ++                   I N+LPHPRFNAAT VV D+LFI+ GVWE
Sbjct: 404 EEIDAAEESTAVEEDSDESESLDKEH----VIMNELPHPRFNAATAVVDDTLFIFGGVWE 459

Query: 475 LGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXXX 534
            GEKDY I+SFY IDLNK DGV VYWE+L+A+E AK                        
Sbjct: 460 FGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKDEDDSDEDEGEEDDDDEEDSEEEQ 519

Query: 535 XXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 594
                                  + +MEIPD R WLPHPK FE+LR+FY+R GA FL W+
Sbjct: 520 VDQKLVAEDEDEEEEEFE-----EEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWA 574

Query: 595 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTKPSKRR 651
           ISNNR++KGK LKTKSFE+CE RWWERRDQV LEE++LE+ GG   IIERD TTK  KRR
Sbjct: 575 ISNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERD-TTKTKKRR 633

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/600 (48%), Positives = 380/600 (63%), Gaps = 24/600 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F ++Q + E V ++ V+RP+ R +  M ANP H K EL +FGGE T+S    T FYNDL+
Sbjct: 55  FKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYNDLF 114

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +YS+  + W+K  SQN+P+PRSSAA+A HPSG+ L+HGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 115 TYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDC 174

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++ K+E   + + P+ARSGHR+  WKNYFIL GGFRDLG   T+YL+D W FDI+ Y
Sbjct: 175 NTKEWTKIE---QKNGPTARSGHRLTVWKNYFILHGGFRDLGT-MTTYLSDCWLFDITTY 230

Query: 238 KWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           KW +++    +  PDARSGH  +PT + A+L GGYCK   K  K L KGKIL D W L +
Sbjct: 231 KWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCK--VKAGKGLQKGKILTDCWYLKM 288

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESLES+FYNDL+
Sbjct: 289 KSDIGAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLESMFYNDLF 347

Query: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXX 414
            F +E N+W    ++ QR+ +     ATSK   NKD  KEL+D+LN IL K+        
Sbjct: 348 TFQIETNRWYSASLRPQRKAAK----ATSKNNRNKD--KELEDILNQILEKANLNDDENE 401

Query: 415 XXXYTATGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVWE 474
                      +                   I  QLPHPRFNA+T VV D+LFI+ GVWE
Sbjct: 402 KETIGDV-LKELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWE 460

Query: 475 LGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXXX 534
           +GEKDY I+SFY+IDLN+LDG+K+YWE+L  IE AK LG                     
Sbjct: 461 IGEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEE 520

Query: 535 XXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 594
                  +               + + EIPD R WLPHPKPFETLR FY+R GA+FL W+
Sbjct: 521 EITDQKLV---AEDDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWA 577

Query: 595 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGI---IERDVTTKPSKRR 651
           IS+NR+ +GK LK KSF+LC+DRWWERRDQV +EE++LE+ GGI   +E+D T+K  KRR
Sbjct: 578 ISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKD-TSKSKKRR 636

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/583 (49%), Positives = 365/583 (62%), Gaps = 21/583 (3%)

Query: 83  LMFANPQHNKH--ELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSS 140
           ++ A   HNK   EL +FGGE+T  ET +THFYNDL SY+     W+K  SQN+P+PRSS
Sbjct: 88  MITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSS 147

Query: 141 AAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGRDSSPSARSGH 200
           AA+  HPSGIA+LHGGEFSSPKQ+ FYHYSDTW+ D   +++ K++      SP ARSGH
Sbjct: 148 AAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDI---KKSPVARSGH 204

Query: 201 RIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIE---TNSKPDARSGHCFI 257
           RI+ WKNYF+LFGGF+D+GN QT+Y ND+WCFDI NYKW+++E    +  PD RSGH +I
Sbjct: 205 RIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWI 264

Query: 258 PTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRV 317
           P +   IL GGY K  +K      KGKILND W L +  D    +WE+ K    QPSPRV
Sbjct: 265 PVEEGCILWGGYTKVKSKLKSGQQKGKILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRV 324

Query: 318 GYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKLRIKSQRQTSNR 377
           G S   + + + + FGGVYD  ETEESLES+FYNDL+ +++E N+W  L ++ + Q  N+
Sbjct: 325 GCSM-AYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNLR-KNQKGNK 382

Query: 378 NSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXXXXXYTATGSNSIXXXXX------ 431
            S   S  K++K++EKELQDLLN IL K+                 +             
Sbjct: 383 -SLKRSNNKNSKEKEKELQDLLNQILEKNNLKDEDDEDDEEVNENEDGSTTASTAATSDD 441

Query: 432 XXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVWELGEKDYPINSFYSIDLN 491
                       +TI NQLPHPR+N A  VV D LFIY G WELGEKDY INSFYSIDLN
Sbjct: 442 EDTERTTQEAEGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINSFYSIDLN 501

Query: 492 KLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXXXXXXXXAGLLXXXXXXXX 551
           ++DGV  YWE+L  IE+AK LG                             L        
Sbjct: 502 RIDGVTCYWEDLKEIEKAKELGEQDSDEEDDEDDEEDDDEDDDEEEIKDQKLVADDEDEE 561

Query: 552 XXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISNNRNLKGKQLKTKSF 611
                 Q +MEIPD R WLPHPKPFE+LRAFY+REG  FL W+ISNN++++GK LK KSF
Sbjct: 562 EEEEDVQ-EMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGKHLKKKSF 620

Query: 612 ELCEDRWWERRDQVTLEEERLED---TGGIIERDVTTKPSKRR 651
           ELCEDRWWERRDQ+ +EE++LE+    G +IE+D +   SKRR
Sbjct: 621 ELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKRR 663

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/601 (48%), Positives = 382/601 (63%), Gaps = 26/601 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F K+Q   E ++I +VE+PS R +  + ++    K EL +FGGE T  E + T FYNDLY
Sbjct: 55  FKKEQENYEKINIESVEKPSIRNNGSIISST--TKKELLLFGGEHTSKELQTTKFYNDLY 112

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           ++S  NN WK+  SQN+P+PRSSAA+A HPSGIALL+GGEFSSPKQS FYHYSDTW+ D 
Sbjct: 113 TFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSDTWILDL 172

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++ K+E  G+   P  RSGHRI  WKNYFILFGGF+DLG+  T+Y ND+W FDI+ Y
Sbjct: 173 TTKEWTKIE--GK-VKPVGRSGHRITTWKNYFILFGGFKDLGH-STTYYNDVWLFDITTY 228

Query: 238 KWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E    ++ PDARSGH  IPT    I+ GGYCK  AK  K L KGK+L+  W L +
Sbjct: 229 KWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAK--KGLQKGKLLSGCWNLKM 286

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D +  +WE+ +    QPSPRVG S   + + + + FGGVYD  ETEESLES+FYNDL+
Sbjct: 287 KADVEAIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFDETEESLESIFYNDLF 345

Query: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXX 414
            +++E N+W  + +K  ++++   + +++K KS+K++E+ELQDLLN IL K+        
Sbjct: 346 TYNIESNRWFNVTLK--KRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNLKPDDEE 403

Query: 415 XXXYTAT-GSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVW 473
               +   GS+                   I    QLPHPRFNA T V+ D L+IY G W
Sbjct: 404 EEESSDIFGSDD-------EDDEEQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAW 456

Query: 474 ELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXX 533
           E GE DY I+SFYSIDLNKLDGV VYWE+L+ IE AK LG                    
Sbjct: 457 EFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFEEDEEDGE 516

Query: 534 XXXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 593
                   L+                +MEIPD R WLPHPK FE+LRAFYLREG  FL W
Sbjct: 517 EEVEDTK-LIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFLEW 575

Query: 594 SISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED---TGGIIERDVTTKPSKR 650
           +ISNNR+ +GK LK KSFELC+DRWWERRDQ+++EE++LE+    G ++ERD +   SKR
Sbjct: 576 AISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKR 635

Query: 651 R 651
           R
Sbjct: 636 R 636

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/604 (47%), Positives = 378/604 (62%), Gaps = 21/604 (3%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F  +Q + E V +  V  P+ R +  +  N   +K EL +FGGE T++ET +T FYNDL+
Sbjct: 57  FKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDLH 114

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
            Y+ +NN WKK+ SQN+P+PRSSAA+  H SG+ +L GGEFSSPKQ+ FYHY+DTWL D 
Sbjct: 115 VYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDN 174

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             R+++KL+F    + PSARSGHRI  WKNYFILFGGF+DL  G TSY ND+W F++ ++
Sbjct: 175 TTREWSKLDF---KNGPSARSGHRITTWKNYFILFGGFKDLNQG-TSYFNDVWLFNVVDF 230

Query: 238 KWSKIETNSK--PDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT 295
           KW+K ET +K  PD RSGH +I ++   I+ GGYCK  AKNNK+L KGK L D W L ++
Sbjct: 231 KWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMS 290

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            +  + +WE+      QPSPRVG S  L + N+ + FGGVYDL+ETEE L S++YNDLY 
Sbjct: 291 QNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYS 350

Query: 356 FHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXXX 415
           +++E N+W  L+++   Q SN N   +S    +K+QEKELQDLLN IL ++         
Sbjct: 351 YNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETN- 409

Query: 416 XXYTATGSNS-----IXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYS 470
              + +GSN+                       +   NQLPH RFNA T V+ D+ +IY 
Sbjct: 410 ---SYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYG 466

Query: 471 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXX 530
           G+WE  + DY I+SFYSIDLNKLDG+  Y+E L  IEE KRLG                 
Sbjct: 467 GMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDDED 526

Query: 531 XXXXXXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590
                      L              G  +MEIPD R WLPHPK FE+LR FY+REG  F
Sbjct: 527 DGEAEPTNER-LEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKF 585

Query: 591 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDT---GGIIERDVTTKP 647
           L W+ISNN++ KGK LK KSFELC+DRWWERRDQ+ +EE++L++    G IIERD  + P
Sbjct: 586 LEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPP 645

Query: 648 SKRR 651
           + RR
Sbjct: 646 TARR 649

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/599 (48%), Positives = 372/599 (62%), Gaps = 27/599 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F K+Q   + V +T VERPS R +  M ANP H K EL IFGGE T+S   LT FYN+L+
Sbjct: 81  FKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNELF 140

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +YS+ ++ W+K  S+N+P+PRSSAA A H SG+AL+HGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 141 TYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDTWLLDC 200

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++ K+E   + + PSARSGHR+  WKN+FIL GGFRDLG   T+YLNDLW FDI+ Y
Sbjct: 201 TTKEWTKME---QKNGPSARSGHRMTIWKNFFILHGGFRDLGTS-TTYLNDLWIFDITTY 256

Query: 238 KWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E    +  PDARSGH  IPT + A+L GGYCK   K  K L KGK L D W L +
Sbjct: 257 KWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCK--VKAGKGLQKGKTLTDCWYLKM 314

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D    +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEE L S F+NDL+
Sbjct: 315 KSDVSAIRWERRKKQGFQPSPRVGCSM-VHHKGRGMLFGGVYDFEETEEGLASEFFNDLF 373

Query: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXX 414
            + +E N+W  ++++ Q+    + + A S+   NKD+  EL+++LN IL ++        
Sbjct: 374 SYQVEANRWYSVKMRPQK----KKTVAISRNNRNKDE--ELENILNDILQQANLADDTDD 427

Query: 415 XXXYTATGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVWE 474
                      I                   +  QLPHPRFNA T VV D LFI+ GVWE
Sbjct: 428 DDNEIKRELQRI-----DEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWE 482

Query: 475 LGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXXX 534
            GE+D+ I+SFYSIDLNKLDGVKVYWE LS +E+AK LG                     
Sbjct: 483 FGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDEDDDDDDEEEE 542

Query: 535 XXXXXAGLLXXXXXXXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWS 594
                   L              + + EIPD R WLPHPKPFETLRAFY+R GA FL W+
Sbjct: 543 TADQK---LVAEDEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWA 599

Query: 595 ISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTKPSKR 650
           ISNNR+ KGK LK +SF+LC+DRWWERR+Q+ +EE++LE+ GG   ++ERD      +R
Sbjct: 600 ISNNRDAKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTMKRR 658

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  526 bits (1355), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 279/604 (46%), Positives = 365/604 (60%), Gaps = 26/604 (4%)

Query: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117
           F K+Q   + V +T V+RPS R++  M  NP H K EL IFGGE+T+  +  T FYN+L+
Sbjct: 55  FRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELF 114

Query: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +YS+  + WKK  S+NAP+PRSSAA A HPSG+ L+HGGEFSSPKQ+ FYHYSD+WL DC
Sbjct: 115 TYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDC 174

Query: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++ K++   + + PSARSGHR+  WKN+F++ GGFRDLG   T+YLND W FDI+ Y
Sbjct: 175 SSKEWTKID---QKNGPSARSGHRMTVWKNFFVMHGGFRDLGTS-TTYLNDCWLFDITTY 230

Query: 238 KWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E    +  PDARSGH  IPT   AI+ GGYCK  AK  K L KGKIL D W L +
Sbjct: 231 KWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAK--KGLQKGKILTDCWYLRM 288

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D    +WE+ K    QPSPRVG S    K  + + FGGVYD +ETEE L S F+NDL 
Sbjct: 289 KSDITGIRWERRKKQGFQPSPRVGCSMAHHK-GRGILFGGVYDYEETEEGLSSEFFNDLL 347

Query: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSXXXXXXXX 414
            + +E N+W  ++++ Q++         +  KS K ++ EL  +LN IL K+        
Sbjct: 348 SYQVEANRWYSIKMRPQKKK------IVAASKSAKSKDDELVGILNDILQKANLADEENE 401

Query: 415 XXXYTATGSNSIXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVGDSLFIYSGVWE 474
                +     +                 +    QLPH RFNAAT VV D+LFI+ G WE
Sbjct: 402 ENESDSEIEKELHRLDEEELLGHQQKQYPVVA--QLPHSRFNAATTVVDDTLFIFGGSWE 459

Query: 475 LGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGXXXXXXXXXXXXXXXXXXXXX 534
            GE+D+ I+SFYSIDLN+ DGV+V+WE+L  IE+AK  G                     
Sbjct: 460 YGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEEE 519

Query: 535 XXXXXAGLLXXXXX----XXXXXXXXGQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590
                                      +A  EIPD R WLPHPK FETLRAFY+R GA F
Sbjct: 520 TLDEELIAEMEDDKQEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEF 579

Query: 591 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTKP 647
           L W+ISNNR+ KGK LK +SF+L +DRWWERR+QV +EE++LE+ GG   IIERD ++  
Sbjct: 580 LQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERD-SSHS 638

Query: 648 SKRR 651
           +KRR
Sbjct: 639 TKRR 642

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 102/259 (39%), Gaps = 50/259 (19%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC--VER 180
           W +   QN+P PR    S+A A   + I +L G    S        Y DTW+  C     
Sbjct: 139 WNRIKLQNSPFPRYRHVSSAYATASNNIYILGGLHDQSV-------YGDTWIISCNPDAT 191

Query: 181 KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWS 240
           +F+       +++P  R GH      N FI+FGG     N +    +D++ F+I++YKW+
Sbjct: 192 QFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMDDDIYLFNINSYKWT 251

Query: 241 -KIETNSKPDARSGH--CFIPTDNSAI---LMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
                  +P  R GH  C + T        L GG                  ND    +L
Sbjct: 252 IPNPIGPRPLGRYGHKICILATSTVKTKLYLFGGQ-----------FDDTYFNDLAVFDL 300

Query: 295 TP---DPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESV 348
           +        W++ K K F   P      V Y  +LW       +GG     +T++ L   
Sbjct: 301 SSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLW------IYGG-----DTQQGL--- 346

Query: 349 FYNDLYMFHLELNKWSKLR 367
             ND++ F    N W+K+ 
Sbjct: 347 -INDIFKFSPNTNTWTKVE 364

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 84/194 (43%), Gaps = 44/194 (22%)

Query: 92  KHELFIFGGEFTDSETKLTHFYNDLYSYSI-----KNNSWKKYVSQN-APLPRSSAAVAV 145
           K +L++FGG+F D+      ++NDL  + +     +++ W+   S+   P P ++  +  
Sbjct: 277 KTKLYLFGGQFDDT------YFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVT 330

Query: 146 HPSGIALLHGGEFSSPKQSKFYHYS---DTWLFDCVERKFNKLEFGGRDSSPSARSGHRI 202
           + S +  ++GG+      +  + +S   +TW          K+E  G  + P     H  
Sbjct: 331 YGSDL-WIYGGDTQQGLINDIFKFSPNTNTW---------TKVETTG--TKPPPMQEHAA 378

Query: 203 IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSKPD-------ARSGHC 255
           + +KN   + GG     +    YLN ++ F+  + KW        PD        RSGH 
Sbjct: 379 VVYKNIMCVVGG----KDENDMYLNSVYLFNFDSSKWYTF-----PDFKSGIIQGRSGHS 429

Query: 256 FIPTDNSAIL-MGG 268
               +N  +L MGG
Sbjct: 430 VTLLNNDKLLIMGG 443

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 121/295 (41%), Gaps = 57/295 (19%)

Query: 95  LFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQNA---PLPRSSAAVAVHPSGIA 151
             +FGG+ T    K     +D+Y ++I  NS+K  +       PL R    + +  +   
Sbjct: 220 FIVFGGD-THKVNKEGLMDDDIYLFNI--NSYKWTIPNPIGPRPLGRYGHKICILATSTV 276

Query: 152 ----LLHGGEFSSPKQSKFYHYSDTWLFD--CVERKFNKLEF-GGRDSSPSARSGHRIIA 204
                L GG+F         +++D  +FD     R+ +  EF   +   P   + H ++ 
Sbjct: 277 KTKLYLFGGQFDD------TYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVT 330

Query: 205 WKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETN-SKPDARSGHCFIPTDNSA 263
           + +   ++GG     + Q   +ND++ F  +   W+K+ET  +KP     H  +   N  
Sbjct: 331 YGSDLWIYGG-----DTQQGLINDIFKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKNIM 385

Query: 264 ILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYSFN 322
            ++GG        ++N M    LN  +  N   D  KW      +FK+     R G+S  
Sbjct: 386 CVVGG-------KDENDM---YLNSVYLFNF--DSSKWYT--FPDFKSGIIQGRSGHSVT 431

Query: 323 LWKQNKSVAFG---------GVYDLQ--ETEESLESVFYNDLYMFHLELNKWSKL 366
           L   +K +  G         G YDL   E +E + ++ Y       L+L++ S L
Sbjct: 432 LLNNDKLLIMGGDKYDFARPGDYDLHTSEIDEGVGTILYT------LDLSRLSNL 480

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 104/260 (40%), Gaps = 42/260 (16%)

Query: 126 WKKYVSQNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFN 183
           W +   QN+P PR    A+  +  +    + GG      QS    Y DTW+  C + + +
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHD---QSV---YGDTWVLTCEDPQTS 184

Query: 184 KLEFGGR-----DSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYK 238
            + F  R     +++P  R GH      N F++FGG     N      +D++ F+I++YK
Sbjct: 185 TM-FSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDIYLFNINSYK 243

Query: 239 WS-KIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTP- 296
           W+       +P  R GH        +I+     +T              ND    +L+  
Sbjct: 244 WTIPHPIGPRPKGRYGHKI------SIIARKQMQTKLYLFGGQFDDNYFNDLVVFDLSSF 297

Query: 297 --DPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351
             D   W++ K ++F   P      V Y F LW       FGG        ++LE +  N
Sbjct: 298 RRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLW------VFGG--------DTLEGLL-N 342

Query: 352 DLYMFHLELNKWSKLRIKSQ 371
            ++M+   +N W  +    Q
Sbjct: 343 QVFMYDPAVNDWCVVETTCQ 362

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 115/282 (40%), Gaps = 45/282 (15%)

Query: 68  VDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWK 127
           VDIT    P    H           +   IFGG+ T  + ++    +D+Y ++I  NS+K
Sbjct: 192 VDITETTPPPRVGHASTLCG-----NAFVIFGGD-THKKNEMGEMDDDIYLFNI--NSYK 243

Query: 128 KYVSQNAPL-PRSSAAVAVHPSGIA--------LLHGGEFSSPKQSKFYHYSDTWLFD-- 176
             +    P+ PR         S IA         L GG+F         +++D  +FD  
Sbjct: 244 WTIPH--PIGPRPKGRYGHKISIIARKQMQTKLYLFGGQFDD------NYFNDLVVFDLS 295

Query: 177 CVERKFNKLEF-GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIS 235
              R  +  EF   R   P   + H ++++     +FGG  D   G    LN ++ +D +
Sbjct: 296 SFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG--DTLEG---LLNQVFMYDPA 350

Query: 236 NYKWSKIETNSKPDARSGHCFIPTDNSAILM--GGYCKTIAKNNKNLMKGKILNDAWKLN 293
              W  +ET  + D    +   P    A L+  G  C    K+ ++      LND + LN
Sbjct: 351 VNDWCVVETTCQDDDLE-NMPPPMQEHATLIYKGLMCIVGGKDEQD----HYLNDVYFLN 405

Query: 294 LTPDPKKWQWEKLKNFKNQ-PSPRVGYSFNLWKQNKSVAFGG 334
           L    K  +W +L  F +  P  R G+S  L K +K +  GG
Sbjct: 406 L----KSLKWFRLPRFMDGIPQGRSGHSVTLLKNDKLLIMGG 443

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 101/255 (39%), Gaps = 42/255 (16%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER-- 180
           W +    N+P PR    ++A A   + + ++ G    S        Y DTW+    +   
Sbjct: 78  WSRVKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIISAHDNGS 130

Query: 181 KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWS 240
           KF+       D++P  R GH      N F++FGG     N      +D++ F+I++YKW+
Sbjct: 131 KFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 190

Query: 241 -KIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT---- 295
                  +P  R GH        +I+     +T              ND    +L+    
Sbjct: 191 IPRPVGPRPLGRYGHKI------SIIATSQMRTKLYVFGGQFDDTYFNDLTVFDLSSFRR 244

Query: 296 PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYND 352
           PD   WQ+ K   F   P      + Y + LW       FGG     +T + L     ND
Sbjct: 245 PD-SHWQFIKPNTFTPPPLTNHTMISYDYKLW------VFGG-----DTPQGL----IND 288

Query: 353 LYMFHLELNKWSKLR 367
           ++MF  ++N W  ++
Sbjct: 289 VFMFDPQINDWKVMQ 303

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 87/201 (43%), Gaps = 23/201 (11%)

Query: 75  RPSCR-THPLMFANPQHNKHELFIFGGEFTDSE-TKLTHFYNDLYSYSIKNNSWKKYVSQ 132
           RP  R  H +        + +L++FGG+F D+    LT F  DL S+   ++ W +++  
Sbjct: 198 RPLGRYGHKISIIATSQMRTKLYVFGGQFDDTYFNDLTVF--DLSSFRRPDSHW-QFIKP 254

Query: 133 N--APLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGR 190
           N   P P ++  +  +   + +  G    +P+       +D ++FD     +  ++  G 
Sbjct: 255 NTFTPPPLTNHTMISYDYKLWVFGG---DTPQG----LINDVFMFDPQINDWKVMQTTG- 306

Query: 191 DSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIET--NSKP 248
              P     H  + + +   + GG     + Q  Y N ++  ++ + KW K+ +  +  P
Sbjct: 307 -DKPPPLQEHAAVLYGDLMCVVGG----KDEQDVYSNSVFFLNLISLKWFKLPSYRSGIP 361

Query: 249 DARSGHCFIPTDNSAIL-MGG 268
             RSGH      N  +L MGG
Sbjct: 362 QGRSGHSLTLLPNHKLLIMGG 382

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 101/251 (40%), Gaps = 42/251 (16%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER-- 180
           W +   QN+P PR    ++A     + I ++ G    S        Y DTW+   ++   
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTALDNAT 165

Query: 181 KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWS 240
           KF+       +++P  R GH  +   N F++FGG     N +    +D++  +I++YKW+
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 241 -KIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT---- 295
                  +P  R GH        +I+     KT              ND    +L+    
Sbjct: 226 VPAPVGPRPLGRYGHKI------SIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRR 279

Query: 296 PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYND 352
           PD   W++ K K F   P      + Y   LW       FGG        ++L+ +  ND
Sbjct: 280 PD-SHWEFLKPKAFTPPPITNFTMISYDSKLW------VFGG--------DTLQGLI-ND 323

Query: 353 LYMFHLELNKW 363
           ++M+   +N W
Sbjct: 324 VFMYDPAINDW 334

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 88/204 (43%), Gaps = 29/204 (14%)

Query: 75  RPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIKN----NSWKKY 129
           RP  R  H +        K +L++FGG+F D+      ++NDL  Y + +    +S  ++
Sbjct: 233 RPLGRYGHKISIIATTQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEF 286

Query: 130 VSQNA--PLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEF 187
           +   A  P P ++  +  + S + +  G              +D +++D     +  +E 
Sbjct: 287 LKPKAFTPPPITNFTMISYDSKLWVFGGDTLQG-------LINDVFMYDPAINDWFIIET 339

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIE--TN 245
            G    P     H  + + +   + GG     +   +YLN ++  ++ ++KW K+   T 
Sbjct: 340 TGEKPPPVQE--HASVVYNDLMCVVGG----KDEHDAYLNSVYFLNLKSHKWFKLPVFTA 393

Query: 246 SKPDARSGHCF-IPTDNSAILMGG 268
             P  RSGH   +  D+  ++MGG
Sbjct: 394 GIPQGRSGHSLTLLKDDKILIMGG 417

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 112/293 (38%), Gaps = 54/293 (18%)

Query: 68  VDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWK 127
           +DI+    P    H  +        +   +FGG+ T    K     +D+Y  +I +  W 
Sbjct: 172 IDISEATPPPRVGHAAVLCG-----NAFVVFGGD-THKVNKEGLMDDDIYLLNINSYKW- 224

Query: 128 KYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFY----HYSDTWLFDCVERKFN 183
                  P P     +  +   I+++   +     ++K Y     + DT+  D     ++
Sbjct: 225 -----TVPAPVGPRPLGRYGHKISIIATTQM----KTKLYVFGGQFDDTYFNDLA--VYD 273

Query: 184 KLEFGGRDS----------SPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
              F   DS          +P   +   +I++ +   +FGG  D   G    +ND++ +D
Sbjct: 274 LSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG--DTLQG---LINDVFMYD 328

Query: 234 ISNYKWSKIETNS-KPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKL 292
            +   W  IET   KP     H  +  ++   ++GG  +  A           LN  + L
Sbjct: 329 PAINDWFIIETTGEKPPPVQEHASVVYNDLMCVVGGKDEHDA----------YLNSVYFL 378

Query: 293 NLTPDPKKWQWEKLKNF-KNQPSPRVGYSFNLWKQNKSVAFGG-VYDLQETEE 343
           NL    K  +W KL  F    P  R G+S  L K +K +  GG  +D    EE
Sbjct: 379 NL----KSHKWFKLPVFTAGIPQGRSGHSLTLLKDDKILIMGGDKFDYARVEE 427

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 100/251 (39%), Gaps = 42/251 (16%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER-- 180
           W +   Q++P PR    S+A     + I ++ G    S        Y DTW+    +   
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 181 KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWS 240
           KF+       +++P  R GH  +   N F++FGG     N +    +D++  +I++YKW+
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 241 -KIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT---- 295
                  +P  R GH        +I+     KT              ND    +L+    
Sbjct: 226 VPAPVGPRPLGRYGHKI------SIIATNQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRR 279

Query: 296 PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYND 352
           PD   W++ K K F   P      + Y   LW       FGG        ++L+ +  ND
Sbjct: 280 PD-SHWEFLKPKTFSPPPITNFTMISYDSKLW------VFGG--------DTLQGLV-ND 323

Query: 353 LYMFHLELNKW 363
           ++M+   LN W
Sbjct: 324 VFMYDPALNDW 334

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 84/204 (41%), Gaps = 29/204 (14%)

Query: 75  RPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIK-----NNSWKK 128
           RP  R  H +        K +L++FGG+F D+      ++NDL  Y +      ++ W+ 
Sbjct: 233 RPLGRYGHKISIIATNQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEF 286

Query: 129 YVSQN-APLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEF 187
              +  +P P ++  +  + S + +  G              +D +++D     +  +E 
Sbjct: 287 LKPKTFSPPPITNFTMISYDSKLWVFGGDTLQG-------LVNDVFMYDPALNDWFIIET 339

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIE--TN 245
            G    P     H  + + +   + GG     +   +YLN ++  ++ + KW K+   T 
Sbjct: 340 TGEKPPPVQE--HATVVYNDLMCVVGG----KDEHDAYLNSVYFLNLKSNKWFKLPVFTA 393

Query: 246 SKPDARSGHCFIPTDNSAIL-MGG 268
             P  RSGH      N  IL MGG
Sbjct: 394 GIPQGRSGHSLTLLKNDKILIMGG 417

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 121/314 (38%), Gaps = 61/314 (19%)

Query: 68  VDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWK 127
           +DI+    P    H  +        +   +FGG+ T    K     +D+Y  +I +  W 
Sbjct: 172 IDISEATPPPRVGHAAVLCG-----NAFVVFGGD-THKVNKEGLMDDDIYLLNINSYKW- 224

Query: 128 KYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFY----HYSDTWLFDCVERKFN 183
                  P P     +  +   I+++   +     ++K Y     + DT+  D     ++
Sbjct: 225 -----TVPAPVGPRPLGRYGHKISIIATNQM----KTKLYVFGGQFDDTYFNDLA--VYD 273

Query: 184 KLEFGGRDS----------SPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
              F   DS          SP   +   +I++ +   +FGG  D   G    +ND++ +D
Sbjct: 274 LSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG--DTLQG---LVNDVFMYD 328

Query: 234 ISNYKWSKIETN-SKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKL 292
            +   W  IET   KP     H  +  ++   ++GG  +  A           LN  + L
Sbjct: 329 PALNDWFIIETTGEKPPPVQEHATVVYNDLMCVVGGKDEHDA----------YLNSVYFL 378

Query: 293 NLTPDPKKWQWEKLKNF-KNQPSPRVGYSFNLWKQNKSVAFGG-VYDLQETEESLESVFY 350
           NL    K  +W KL  F    P  R G+S  L K +K +  GG  +D    EES      
Sbjct: 379 NL----KSNKWFKLPVFTAGIPQGRSGHSLTLLKNDKILIMGGDKFDYARVEES------ 428

Query: 351 NDLYMFHLELNKWS 364
            DL+   +++ K +
Sbjct: 429 -DLHTSDIDMQKGT 441

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 120/293 (40%), Gaps = 57/293 (19%)

Query: 91  NKHELFIFGGEFTDSETKLTHFYNDLYSYSIKNN-----SWKKYVSQNAPLPRSSAAVAV 145
           N + +F+ GG +  S       Y D++  +   N     S +  +  N P PR   A  +
Sbjct: 96  NDNRIFVTGGLYDQS------VYGDVWEITANANGTSFTSKRIQIDHNTPPPRVGHASTM 149

Query: 146 HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGRDSSPSARSGHRI--I 203
             +   +  GG+     +++     D +LF+    K+      G  S P  R GH+I  I
Sbjct: 150 CGNAYVVF-GGDTHKLNKNRLLD-DDLYLFNINSYKWTIPHPIG--SRPLGRYGHKISII 205

Query: 204 AWKNY---FILFGGFRDLGNGQTSYLNDLWCFDISNYK-----WSKIETNSK-PDARSGH 254
           A K       LFGG  D      +Y NDL  FD+S+++     W  +E  S  P   + H
Sbjct: 206 ASKQMHTELYLFGGQID-----ETYFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNH 260

Query: 255 CFIPTDNSAILMGGYC-KTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQP 313
             +  DN   + GG   KTI+            ND +      DP +  W K++    +P
Sbjct: 261 TMVTFDNKLWVFGGETPKTIS------------NDTYCY----DPIQNAWSKVETTGEKP 304

Query: 314 SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKL 366
            P   ++  ++K    V FGG        + + + + ND+Y  +L   KW KL
Sbjct: 305 PPVQEHASVVYKHLMCV-FGG--------KDIHNTYSNDVYFLNLLSLKWFKL 348

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 97/249 (38%), Gaps = 36/249 (14%)

Query: 96  FIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHG 155
            +FGG+ T    K     +DLY ++I +  W        P P  S  +  +   I+++  
Sbjct: 155 VVFGGD-THKLNKNRLLDDDLYLFNINSYKW------TIPHPIGSRPLGRYGHKISIIAS 207

Query: 156 GEFSSP-----KQSKFYHYSDTWLFDC--VERKFNKLEFGGRDSS-PSARSGHRIIAWKN 207
            +  +       Q    +++D  +FD     R  +  EF    S+ P   + H ++ + N
Sbjct: 208 KQMHTELYLFGGQIDETYFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDN 267

Query: 208 YFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETN-SKPDARSGHCFIPTDNSAILM 266
              +FGG         +  ND +C+D     WSK+ET   KP     H  +   +   + 
Sbjct: 268 KLWVFGG-----ETPKTISNDTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKHLMCVF 322

Query: 267 GGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYSFNLWK 325
           GG      K+  N       ND + LNL       +W KL   K   P  R G+S  L  
Sbjct: 323 GG------KDIHNTYS----NDVYFLNLL----SLKWFKLPCVKEGIPQERSGHSLTLMN 368

Query: 326 QNKSVAFGG 334
             K V  GG
Sbjct: 369 NEKLVIMGG 377

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 100/258 (38%), Gaps = 38/258 (14%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCVER 180
           W +   +++P PR   SS+ +  + + I  + GG +          Y D W    +    
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTNDNRI-FVTGGLYDQSV------YGDVWEITANANGT 125

Query: 181 KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWS 240
            F         ++P  R GH      N +++FGG     N      +DL+ F+I++YKW+
Sbjct: 126 SFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKWT 185

Query: 241 KIE-TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKI----LNDAWKLNLT 295
                 S+P  R GH      +  +    Y          L  G+I     ND    +L+
Sbjct: 186 IPHPIGSRPLGRYGHKISIIASKQMHTELY----------LFGGQIDETYFNDLAVFDLS 235

Query: 296 PDPK-KWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
              +    WE L+     P P   ++   +  NK   FGG     ET +++     ND Y
Sbjct: 236 SFRRPNSHWEFLEPISALPPPLTNHTMVTF-DNKLWVFGG-----ETPKTIS----NDTY 285

Query: 355 MFHLELNKWSKLRIKSQR 372
            +    N WSK+    ++
Sbjct: 286 CYDPIQNAWSKVETTGEK 303

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 68/151 (45%), Gaps = 17/151 (11%)

Query: 216 RDLGNGQTSYLNDLWCFDISNYKWSKIETNSKPDARSGHC--FIPTDNSAILMGGYCKTI 273
           R++    T+  + L   +   Y W++I+    P  R  H   FI T+++ I + G     
Sbjct: 50  RNISGASTNLPSPLERKNSRRYIWNRIKLKDSPFPRYRHSSSFITTNDNRIFVTG----- 104

Query: 274 AKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFG 333
                 L    +  D W++    +   +  ++++   N P PRVG++  +   N  V FG
Sbjct: 105 -----GLYDQSVYGDVWEITANANGTSFTSKRIQIDHNTPPPRVGHASTMCG-NAYVVFG 158

Query: 334 GVYDLQETEESLESVFYNDLYMFHLELNKWS 364
           G  D  +  ++   +  +DLY+F++   KW+
Sbjct: 159 G--DTHKLNKN--RLLDDDLYLFNINSYKWT 185

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 101/252 (40%), Gaps = 44/252 (17%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL---FDCVE 179
           W +   QN+P PR    ++A     + I ++ G    S        Y DTW+   FD   
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 180 RKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKW 239
           R F+       +++P  R GH  +   N F++FGG     N +    +D++  +I++YKW
Sbjct: 166 R-FSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKW 224

Query: 240 S-KIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT--- 295
           +       +P  R GH        +I+     KT              ND    +L+   
Sbjct: 225 TVPAPVGPRPLGRYGHKI------SIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFR 278

Query: 296 -PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351
            PD   W++ K + F   P      + Y   LW       FGG        ++L+ +  N
Sbjct: 279 RPD-SHWEFLKPRTFTPPPITNFTMISYDSKLW------VFGG--------DTLQGLV-N 322

Query: 352 DLYMFHLELNKW 363
           D++M+   +N W
Sbjct: 323 DVFMYDPAINDW 334

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 83/204 (40%), Gaps = 29/204 (14%)

Query: 75  RPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIK-----NNSWKK 128
           RP  R  H +        K +L++FGG+F D+      ++NDL  Y +      ++ W+ 
Sbjct: 233 RPLGRYGHKISIIATTQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEF 286

Query: 129 YVSQN-APLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEF 187
              +   P P ++  +  + S + +  G              +D +++D     +  ++ 
Sbjct: 287 LKPRTFTPPPITNFTMISYDSKLWVFGGDTLQG-------LVNDVFMYDPAINDWFIIDT 339

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIE--TN 245
            G    P     H  + + +   + GG     +   +YLN ++  ++ + KW K+   T 
Sbjct: 340 TGEKPPPVQE--HATVVYNDLMCVVGG----KDEHDAYLNSVYFLNLKSRKWFKLPVFTA 393

Query: 246 SKPDARSGHCFIPTDNSAIL-MGG 268
             P  RSGH      N  IL MGG
Sbjct: 394 GIPQGRSGHSLTLLKNDKILIMGG 417

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 112/291 (38%), Gaps = 50/291 (17%)

Query: 68  VDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWK 127
           +DI+    P    H  +        +   +FGG+ T    K     +D+Y  +I +  W 
Sbjct: 172 IDISEATPPPRVGHAAVLCG-----NAFVVFGGD-THKVNKEGLMDDDIYLLNINSYKW- 224

Query: 128 KYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFY----HYSDTWLFDCV----- 178
                  P P     +  +   I+++   +     ++K Y     + DT+  D       
Sbjct: 225 -----TVPAPVGPRPLGRYGHKISIIATTQM----KTKLYVFGGQFDDTYFNDLAVYDLS 275

Query: 179 --ERKFNKLEF-GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIS 235
              R  +  EF   R  +P   +   +I++ +   +FGG  D   G    +ND++ +D +
Sbjct: 276 SFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG--DTLQG---LVNDVFMYDPA 330

Query: 236 NYKWSKIETN-SKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
              W  I+T   KP     H  +  ++   ++GG  +  A           LN  + LNL
Sbjct: 331 INDWFIIDTTGEKPPPVQEHATVVYNDLMCVVGGKDEHDA----------YLNSVYFLNL 380

Query: 295 TPDPKKWQWEKLKNF-KNQPSPRVGYSFNLWKQNKSVAFGG-VYDLQETEE 343
               K  +W KL  F    P  R G+S  L K +K +  GG  +D    EE
Sbjct: 381 ----KSRKWFKLPVFTAGIPQGRSGHSLTLLKNDKILIMGGDKFDYARVEE 427

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 99/253 (39%), Gaps = 46/253 (18%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVE--R 180
           W +   QN+P PR    ++A A   + I ++ G    S        Y DTW+    +   
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV-------YGDTWILSAFDDAT 165

Query: 181 KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWS 240
           KF+       +++P  R GH  +   N F++FGG     N +    +D++  ++++YKW+
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKWT 225

Query: 241 -KIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT---- 295
                  +P  R GH        +I+     KT              ND    +L+    
Sbjct: 226 VPAPVGPRPLGRYGHKI------SIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRR 279

Query: 296 PDPKKWQWEKLKNFKNQPSP-----RVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
           PD     W+ LK     P P      + Y   LW       FGG        ++L+ +  
Sbjct: 280 PD---SHWDFLKPMTFTPPPMTNFTMISYDSKLW------VFGG--------DTLQGLI- 321

Query: 351 NDLYMFHLELNKW 363
           ND++M+    N W
Sbjct: 322 NDVFMYDPAKNDW 334

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 85/206 (41%), Gaps = 33/206 (16%)

Query: 75  RPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQ- 132
           RP  R  H +        K +L++FGG+F D+      ++NDL  Y +  +S+++  S  
Sbjct: 233 RPLGRYGHKISIIATTQMKTKLYVFGGQFDDT------YFNDLAVYDL--SSFRRPDSHW 284

Query: 133 -------NAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKL 185
                    P P ++  +  + S + +  G              +D +++D  +  +  +
Sbjct: 285 DFLKPMTFTPPPMTNFTMISYDSKLWVFGGDTLQG-------LINDVFMYDPAKNDWFTI 337

Query: 186 EFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETN 245
           E  G    P     H  + + +   + GG     +   +YLN ++  ++  +KW K+   
Sbjct: 338 ETSGEKPPPVQE--HATVVYNDLMCVVGG----KDEHDAYLNTVYFLNLKTHKWFKLPIF 391

Query: 246 SK--PDARSGHCFIPTDNSAIL-MGG 268
           +   P  RSGH      N  +L MGG
Sbjct: 392 AAGIPQGRSGHSLTLLKNDKVLIMGG 417

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 68/155 (43%), Gaps = 22/155 (14%)

Query: 193 SPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETN-SKPDAR 251
           +P   +   +I++ +   +FGG  D   G    +ND++ +D +   W  IET+  KP   
Sbjct: 293 TPPPMTNFTMISYDSKLWVFGG--DTLQG---LINDVFMYDPAKNDWFTIETSGEKPPPV 347

Query: 252 SGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK- 310
             H  +  ++   ++GG  +  A           LN  + LNL    K  +W KL  F  
Sbjct: 348 QEHATVVYNDLMCVVGGKDEHDA----------YLNTVYFLNL----KTHKWFKLPIFAA 393

Query: 311 NQPSPRVGYSFNLWKQNKSVAFGG-VYDLQETEES 344
             P  R G+S  L K +K +  GG  +D    EES
Sbjct: 394 GIPQGRSGHSLTLLKNDKVLIMGGDKFDYARAEES 428

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 103/260 (39%), Gaps = 42/260 (16%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER-- 180
           W++    N+P PR    ++A A   + + ++ G    S        Y DTW+    E   
Sbjct: 76  WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIVTSHENGA 128

Query: 181 KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWS 240
           +F        D++P  R GH      N F++FGG     N      +D++ F+I++YKW+
Sbjct: 129 RFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 188

Query: 241 -KIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT---- 295
                  +P  R GH        +I+     KT              ND    +L+    
Sbjct: 189 IPNPVGPRPLGRYGHKI------SIIAMSPMKTKLYVFGGQFDDTYFNDLAVFDLSSFRR 242

Query: 296 PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYND 352
           PD   WQ+    +F   P      + Y + LW       FGG     +T + L     +D
Sbjct: 243 PD-SSWQFITPNSFTPPPLTNHAMISYDYKLW------VFGG-----DTPQGL----IDD 286

Query: 353 LYMFHLELNKWSKLRIKSQR 372
           +++F  ++N W  ++   Q+
Sbjct: 287 VFVFDPQVNDWKFIQTTGQK 306

 Score = 38.5 bits (88), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 83/187 (44%), Gaps = 30/187 (16%)

Query: 92  KHELFIFGGEFTDSETKLTHFYNDLYSYSIK-----NNSWKKYVSQNA--PLPRSSAAVA 144
           K +L++FGG+F D+      ++NDL  + +      ++SW ++++ N+  P P ++ A+ 
Sbjct: 214 KTKLYVFGGQFDDT------YFNDLAVFDLSSFRRPDSSW-QFITPNSFTPPPLTNHAMI 266

Query: 145 VHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGRDSSPSARSGHRIIA 204
            +   + +  G    +P+        D ++FD     +  ++  G+   P     H  + 
Sbjct: 267 SYDYKLWVFGG---DTPQGL----IDDVFVFDPQVNDWKFIQTTGQ--KPPPLQEHASVL 317

Query: 205 WKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIE--TNSKPDARSGHCFIPTDNS 262
           + +   + GG     + Q  Y N ++  ++ + KW K        P  RSGH      N 
Sbjct: 318 YGDLMCIVGG----KDEQDVYSNGVYFLNLISLKWFKFPFFRAGIPQGRSGHSLTLLPNH 373

Query: 263 AIL-MGG 268
            +L MGG
Sbjct: 374 KLLIMGG 380

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 105/267 (39%), Gaps = 47/267 (17%)

Query: 126 WKKYVSQNAPLPRSSAAVA--VHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER--- 180
           W K   +  P PR     +  ++PS    ++GG F S        Y DTW  +  E    
Sbjct: 22  WSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDV------YGDTWKLNIKENYNE 75

Query: 181 --------KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLND-LWC 231
                     N ++  G  ++P  R GH      N  I+FGG     N     ++D L+ 
Sbjct: 76  NDLERWHYSCNIIDIMG--TTPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDLYF 133

Query: 232 FDISNYKWSKIETNS-KPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILN--D 288
            ++   KW+       +P  R GH     +++  L GG       N+  L+K  +LN  D
Sbjct: 134 LNLDTTKWTIPSPKGIRPLGRYGHKISVINSNLYLFGGQFDETYFND--LVKFDLLNFKD 191

Query: 289 AWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESV 348
           A          +W++ K K F   P P   +S   + +NK   FGG             V
Sbjct: 192 ANS--------QWEFIKPKGFI--PPPLSNFSMCTF-ENKLYVFGG---------DTYQV 231

Query: 349 FYNDLYMFHLELNKWSKLRIKSQRQTS 375
             N+ +++  ELN+WS L    Q  T+
Sbjct: 232 LTNETFVYDPELNEWSILETFGQEDTN 258

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 119/293 (40%), Gaps = 57/293 (19%)

Query: 91  NKHELFIFGGEFTDSETKLTHFYNDLYSYSIKNN-----SWKKYVSQNAPLPRSSAAVAV 145
           N + +F+ GG    S       Y D++  +   +     S +  + QN P PR   A  +
Sbjct: 96  NDNRIFVTGGLHDQS------VYGDVWQIAANADGTSFTSKRIDIDQNTPPPRVGHASTI 149

Query: 146 HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGRDSSPSARSGHRI--I 203
             +   +  GG+     ++      D +LF+    K+   +  GR   P  R GH+I  I
Sbjct: 150 CGNAYVVF-GGDTHKLNKNGLLD-DDLYLFNINSYKWTIPQPIGR--RPLGRYGHKISII 205

Query: 204 A---WKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYK-----WSKIE-TNSKPDARSGH 254
           A    +    LFGG  D      +Y NDL  FD+S+++     W  +E     P   + H
Sbjct: 206 ASNPMQTKLYLFGGQVD-----ETYFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNH 260

Query: 255 CFIPTDNSAILMGGYC-KTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQP 313
             +  DN   + GG   KTI+            ND ++     DP + +W K+K    +P
Sbjct: 261 TMVAYDNKLWVFGGETPKTIS------------NDTYRY----DPAQSEWSKVKTTGEKP 304

Query: 314 SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKL 366
            P   ++  ++K    V  GG        +   + + ND+Y  +L   KW KL
Sbjct: 305 PPIQEHASVVYKHLMCV-LGG--------KDTHNAYSNDVYFLNLLSLKWYKL 348

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 111/272 (40%), Gaps = 57/272 (20%)

Query: 96  FIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHG 155
            +FGG+ T    K     +DLY ++I +  W        P P     +  +   I+++  
Sbjct: 155 VVFGGD-THKLNKNGLLDDDLYLFNINSYKW------TIPQPIGRRPLGRYGHKISII-- 205

Query: 156 GEFSSPKQSKFY---------HYSDTWLFDCVE-RKFNK----LEFGGRDSSPSARSGHR 201
              S+P Q+K Y         +++D  +FD    R+ N     LE  G    P   + H 
Sbjct: 206 --ASNPMQTKLYLFGGQVDETYFNDLVVFDLSSFRRPNSHWEFLEPVG--DLPPPLTNHT 261

Query: 202 IIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNS-KPDARSGHCFIPTD 260
           ++A+ N   +FGG         +  ND + +D +  +WSK++T   KP     H  +   
Sbjct: 262 MVAYDNKLWVFGG-----ETPKTISNDTYRYDPAQSEWSKVKTTGEKPPPIQEHASVVYK 316

Query: 261 NSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGY 319
           +   ++GG      K+  N       ND + LNL       +W KL   K   P  R G+
Sbjct: 317 HLMCVLGG------KDTHNAYS----NDVYFLNLL----SLKWYKLPRMKEGIPQERSGH 362

Query: 320 SFNLWKQNKSVAFGG---------VYDLQETE 342
           S  L K  K +  GG         ++DLQ +E
Sbjct: 363 SLTLMKNEKLLIMGGDKTDYASPNIHDLQTSE 394

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 99/259 (38%), Gaps = 40/259 (15%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCVER 180
           W +   +N+P PR   SS+ +  + + I +  G    S        Y D W    +    
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQIAANADGT 125

Query: 181 KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWS 240
            F         ++P  R GH      N +++FGG     N      +DL+ F+I++YKW+
Sbjct: 126 SFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKWT 185

Query: 241 KIE-TNSKPDARSGHCFI-----PTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
             +    +P  R GH        P      L GG                  ND    +L
Sbjct: 186 IPQPIGRRPLGRYGHKISIIASNPMQTKLYLFGGQVDET-----------YFNDLVVFDL 234

Query: 295 TPDPK-KWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDL 353
           +   +    WE L+   + P P   ++   +  NK   FGG     ET +++     ND 
Sbjct: 235 SSFRRPNSHWEFLEPVGDLPPPLTNHTMVAY-DNKLWVFGG-----ETPKTIS----NDT 284

Query: 354 YMFHLELNKWSKLRIKSQR 372
           Y +    ++WSK++   ++
Sbjct: 285 YRYDPAQSEWSKVKTTGEK 303

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 61/130 (46%), Gaps = 17/130 (13%)

Query: 237 YKWSKIETNSKPDARSGHC--FIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
           Y W++++  + P  R  H   FI T+++ I + G           L    +  D W++  
Sbjct: 71  YIWNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTG----------GLHDQSVYGDVWQIAA 120

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D   +  +++   +N P PRVG++  +   N  V FGG  D  +  ++   +  +DLY
Sbjct: 121 NADGTSFTSKRIDIDQNTPPPRVGHASTICG-NAYVVFGG--DTHKLNKN--GLLDDDLY 175

Query: 355 MFHLELNKWS 364
           +F++   KW+
Sbjct: 176 LFNINSYKWT 185

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 102/263 (38%), Gaps = 52/263 (19%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER-- 180
           W +    N+P PR    ++A A     I ++ G    S        Y DTW+        
Sbjct: 134 WNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV-------YGDTWILTSENNAS 186

Query: 181 KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWS 240
           +F        D++P  R GH      N FI+FGG     N      +DL+ F+I+++KW+
Sbjct: 187 RFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMDDDLYLFNINSHKWT 246

Query: 241 -KIETNSKPDARSGH--CFIPTDNSAI---LMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294
                  +P  R GH    I T NS     L GG                  ND    +L
Sbjct: 247 IPNPVGPRPLGRYGHKISIIATANSKTRLYLFGGQ-----------FDDAYFNDLVVFDL 295

Query: 295 T----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLES 347
           +    PD  +W++ K K+F   P      V Y   LW       FGG        ++L+ 
Sbjct: 296 SSFRRPD-SRWEFVKPKSFVPPPLTNHTMVSYDNKLW------VFGG--------DTLQG 340

Query: 348 VFYNDLYMFHLELNKWSKLRIKS 370
           +  N ++M+   +N W+ +   S
Sbjct: 341 L-TNRVFMYDPMINDWTTIETSS 362

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 125/311 (40%), Gaps = 58/311 (18%)

Query: 95  LFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIAL-- 152
             IFGG+ T    K     +DLY ++I ++ W      N   PR         S IA   
Sbjct: 215 FIIFGGD-THKVNKDGLMDDDLYLFNINSHKW---TIPNPVGPRPLGRYGHKISIIATAN 270

Query: 153 ------LHGGEFSSPKQSKFYHYSDTWLFD--CVERKFNKLEFGGRDS-SPSARSGHRII 203
                 L GG+F         +++D  +FD     R  ++ EF    S  P   + H ++
Sbjct: 271 SKTRLYLFGGQFDD------AYFNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMV 324

Query: 204 AWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSKPDARSGHCFIPTDNSA 263
           ++ N   +FGG  D   G T   N ++ +D     W+ IET+S             +N A
Sbjct: 325 SYDNKLWVFGG--DTLQGLT---NRVFMYDPMINDWTTIETSSDN----------PNNIA 369

Query: 264 ILMGGYCKTIAKNNKNLMKGK-----ILNDAWKLNLTPDPKKWQWEKLKNFK-NQPSPRV 317
             M  +   + K+   +  GK      LN  + LNL    +  +W KL  F    P  R 
Sbjct: 370 PPMQEHAAIVYKDLMCIFGGKDEQDTYLNGVYFLNL----RTLKWYKLPIFAPGIPQGRS 425

Query: 318 GYSFNLWKQNKSVAFGGV---------YDLQETEESL--ESVFYNDLYMFHLELNKWSKL 366
           G+S  L K +K +  GG          +DL  +E ++   ++ Y  L + HL+      L
Sbjct: 426 GHSITLLKNDKLLIMGGDKFDYARVDNFDLHTSETNMGKGTILYT-LDLSHLQDICPGIL 484

Query: 367 RIKSQRQTSNR 377
            + S   TSN+
Sbjct: 485 DVPSVTPTSNK 495

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 97/232 (41%), Gaps = 37/232 (15%)

Query: 75  RPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIK-----NNSWKK 128
           RP  R  H +      ++K  L++FGG+F D+      ++NDL  + +      ++ W+ 
Sbjct: 254 RPLGRYGHKISIIATANSKTRLYLFGGQFDDA------YFNDLVVFDLSSFRRPDSRWEF 307

Query: 129 YVSQN-APLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEF 187
              ++  P P ++  +  + + + +  G          F       ++D +   +  +E 
Sbjct: 308 VKPKSFVPPPLTNHTMVSYDNKLWVFGGDTLQGLTNRVF-------MYDPMINDWTTIET 360

Query: 188 GGRDSSPSA--RSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETN 245
              + +  A     H  I +K+   +FGG     + Q +YLN ++  ++   KW K+   
Sbjct: 361 SSDNPNNIAPPMQEHAAIVYKDLMCIFGG----KDEQDTYLNGVYFLNLRTLKWYKLPIF 416

Query: 246 SK--PDARSGHCFIPTDNSAIL-MGG----YCKT----IAKNNKNLMKGKIL 286
           +   P  RSGH      N  +L MGG    Y +     +  +  N+ KG IL
Sbjct: 417 APGIPQGRSGHSITLLKNDKLLIMGGDKFDYARVDNFDLHTSETNMGKGTIL 468

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 104/253 (41%), Gaps = 38/253 (15%)

Query: 123 NNSWKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVE 179
           N  W +   +++P PR    +++ A     + ++ G       QS F    D W+   +E
Sbjct: 194 NVVWNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLH----DQSVF---GDVWIIKSLE 246

Query: 180 R--KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
              KF        +++P  R GH      N F++FGG     N      +DL+ F+I++Y
Sbjct: 247 NGTKFTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNINSY 306

Query: 238 KWS-KIETNSKPDARSGH-----CFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWK 291
           KW+       +P  R GH        P      L GG       NN  +       D  +
Sbjct: 307 KWTIPNPIGPRPLGRYGHKVSIIATTPMKTKLYLFGGQFDDTYFNNLAVF------DLSQ 360

Query: 292 LNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351
               PD   W++ K K+F   P P   ++   + QNK   FGG        ++L+ +  N
Sbjct: 361 FR-RPD-SHWEFLKPKSF--MPPPLTNHTMVSY-QNKLWIFGG--------DTLQGLI-N 406

Query: 352 DLYMFHLELNKWS 364
            ++M+  E+N W+
Sbjct: 407 KIFMYDPEVNDWT 419

 Score = 38.5 bits (88), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 62/287 (21%), Positives = 110/287 (38%), Gaps = 55/287 (19%)

Query: 68  VDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWK 127
           +DIT    P    H           +   +FGG+ T    K     +DLY ++I +  W 
Sbjct: 256 IDITENTPPPRVGHAATLCG-----NAFVVFGGD-THKVNKDGLMDDDLYLFNINSYKW- 308

Query: 128 KYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFY----HYSDTW-----LFDCV 178
                  P P     +  +   ++++     ++P ++K Y     + DT+     +FD  
Sbjct: 309 -----TIPNPIGPRPLGRYGHKVSII----ATTPMKTKLYLFGGQFDDTYFNNLAVFDLS 359

Query: 179 E--RKFNKLEFGGRDS-SPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIS 235
           +  R  +  EF    S  P   + H +++++N   +FGG    G      +N ++ +D  
Sbjct: 360 QFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGGDTLQG-----LINKIFMYDPE 414

Query: 236 NYKWSKIET----NSK---PDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILND 288
              W+ +ET    N +   P     H  +   +  ++MGG  +          +   LN 
Sbjct: 415 VNDWTVVETFPANNDQENFPPPMQEHASVMYGDLMVVMGGKDE----------QDNYLNT 464

Query: 289 AWKLNLTPDPKKWQWEKLKNFK-NQPSPRVGYSFNLWKQNKSVAFGG 334
            + L +       +W KL       P  R G+S  L K NK +  GG
Sbjct: 465 VYFLKI----NTLEWYKLPFLSVGIPQGRSGHSITLLKGNKLLIMGG 507

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 98/259 (37%), Gaps = 58/259 (22%)

Query: 126 WKKYVSQNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER--K 181
           W +   + +P PR    A+     SG   + GG      QS    Y DTW+   ++    
Sbjct: 93  WNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHD---QSV---YGDTWIIKSLDNATS 146

Query: 182 FNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSK 241
           F  +     D++P  R GH      N F++FGG     N      +D++ F+I+++KW+ 
Sbjct: 147 FKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMDDDIYLFNINSHKWT- 205

Query: 242 IETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKI-----------LNDAW 290
                          IPT      +G Y   I+    N MK K+            ND  
Sbjct: 206 ---------------IPTPQGPRPLGRYGHKISIIAANQMKTKLYVFGGQFDDTYFNDLA 250

Query: 291 KLNLTPDPKK-WQWEKLKNFKNQPSP-----RVGYSFNLWKQNKSVAFGGVYDLQETEES 344
           + +L+   +    WE +K     P P      + +   LW       FGG     +T + 
Sbjct: 251 EFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLW------VFGG-----DTPQG 299

Query: 345 LESVFYNDLYMFHLELNKW 363
           L     N+++MF    N W
Sbjct: 300 LT----NEVFMFDPAANDW 314

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 97/207 (46%), Gaps = 35/207 (16%)

Query: 75  RPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSI----KNNSWKKY 129
           RP  R  H +        K +L++FGG+F D+      ++NDL  + +    +++S  ++
Sbjct: 213 RPLGRYGHKISIIAANQMKTKLYVFGGQFDDT------YFNDLAEFDLSSFRRSDSHWEF 266

Query: 130 VSQNAPLPRSSAAVAVHPSGIALLH-----GGEFSSPKQSKFYHYSDTWLFDCVERKFNK 184
           +     +P     +A H + I+  H     GG+  +P+       ++ ++FD     +  
Sbjct: 267 IKPATFMP---PPLANH-TMISFDHKLWVFGGD--TPQGLT----NEVFMFDPAANDWCV 316

Query: 185 LEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIET 244
           ++  G  + P     H  I +++   +FGG     + Q +Y N ++  +  + KW K+ T
Sbjct: 317 VQTTG--NIPPPLQEHAAIIYRDLMCVFGG----KDAQDNYSNAVYFLNFRSLKWFKLPT 370

Query: 245 --NSKPDARSGHCF-IPTDNSAILMGG 268
             N  P ARSGH   + ++N  ++MGG
Sbjct: 371 FNNMIPRARSGHSLTLLSNNKLLIMGG 397

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 101/256 (39%), Gaps = 48/256 (18%)

Query: 95  LFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLH 154
             IFGG+ T          +D+Y ++I ++ W        P P+    +  +   I+++ 
Sbjct: 174 FVIFGGD-THKVNDAGLMDDDIYLFNINSHKW------TIPTPQGPRPLGRYGHKISIIA 226

Query: 155 GGEFSSPKQSKFY----HYSDTWLFDCVERKFNKLEFGGRDSS----------PSARSGH 200
             +     ++K Y     + DT+  D  E  F+   F   DS           P   + H
Sbjct: 227 ANQM----KTKLYVFGGQFDDTYFNDLAE--FDLSSFRRSDSHWEFIKPATFMPPPLANH 280

Query: 201 RIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSK-PDARSGHCFIPT 259
            +I++ +   +FGG  D   G T   N+++ FD +   W  ++T    P     H  I  
Sbjct: 281 TMISFDHKLWVFGG--DTPQGLT---NEVFMFDPAANDWCVVQTTGNIPPPLQEHAAIIY 335

Query: 260 DNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVG 318
            +   + GG     A++N +       N  + LN     +  +W KL  F N  P  R G
Sbjct: 336 RDLMCVFGGKD---AQDNYS-------NAVYFLNF----RSLKWFKLPTFNNMIPRARSG 381

Query: 319 YSFNLWKQNKSVAFGG 334
           +S  L   NK +  GG
Sbjct: 382 HSLTLLSNNKLLIMGG 397

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 83/206 (40%), Gaps = 32/206 (15%)

Query: 169 YSDTWLFDCVER--KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           Y DTW+        +F        D++P  R GH      N F++FGG     N +    
Sbjct: 112 YGDTWILTAHANNTRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMD 171

Query: 227 NDLWCFDISNYKWS-KIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKI 285
           +D++ F+I++YKW+       +P  R GH        +++     KT             
Sbjct: 172 DDVYLFNINSYKWTIPHPVGPRPLGRYGHKI------SVIATSQMKTKLYVFGGQFDDTY 225

Query: 286 LNDAWKLNLT----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDL 338
            ND    +L+    PD   W++ K ++F   P      V Y + LW       FGG    
Sbjct: 226 FNDLCVYDLSSFRRPD-SHWEFLKPQSFVPPPLTNHTMVSYDYKLW------IFGG---- 274

Query: 339 QETEESLESVFYNDLYMFHLELNKWS 364
            +T + L     N+++M+   +N W+
Sbjct: 275 -DTAQGL----INEVFMYDPTVNDWT 295

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 85/189 (44%), Gaps = 28/189 (14%)

Query: 75  RPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIK-----NNSWKK 128
           RP  R  H +        K +L++FGG+F D+      ++NDL  Y +      ++ W+ 
Sbjct: 193 RPLGRYGHKISVIATSQMKTKLYVFGGQFDDT------YFNDLCVYDLSSFRRPDSHWEF 246

Query: 129 YVSQN-APLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEF 187
              Q+  P P ++  +  +   + +  GG+ +          ++ +++D     +  +E 
Sbjct: 247 LKPQSFVPPPLTNHTMVSYDYKLWIF-GGDTAQ------GLINEVFMYDPTVNDWTVVET 299

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIE--TN 245
            G  S P A   H  + +K+   + GG     + Q SY ND++  ++ ++KW K+    N
Sbjct: 300 TG--SKPPAIQEHAAVVYKDLMCVTGG----KDEQDSYSNDVYFLNLKSFKWFKLPFFKN 353

Query: 246 SKPDARSGH 254
             P  RSGH
Sbjct: 354 GVPQGRSGH 362

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 95/263 (36%), Gaps = 48/263 (18%)

Query: 126 WKKYVSQNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCVERK 181
           W +    ++PLPR    A+    P     + GG            Y DTW+   +     
Sbjct: 162 WGRTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGE------LVYGDTWMLTANSDSTN 215

Query: 182 FNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWS- 240
           F         ++P  R GH      N  ++FGG     N +    +DL+ F++ +++W+ 
Sbjct: 216 FTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWTI 275

Query: 241 KIETNSKPDARSGH-----CFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT 295
                ++P  R GH        P      L GG            +     ND    +L+
Sbjct: 276 PTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQ-----------LDDNYFNDLAMYDLS 324

Query: 296 P--DP-KKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVF 349
              +P  +WQ+ K K F   P      V Y + LW       FGG         S     
Sbjct: 325 DFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLW------VFGG---------SSRGEL 369

Query: 350 YNDLYMFHLELNKWSKLRIKSQR 372
            N LY++  +LN+W  L  +  +
Sbjct: 370 QNQLYVYIPDLNEWRCLETEGDK 392

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 55/256 (21%), Positives = 108/256 (42%), Gaps = 48/256 (18%)

Query: 95  LFIFGGEF--TDSETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIAL 152
           L IFGG+    +SE  L    +DLY +++ ++ W        P P  +  +  +   +++
Sbjct: 243 LVIFGGDTHKLNSEGLLD---DDLYLFNVDSHRW------TIPTPIGTRPLGRYGHQVSV 293

Query: 153 LHGGEFSSPKQSKFY---------HYSDTWLFDCVERK--FNKLEF-GGRDSSPSARSGH 200
           +     ++PK++K Y         +++D  ++D  + +   ++ +F   +  +P   + H
Sbjct: 294 I----ATTPKKAKLYLFGGQLDDNYFNDLAMYDLSDFRNPHSRWQFLKSKAFTPPPLTNH 349

Query: 201 RIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIET-NSKPDARSGHCFIPT 259
            ++A+     +FGG     + +    N L+ +     +W  +ET   KP     H     
Sbjct: 350 TMVAYDYKLWVFGG-----SSRGELQNQLYVYIPDLNEWRCLETEGDKPQPIQEHSATIY 404

Query: 260 DNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK-NQPSPRVG 318
            N   + GG  K            +  N  + LNL    +  +W +L     N+P PR G
Sbjct: 405 KNLMCVFGGKNK----------DDEYQNTMYFLNL----QTLKWYRLDTSHCNEPLPRSG 450

Query: 319 YSFNLWKQNKSVAFGG 334
            S +L + +K +  GG
Sbjct: 451 QSMSLMQNDKILIMGG 466

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 104/260 (40%), Gaps = 58/260 (22%)

Query: 96  FIFGGEFTDSETKLTHFYN-------DLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPS 148
            +FGG+        TH  N       DLY ++I +  W        P P  +  +  +  
Sbjct: 155 VVFGGD--------THKLNMNRLLDDDLYLFNINSYKW------TIPQPVGTRPLGRYGH 200

Query: 149 GIALLHGGEFSSPKQSKFY---------HYSDTWLFDCVE-RKFNK--LEFGGRDSSPSA 196
            I+++     ++P Q+K +         +++D  +FD    R+ N   +        P  
Sbjct: 201 KISIIA----NNPMQTKLFLFGGQIDETYFNDLAMFDLSSFRRPNSHWVFLKPVSIVPPP 256

Query: 197 RSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNS-KPDARSGHC 255
            + H ++ + N   +FGG         +  N+ +C+D     WSKI+T   +P A   H 
Sbjct: 257 LTNHTMVTFDNKLWVFGG-----KTPNTLSNETFCYDPVQNDWSKIQTTGERPPAVQEHA 311

Query: 256 FIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PS 314
            +   +   + GG      K+ +N       ND + LNL      ++W KL   K   P 
Sbjct: 312 SVVYKHLMCIFGG------KDIQNAYS----NDVYFLNLI----TFKWYKLPRIKEGLPK 357

Query: 315 PRVGYSFNLWKQNKSVAFGG 334
            R G+S  L K +K V  GG
Sbjct: 358 ERSGHSLTLIKNDKLVIMGG 377

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 99/252 (39%), Gaps = 45/252 (17%)

Query: 130 VSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGG 189
           + QN P PR   A  +  +   +  GG+      ++     D +LF+    K+   +  G
Sbjct: 134 IGQNTPPPRVGHASTICGNAYVVF-GGDTHKLNMNRLLD-DDLYLFNINSYKWTIPQPVG 191

Query: 190 RDSSPSARSGHRIIAWKN-----YFILFGGFRDLGNGQTSYLNDLWCFDISNYK-----W 239
             + P  R GH+I    N        LFGG  D      +Y NDL  FD+S+++     W
Sbjct: 192 --TRPLGRYGHKISIIANNPMQTKLFLFGGQID-----ETYFNDLAMFDLSSFRRPNSHW 244

Query: 240 SKIETNS-KPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDP 298
             ++  S  P   + H  +  DN   + GG       N                    DP
Sbjct: 245 VFLKPVSIVPPPLTNHTMVTFDNKLWVFGGKTPNTLSNE---------------TFCYDP 289

Query: 299 KKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHL 358
            +  W K++    +P P V    ++  ++    FGG        + +++ + ND+Y  +L
Sbjct: 290 VQNDWSKIQTTGERP-PAVQEHASVVYKHLMCIFGG--------KDIQNAYSNDVYFLNL 340

Query: 359 ELNKWSKL-RIK 369
              KW KL RIK
Sbjct: 341 ITFKWYKLPRIK 352

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 65/152 (42%), Gaps = 19/152 (12%)

Query: 216 RDLGNGQTSYLNDLWCFDISNYKWSKIETNSKPDARSGHCFIPT---DNSAILMGGYCKT 272
           R++    T+  + +   D   Y W++I+  + P  R  H   P    DN   + GG    
Sbjct: 50  RNISGASTALPSPMERQDAGKYVWNRIKLKNSPFPRYRHSASPIVTNDNRIFVTGG---- 105

Query: 273 IAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAF 332
                  L    +  D W++    D   +  + ++  +N P PRVG++  +   N  V F
Sbjct: 106 -------LHDHLVYGDTWQITGNLDGTSFVSKTIQIGQNTPPPRVGHASTICG-NAYVVF 157

Query: 333 GGVYDLQETEESLESVFYNDLYMFHLELNKWS 364
           GG       + ++  +  +DLY+F++   KW+
Sbjct: 158 GG----DTHKLNMNRLLDDDLYLFNINSYKWT 185

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 97/267 (36%), Gaps = 72/267 (26%)

Query: 126 WKKYVSQNAPLPRSSAAVAVHPSG------IALLHGGEFSSPKQSKFYHYSDTWLFDCVE 179
           W +   QN+P PR     + + S       I  LH              Y DTW+    +
Sbjct: 141 WNRVKLQNSPFPRYRHVASSNCSEDNSLYVIGGLHDQSV----------YGDTWIISTND 190

Query: 180 R--KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
              +F        +++P  R GH      N F+LFGG     N +    +DL+ F++++Y
Sbjct: 191 NGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFNVNSY 250

Query: 238 KWSKIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKI-----------L 286
           KW+                IP       +G Y   I+    N MK K+            
Sbjct: 251 KWT----------------IPHPIGPRPLGRYGHKISIMAANQMKTKLYLFGGQFDDTYF 294

Query: 287 NDAWKLNLT----PDPKKWQWEKLKNFKNQPSP-----RVGYSFNLWKQNKSVAFGGVYD 337
           ND    +L+    PD     WE LK     P P      + Y  +LW       FGG   
Sbjct: 295 NDLAVFDLSSFRRPD---SHWEFLKPTTFSPPPLTNHTMISYDNHLW------VFGG--- 342

Query: 338 LQETEESLESVFYNDLYMFHLELNKWS 364
                ++L+ +  N ++ + +  N WS
Sbjct: 343 -----DTLQGLI-NQVFKYDVANNDWS 363

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 84/195 (43%), Gaps = 30/195 (15%)

Query: 83  LMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIK-----NNSWKKYVSQN-APL 136
           +M AN    K +L++FGG+F D+      ++NDL  + +      ++ W+       +P 
Sbjct: 272 IMAAN--QMKTKLYLFGGQFDDT------YFNDLAVFDLSSFRRPDSHWEFLKPTTFSPP 323

Query: 137 PRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGRDSSPSA 196
           P ++  +  + + + +  G              +  + +D     ++  E  G  + P  
Sbjct: 324 PLTNHTMISYDNHLWVFGGDTLQG-------LINQVFKYDVANNDWSIAETTG--TKPPP 374

Query: 197 RSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIET--NSKPDARSGH 254
              H  + +K+  ++ GG     +   +YLN ++  ++  ++W K+ T     P  RSGH
Sbjct: 375 MQEHAAVVYKHVMVVVGG----KDEHDTYLNSVYFLNLKTHEWFKLPTFKAGIPQGRSGH 430

Query: 255 CFIPTDNSAIL-MGG 268
                +N  +L MGG
Sbjct: 431 SLTLLNNDKLLIMGG 445

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 81/206 (39%), Gaps = 32/206 (15%)

Query: 169 YSDTWLFDCVER--KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           Y DTW+    E   KF        +++P  R GH      N F++FGG     N +    
Sbjct: 197 YGDTWIIKSHENGNKFTSKTVEITETTPPPRVGHASTLCGNAFVIFGGDTHKTNAEGLMD 256

Query: 227 NDLWCFDISNYKWS-KIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKI 285
           +D++  +I+++KW+       +P  R GH        +I+     KT             
Sbjct: 257 DDVYLLNINSHKWTIPRPVGPRPLGRYGHKI------SIIATSQMKTKLYVFGGQFDDTY 310

Query: 286 LNDAWKLNLT----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDL 338
            ND    +L+    PD   WQ+ K  +F   P      V Y + LW       FGG    
Sbjct: 311 FNDLAVYDLSSFRRPD-SHWQFLKPVSFVPPPLTNHTMVSYDYKLW------VFGG---- 359

Query: 339 QETEESLESVFYNDLYMFHLELNKWS 364
            +T + L     N+L+M+    N WS
Sbjct: 360 -DTPQGL----INELFMYDPTTNDWS 380

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 67/143 (46%), Gaps = 21/143 (14%)

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNS-KPDARS 252
           P   + H ++++     +FGG    G      +N+L+ +D +   WS ++T   KP    
Sbjct: 339 PPPLTNHTMVSYDYKLWVFGGDTPQG-----LINELFMYDPTTNDWSVVDTTGVKPPPLQ 393

Query: 253 GHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKN- 311
            H  +   +   ++GG      K++++    ++    + LNL    K ++W KL +F++ 
Sbjct: 394 EHAALLYKDLMCIVGG------KDDQDNYSQEV----YFLNL----KSFRWFKLPHFRSL 439

Query: 312 QPSPRVGYSFNLWKQNKSVAFGG 334
            PSPR G+S  L    K +  GG
Sbjct: 440 VPSPRSGHSVTLLSNKKLLIMGG 462

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 57/132 (43%), Gaps = 19/132 (14%)

Query: 239 WSKIETNSKPDARSGHC---FIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT 295
           W++++    P  R  H    +    N   ++GG           L    +  D W +   
Sbjct: 158 WNRVKLLQSPFPRYRHVASSYASDSNEVFVIGG-----------LHDQSVYGDTWIIKSH 206

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            +  K+  + ++  +  P PRVG++  L   N  V FGG  D  +T  + E +  +D+Y+
Sbjct: 207 ENGNKFTSKTVEITETTPPPRVGHASTLCG-NAFVIFGG--DTHKT--NAEGLMDDDVYL 261

Query: 356 FHLELNKWSKLR 367
            ++  +KW+  R
Sbjct: 262 LNINSHKWTIPR 273

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 107/254 (42%), Gaps = 44/254 (17%)

Query: 95  LFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQNA---PLPRSSAAVAVHPSGIA 151
             IFGG+ T    K     +D+Y ++I  NS+K  + Q     PL R    +++  +   
Sbjct: 155 FVIFGGD-THKTNKDGLMDDDIYLFNI--NSYKWTIPQPVGPRPLGRYGHKISIIATSQM 211

Query: 152 ----LLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLE-----FGGRDSSPSARSGHRI 202
                + GG+F         +++D  ++D     F K E        +   P   + H +
Sbjct: 212 KTKLYVFGGQFDD------SYFNDLCVYDL--SSFRKPESHWEFLKPKSFIPPPLTNHTM 263

Query: 203 IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNS-KPDARSGHCFIPTDN 261
           +++     +FGG     + Q   +N L+ FD     W  +ET   KP     H  +  ++
Sbjct: 264 VSYDYKLWVFGG-----DTQQGLINQLFMFDPVINDWRVVETTGEKPPPVQEHAAVMFND 318

Query: 262 SAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK-NQPSPRVGYS 320
              +MGG      K+ +++     LN  + LNL    K  +W K  ++K N P  R G+S
Sbjct: 319 LMCIMGG------KDEQDVY----LNSVYFLNL----KSLKWFKFNDYKLNIPQGRSGHS 364

Query: 321 FNLWKQNKSVAFGG 334
             L K N+ +  GG
Sbjct: 365 ITLLKNNRLLIMGG 378

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 73/179 (40%), Gaps = 30/179 (16%)

Query: 193 SPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIE-TNSKPDAR 251
           +P  R GH      N F++FGG     N      +D++ F+I++YKW+  +    +P  R
Sbjct: 139 TPPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKWTIPQPVGPRPLGR 198

Query: 252 SGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT----PDPKKWQWEKLK 307
            GH        +I+     KT              ND    +L+    P+   W++ K K
Sbjct: 199 YGHKI------SIIATSQMKTKLYVFGGQFDDSYFNDLCVYDLSSFRKPE-SHWEFLKPK 251

Query: 308 NFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKW 363
           +F   P      V Y + LW       FGG     +T++ L     N L+MF   +N W
Sbjct: 252 SFIPPPLTNHTMVSYDYKLW------VFGG-----DTQQGL----INQLFMFDPVINDW 295

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 87/206 (42%), Gaps = 33/206 (16%)

Query: 75  RPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQ- 132
           RP  R  H +        K +L++FGG+F DS      ++NDL  Y +  +S++K  S  
Sbjct: 194 RPLGRYGHKISIIATSQMKTKLYVFGGQFDDS------YFNDLCVYDL--SSFRKPESHW 245

Query: 133 -------NAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKL 185
                    P P ++  +  +   + +  GG+      ++ +      +FD V   +  +
Sbjct: 246 EFLKPKSFIPPPLTNHTMVSYDYKLWVF-GGDTQQGLINQLF------MFDPVINDWRVV 298

Query: 186 EFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETN 245
           E  G    P     H  + + +   + GG     + Q  YLN ++  ++ + KW K    
Sbjct: 299 ETTGEKPPPVQE--HAAVMFNDLMCIMGG----KDEQDVYLNSVYFLNLKSLKWFKFNDY 352

Query: 246 --SKPDARSGHCF-IPTDNSAILMGG 268
             + P  RSGH   +  +N  ++MGG
Sbjct: 353 KLNIPQGRSGHSITLLKNNRLLIMGG 378

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 104/254 (40%), Gaps = 46/254 (18%)

Query: 96  FIFGGEFTD-SETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLH 154
            +FGG+    +E KL    +D+Y +++ +  W        P P  S  +  +   I+++ 
Sbjct: 153 VVFGGDTHKLNEDKL--LDDDIYLFNVNSYKW------TIPQPIGSRPLGRYGHKISIIA 204

Query: 155 GGEFSSPKQSKFY---------HYSDTWLFDC--VERKFNKLEF-GGRDSSPSARSGHRI 202
                +P Q+K Y         +++D  +FD     R+ +  EF     + P   + H +
Sbjct: 205 ----YNPMQTKLYLFGGQLDKTYFNDLAMFDLSSFRRRNSHWEFLEPATTVPPPLANHTM 260

Query: 203 IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSK-PDARSGHCFIPTDN 261
           + + N   +FGG         +  N+ +C+D     WSKIET  + P     H  +   +
Sbjct: 261 VTYGNKLWVFGG-----ETPKTVSNETYCYDPIQNDWSKIETTGEIPPPVQEHASVVYKH 315

Query: 262 SAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYS 320
              + GG     A +          ND + L+L      ++W KL + K   P  R G+S
Sbjct: 316 IMCVFGGKYTHNAYS----------NDVYFLDLL----SFKWYKLPHIKEGIPRERSGHS 361

Query: 321 FNLWKQNKSVAFGG 334
             L K  K +  GG
Sbjct: 362 LTLMKNEKILIMGG 375

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 99/252 (39%), Gaps = 38/252 (15%)

Query: 126 WKKYVSQNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCVERK 181
           W +   +++P PR   S++  V       + GG ++   QS    Y D W    +     
Sbjct: 71  WNRIKLKDSPFPRYRHSSSPIVSSENRIFVTGGLYN---QSV---YGDVWQITANADGTS 124

Query: 182 FNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSK 241
           F         ++P  R GH      N +++FGG     N      +D++ F++++YKW+ 
Sbjct: 125 FTPKAIQIDRNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKWTI 184

Query: 242 IE-TNSKPDARSGH-----CFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT 295
            +   S+P  R GH      + P      L GG            +     ND    +L+
Sbjct: 185 PQPIGSRPLGRYGHKISIIAYNPMQTKLYLFGGQ-----------LDKTYFNDLAMFDLS 233

Query: 296 PDPKK-WQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
              ++   WE L+     P P   ++   +  NK   FGG     ET +++     N+ Y
Sbjct: 234 SFRRRNSHWEFLEPATTVPPPLANHTMVTYG-NKLWVFGG-----ETPKTVS----NETY 283

Query: 355 MFHLELNKWSKL 366
            +    N WSK+
Sbjct: 284 CYDPIQNDWSKI 295

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 65/149 (43%), Gaps = 17/149 (11%)

Query: 113 YNDLYSYSIKNNSWKKYVSQNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYS 170
           Y+ L+  +I    W +   QN+P PR    A+  V   G   + GG      QS    Y 
Sbjct: 151 YHKLHPTTI----WNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHD---QSV---YG 200

Query: 171 DTWLF----DCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           DTW+     + +            +++P  R GH      N F++FGG     N   S  
Sbjct: 201 DTWILSYENNGLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMD 260

Query: 227 NDLWCFDISNYKWSKIE-TNSKPDARSGH 254
           +D++ F+I++YKW+  +    +P  R GH
Sbjct: 261 DDIYLFNINSYKWTIPKPVGQRPLGRYGH 289

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 111/306 (36%), Gaps = 84/306 (27%)

Query: 94  ELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYV-------SQNAPLPRSSAAVAVH 146
           ++++ GG    S       Y D +  S +NN     +       S+N P PR   A  + 
Sbjct: 186 KIYVIGGLHDQS------VYGDTWILSYENNGLSTTITSKTVDISENTPPPRVGHAATLC 239

Query: 147 PSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGRDSSPSARSGHRI--IA 204
            +   +  G      K        D +LF+    K+   +  G+   P  R GH+I  IA
Sbjct: 240 GNAFVIFGGDTHKVNKDGSMD--DDIYLFNINSYKWTIPKPVGQ--RPLGRYGHKISIIA 295

Query: 205 ---WKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYK-----WSKIETNS-KPDARSGHC 255
               K    LFGG  D      +Y NDL  FD+S+++     W  I   S  P   + H 
Sbjct: 296 TSQMKTKLYLFGGQFD-----DTYFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHT 350

Query: 256 FIPTDNSAILMGG---------------------YCKTIAKNN----------------- 277
               D+   + GG                       +T A NN                 
Sbjct: 351 MCSYDHKLWVFGGDTLQGLTNQVFMYDPVDNDWCVVETFANNNDVSNIPPPIQEHAAVLY 410

Query: 278 KNLM---KGK-----ILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYSFNLWKQNK 328
           K+LM    GK      LND + LNL    K  +W KL  +K   P  R G+S  L K +K
Sbjct: 411 KDLMCVIGGKDESDNYLNDVYFLNL----KTLKWFKLPFYKEGVPQGRSGHSVTLLKNDK 466

Query: 329 SVAFGG 334
            +  GG
Sbjct: 467 ILIMGG 472

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 83/209 (39%), Gaps = 31/209 (14%)

Query: 74  ERPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIK-----NNSWK 127
           +RP  R  H +        K +L++FGG+F D+      ++NDL  + +      ++ W+
Sbjct: 281 QRPLGRYGHKISIIATSQMKTKLYLFGGQFDDT------YFNDLVVFDLSSFRRPDSHWE 334

Query: 128 KYVSQN-APLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYH--YSDTWLFDCVERKFNK 184
               ++  P P ++  +  +   + +  G          F +    + W   CV   F  
Sbjct: 335 FIRPKSFIPPPLTNHTMCSYDHKLWVFGGDTLQGLTNQVFMYDPVDNDW---CVVETF-- 389

Query: 185 LEFGGRDSS--PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKI 242
                 D S  P     H  + +K+   + GG  +  N    YLND++  ++   KW K+
Sbjct: 390 --ANNNDVSNIPPPIQEHAAVLYKDLMCVIGGKDESDN----YLNDVYFLNLKTLKWFKL 443

Query: 243 E--TNSKPDARSGHCFIPTDNSAIL-MGG 268
                  P  RSGH      N  IL MGG
Sbjct: 444 PFYKEGVPQGRSGHSVTLLKNDKILIMGG 472

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 100/257 (38%), Gaps = 49/257 (19%)

Query: 126 WKKYVSQNAPLPRSSAAVAVHPS--GIALLHGGEFSSPKQSKFYHYSDTWLFDCVERK-F 182
           W ++    +P PR     + H S      + GG     +QS    Y D W  +  + K F
Sbjct: 37  WNRFKLNPSPFPRYRHVASSHASKDDTLFIIGGLR---EQSV---YGDVWSINHKDDKSF 90

Query: 183 NKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKI 242
           +        ++P  R GH      N  ILFGG     N      +DL+ F++++YKW+  
Sbjct: 91  SASSIEITPTTPPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWTIP 150

Query: 243 E-TNSKPDARSGH-----CFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT- 295
           E    +P  R GH        PT     L GG                  ND    +L+ 
Sbjct: 151 EPIGLRPLGRYGHKISIIATQPTKTKLFLFGGQ-----------FDDTYFNDLSMFDLST 199

Query: 296 ---PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLESVF 349
              PD  +W++ K K+F   P      + Y   LW       FGG        E+L+ + 
Sbjct: 200 FRKPD-AQWEFIKPKSFFPPPVSNHTMISYDNKLW------VFGG--------ETLQGLI 244

Query: 350 YNDLYMFHLELNKWSKL 366
            N+++++   +N WS +
Sbjct: 245 -NEVFVYDPIVNDWSVI 260

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 98/216 (45%), Gaps = 31/216 (14%)

Query: 75  RPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSI----KNNSWKKY 129
           RP  R  H +     Q  K +LF+FGG+F D+      ++NDL  + +    K ++  ++
Sbjct: 156 RPLGRYGHKISIIATQPTKTKLFLFGGQFDDT------YFNDLSMFDLSTFRKPDAQWEF 209

Query: 130 VSQNA--PLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEF 187
           +   +  P P S+  +  + + + +  G              ++ +++D +   ++ +E 
Sbjct: 210 IKPKSFFPPPVSNHTMISYDNKLWVFGGETLQG-------LINEVFVYDPIVNDWSVIET 262

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSK 247
            G  SSP     H  + +KN   + GG     + + +Y+N ++  +++  KW K+  +  
Sbjct: 263 TG--SSPPPIQEHAAVVYKNLMCVVGG----KDSKDNYMNSVYFLNLNTLKWFKL-PHIN 315

Query: 248 P---DARSGH-CFIPTDNSAILMGGYCKTIAKNNKN 279
           P     RSGH   +  D+S +++ G     A+  +N
Sbjct: 316 PGIMQGRSGHTATLLNDDSILILSGDKNDFARPGEN 351

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 83/206 (40%), Gaps = 32/206 (15%)

Query: 169 YSDTWLFDCVE--RKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           Y DTW+    +  ++F+       +++P  R GH      N F++FGG     N +    
Sbjct: 91  YGDTWILRAQDNGKQFSARTIEITETTPPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMD 150

Query: 227 NDLWCFDISNYKWS-KIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKI 285
           +D++  +++++KW+       +P  R GH        +I+     KT             
Sbjct: 151 DDVYLLNVNSHKWTIPHPVGPRPLGRYGHKI------SIIATSQMKTKLYVFGGQFDDTY 204

Query: 286 LNDAWKLNLT----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDL 338
            ND    +L+    PD   W + K  +F   P      V Y + LW       FGG    
Sbjct: 205 FNDLAVYDLSSFRRPD-SHWVFVKPASFVPPPLTNHTMVSYDYKLW------VFGG---- 253

Query: 339 QETEESLESVFYNDLYMFHLELNKWS 364
            +T + L     N+L+++   +N WS
Sbjct: 254 -DTPQGL----INELFVYDPVVNDWS 274

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 66/143 (46%), Gaps = 21/143 (14%)

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETN-SKPDARS 252
           P   + H ++++     +FGG    G      +N+L+ +D     WS +ET  +KP    
Sbjct: 233 PPPLTNHTMVSYDYKLWVFGGDTPQG-----LINELFVYDPVVNDWSVVETTGAKPPPLQ 287

Query: 253 GHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ 312
            H  +   +   ++GG      K++++        D + +N+    K ++W KL +F++ 
Sbjct: 288 EHAAVLYRDLMCVVGG------KDDQD----NYSQDVYFMNM----KTFRWFKLPHFQDM 333

Query: 313 -PSPRVGYSFNLWKQNKSVAFGG 334
            PSPR G+S  L    K +  GG
Sbjct: 334 VPSPRSGHSVTLLANRKLLIMGG 356

 Score = 38.9 bits (89), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 19/129 (14%)

Query: 239 WSKIETNSKPDARSGH---CFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLT 295
           W +++    P  R  H    +    N  I++GG           L    +  D W L   
Sbjct: 52  WDRVKLVQTPFPRYRHVASAYASDTNEVIVIGG-----------LHDQSVYGDTWILRAQ 100

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            + K++    ++  +  P PRVG++  L   N  V FGG  D  +T    E +  +D+Y+
Sbjct: 101 DNGKQFSARTIEITETTPPPRVGHAATLCG-NAFVIFGG--DTHKTNN--EGLMDDDVYL 155

Query: 356 FHLELNKWS 364
            ++  +KW+
Sbjct: 156 LNVNSHKWT 164

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 96/262 (36%), Gaps = 46/262 (17%)

Query: 126 WKKYVSQNAPLPRSSAAVAVHPSG------IALLHGGEFSSPKQSKFYHYSDTWLFDCVE 179
           W +   Q++P PR     + + S       I  LH              Y DTW+ +  +
Sbjct: 94  WNRVKLQDSPFPRYRHVASSYVSDDNRIYVIGGLHDESV----------YGDTWIINVDD 143

Query: 180 R--KFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
              +F+       + +P  R GH      N F++FGG     N +    +DL+ F+I+++
Sbjct: 144 SGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLYLFNINSF 203

Query: 238 KWS-KIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTP 296
           KW+       +P  R GH        +I+     KT              ND    +L+ 
Sbjct: 204 KWTIPHPVGPRPLGRYGHKI------SIIATNQMKTKLYLFGGQFDDTFFNDLAVYDLSS 257

Query: 297 ---DPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
                  W++ K K F   P      V Y   LW       FGG     +T + L     
Sbjct: 258 FRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLW------IFGG-----DTMQGL----I 302

Query: 351 NDLYMFHLELNKWSKLRIKSQR 372
           N ++++ +  N WS +     R
Sbjct: 303 NKVFVYDIMSNDWSLVETTGAR 324

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 66/143 (46%), Gaps = 21/143 (14%)

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETN-SKPDARS 252
           P   + H ++++ +   +FGG  D   G    +N ++ +DI +  WS +ET  ++P    
Sbjct: 275 PPPLANHTMVSYDHKLWIFGG--DTMQG---LINKVFVYDIMSNDWSLVETTGARPPPLQ 329

Query: 253 GHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK-N 311
            H  +   +   ++GG      K+ +++     LN  + LNL    K  +W K   FK  
Sbjct: 330 EHAALIYKDLMCVVGG------KDEQDIY----LNSIYFLNL----KSCRWFKFPVFKAG 375

Query: 312 QPSPRVGYSFNLWKQNKSVAFGG 334
            P  R G+S  L K NK +  GG
Sbjct: 376 IPQGRSGHSITLLKNNKILIMGG 398

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 84/204 (41%), Gaps = 29/204 (14%)

Query: 75  RPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSI-----KNNSWKK 128
           RP  R  H +        K +L++FGG+F D+      F+NDL  Y +      ++ W+ 
Sbjct: 214 RPLGRYGHKISIIATNQMKTKLYLFGGQFDDT------FFNDLAVYDLSSFRRSDSHWEF 267

Query: 129 YVSQN-APLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEF 187
              +   P P ++  +  +   + +  G              +  +++D +   ++ +E 
Sbjct: 268 LKPKTFVPPPLANHTMVSYDHKLWIFGGDTMQG-------LINKVFVYDIMSNDWSLVET 320

Query: 188 GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIET--N 245
            G  + P     H  + +K+   + GG     + Q  YLN ++  ++ + +W K      
Sbjct: 321 TG--ARPPPLQEHAALIYKDLMCVVGG----KDEQDIYLNSIYFLNLKSCRWFKFPVFKA 374

Query: 246 SKPDARSGHCFIPTDNSAIL-MGG 268
             P  RSGH      N+ IL MGG
Sbjct: 375 GIPQGRSGHSITLLKNNKILIMGG 398

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 97/258 (37%), Gaps = 52/258 (20%)

Query: 126 WKKYVSQNAPLPRSSAAVAVHPS--GIALLHGGEFSSPKQSKFYHYSDTWLFDCVE---- 179
           W +    N+P PR     + H +  G   + GG      QS    Y DTW+    +    
Sbjct: 147 WGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHD---QSV---YGDTWILTASDIDKT 200

Query: 180 ---RKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISN 236
                F        +S+P  R GH      N F++FGG     N      +DL+  +I++
Sbjct: 201 GAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDLYLLNINS 260

Query: 237 YKWSKIE-TNSKPDARSGHCFIPTDNSAILMGGYCKTI-AKNNKNLMKGKILNDAWKLNL 294
           YKW+  +    +P  R GH  +              TI A+  K  + G   +D +  +L
Sbjct: 261 YKWTIPKPVGQRPLGRYGHKIV--------------TISAEQTKLYLFGGQFDDTYFGDL 306

Query: 295 T---------PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESL 345
                     PD   W + K   F   P P   ++   + Q+K   FGG        ++L
Sbjct: 307 AVFDLSSFRRPD-SHWVFLKPSGF--NPPPLTNHTMVTY-QDKIWVFGG--------DTL 354

Query: 346 ESVFYNDLYMFHLELNKW 363
           E    N +Y++    N W
Sbjct: 355 EEGLINRVYLYSPTNNSW 372

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 102/238 (42%), Gaps = 40/238 (16%)

Query: 74  ERPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYN----DLYSYSIKNNSWK- 127
           +RP  R  H ++  + +  K  L++FGG+F D     T+F +    DL S+   ++ W  
Sbjct: 271 QRPLGRYGHKIVTISAEQTK--LYLFGGQFDD-----TYFGDLAVFDLSSFRRPDSHWVF 323

Query: 128 -KYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLE 186
            K    N P P ++  +  +   I +  G        ++ Y YS T         +  +E
Sbjct: 324 LKPSGFNPP-PLTNHTMVTYQDKIWVFGGDTLEEGLINRVYLYSPT------NNSWEIVE 376

Query: 187 FGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIE--T 244
             G    P     H  I +K+   + GG     + + +YLN L+  ++ + KW K+    
Sbjct: 377 TTG--DIPPPMQEHAAIVYKDLMCVVGG----KDAEDNYLNTLYFLNLQSLKWFKLPFYK 430

Query: 245 NSKPDARSGHCFIPTDNSAIL-MGG-------YCKTIAKNNKNLMKGKILNDAWKLNL 294
           N+ P  RSGH      N  IL MGG         + +  ++ ++ KG IL   + LNL
Sbjct: 431 NNIPQGRSGHSVTLLKNDQILIMGGDKYDYSSSTENMHISDVDMGKGTIL---YTLNL 485

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 110/284 (38%), Gaps = 65/284 (22%)

Query: 95  LFIFGGEFTDSETKLTHFYN-------DLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHP 147
             +FGG+        TH  N       DLY  +I +  W        P P     +  + 
Sbjct: 233 FVVFGGD--------THKVNSDGLMDDDLYLLNINSYKW------TIPKPVGQRPLGRYG 278

Query: 148 SGIALLHGGEFSSPKQSKFY----HYSDTWLFDCVERKFNKLEFGGRDS----------S 193
             I  +      S +Q+K Y     + DT+  D     F+   F   DS          +
Sbjct: 279 HKIVTI------SAEQTKLYLFGGQFDDTYFGDLA--VFDLSSFRRPDSHWVFLKPSGFN 330

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSK-PDARS 252
           P   + H ++ +++   +FGG       +   +N ++ +  +N  W  +ET    P    
Sbjct: 331 PPPLTNHTMVTYQDKIWVFGG----DTLEEGLINRVYLYSPTNNSWEIVETTGDIPPPMQ 386

Query: 253 GHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ 312
            H  I   +   ++GG     A++N        LN  + LNL    +  +W KL  +KN 
Sbjct: 387 EHAAIVYKDLMCVVGGKD---AEDN-------YLNTLYFLNL----QSLKWFKLPFYKNN 432

Query: 313 -PSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            P  R G+S  L K ++ +  GG  D  +   S E++  +D+ M
Sbjct: 433 IPQGRSGHSVTLLKNDQILIMGG--DKYDYSSSTENMHISDVDM 474

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 60/285 (21%), Positives = 111/285 (38%), Gaps = 50/285 (17%)

Query: 93  HELFIFGGE--FTDSETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGI 150
           H+  ++G     T S+   T   N   S +I+       ++++ P PR   A  +   G 
Sbjct: 181 HDQSVYGDTWILTASDIDKTGAINSFKSTTIE-------ITESTPPPRVGHASTL--CGN 231

Query: 151 ALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGRDSSPSARSGHRII---AWKN 207
           A +  G  +    S      D +L +    K+   +  G+   P  R GH+I+   A + 
Sbjct: 232 AFVVFGGDTHKVNSDGLMDDDLYLLNINSYKWTIPKPVGQ--RPLGRYGHKIVTISAEQT 289

Query: 208 YFILFGGFRDLGNGQTSYLNDLWCFDISNYK-----WSKIETNS-KPDARSGHCFIPTDN 261
              LFGG  D      +Y  DL  FD+S+++     W  ++ +   P   + H  +   +
Sbjct: 290 KLYLFGGQFD-----DTYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQD 344

Query: 262 SAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSF 321
              + GG          + ++  ++N  +  +    P    WE ++   + P P   ++ 
Sbjct: 345 KIWVFGG----------DTLEEGLINRVYLYS----PTNNSWEIVETTGDIPPPMQEHAA 390

Query: 322 NLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKL 366
            ++K    V  G         +  E  + N LY  +L+  KW KL
Sbjct: 391 IVYKDLMCVVGG---------KDAEDNYLNTLYFLNLQSLKWFKL 426

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 98/263 (37%), Gaps = 54/263 (20%)

Query: 126 WKKYVSQNAPLPRSSAAVAVHPSG------IALLHGGEFSSPKQSKFYHYSDTWLFDCVE 179
           W +    N+P PR     + + S       I  LH              Y DTW    + 
Sbjct: 142 WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV----------YGDTW---SIT 188

Query: 180 RKFNKLEFGGR-----DSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDI 234
              N  +F  +     D SP  R GH      N F++FGG     N      +D++ F+I
Sbjct: 189 STNNGTQFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLMDDDIYLFNI 248

Query: 235 SNYKWS-KIETNSKPDARSGH--CFIPTDNSAI---LMGGYCKTIAKNNKNLMKGKILND 288
           +++KW+       +P  R GH    I T +S     L GG                  ND
Sbjct: 249 NSHKWTIPSPVGPRPLGRYGHKISIIATSSSKTKLYLFGGQ-----------FDDTYFND 297

Query: 289 AWKLNLTPDPKK-WQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLES 347
               +L+   +    WE +K     P P   ++   +  NK   FGG     +T++ L  
Sbjct: 298 IAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTY-DNKLWVFGG-----DTKDGL-- 349

Query: 348 VFYNDLYMFHL--ELNKWSKLRI 368
              ND+Y F     +N W+K+ +
Sbjct: 350 --INDIYAFDPADSINTWTKIDV 370

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 112/295 (37%), Gaps = 59/295 (20%)

Query: 93  HELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQN------APLPRSSAAVAVH 146
           +E+F+ GG    S       Y D +S +  NN   +++S+       +P PR   A  + 
Sbjct: 167 NEIFVIGGLHDQS------VYGDTWSITSTNNG-TQFISKALEILDLSPPPRVGHASTLC 219

Query: 147 PSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFN-KLEFGGRDSSPSARSGHRI--I 203
            +   +  G      K        D +LF+    K+      G R   P  R GH+I  I
Sbjct: 220 GNAFVVFGGDTHKVNKDGLMD--DDIYLFNINSHKWTIPSPVGPR---PLGRYGHKISII 274

Query: 204 AW---KNYFILFGG-FRDLGNGQTSYLNDLWCFDISNYK-----WSKIETNS-KPDARSG 253
           A    K    LFGG F D      +Y ND+  FD+S+++     W  I+     P   + 
Sbjct: 275 ATSSSKTKLYLFGGQFDD------TYFNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTN 328

Query: 254 HCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQP 313
           H  +  DN   + GG  K             ++ND +  +  P      W K+    + P
Sbjct: 329 HTMVTYDNKLWVFGGDTK-----------DGLINDIYAFD--PADSINTWTKIDVTGDIP 375

Query: 314 SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKLRI 368
            P   +S  ++  N     GG        +    ++ N ++ F+ +  KW K  I
Sbjct: 376 CPVQEHSALIY-DNLMCVIGG--------KDENDMYLNSVHFFNFDKLKWFKFPI 421

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 87/205 (42%), Gaps = 29/205 (14%)

Query: 75  RPSCR-THPLMFANPQHNKHELFIFGGEFTDSETKLTHFYN----DLYSYSIKNNSWKKY 129
           RP  R  H +       +K +L++FGG+F D     T+F +    DL S+   ++ W+  
Sbjct: 262 RPLGRYGHKISIIATSSSKTKLYLFGGQFDD-----TYFNDIAVFDLSSFRRADSHWEFI 316

Query: 130 VSQN-APLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVE--RKFNKLE 186
             +   P P ++  +  + + + +  GG+      +K    +D + FD  +    + K++
Sbjct: 317 KPKGLIPPPMTNHTMVTYDNKLWVF-GGD------TKDGLINDIYAFDPADSINTWTKID 369

Query: 187 FGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSK--IET 244
             G    P     H  + + N   + GG     +    YLN +  F+    KW K  I  
Sbjct: 370 VTG--DIPCPVQEHSALIYDNLMCVIGG----KDENDMYLNSVHFFNFDKLKWFKFPIFK 423

Query: 245 NSKPDARSGHCFIPTDNSAIL-MGG 268
           +     RSGH     +N+ IL MGG
Sbjct: 424 SGIMQGRSGHSISLLNNNKILIMGG 448

>SAKL0C13530g Chr3 complement(1192946..1195039) [2094 bp, 697 aa]
           {ON} similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 697

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 49/112 (43%), Gaps = 22/112 (19%)

Query: 240 SKIETNSKPDARSGHCFIPTD-NSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDP 298
           S I+++  P  R  H F   D N+ IL GG     A N       K L D W L      
Sbjct: 423 SAIDSSRIPQERMCHTFTYVDDNTCILAGG---RTAPN-------KTLEDVWILTRKQSE 472

Query: 299 KKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGG--------VYDLQETE 342
             W+W++  N    P PR  +S  L  +++ + +GG        VYD+++ E
Sbjct: 473 GAWEWQQGLNL---PDPRFRHSACLLNEHQLLIYGGKTRGSTFLVYDMRKNE 521

>YOL141W Chr15 (56452..58539) [2088 bp, 695 aa] {ON}
           PPM2AdoMet-dependent tRNA methyltransferase also
           involved in methoxycarbonylation; required for the
           synthesis of wybutosine (yW), a modified guanosine found
           at the 3'-position adjacent to the anticodon of
           phe-tRNA; similarity to Ppm1p
          Length = 695

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 194 PSARSGHRI--IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSKPDAR 251
           P AR  H    I+  N  +L GG +    G    L+D W FD+   +WS I++ S    R
Sbjct: 437 PVARMCHTFTTISRNNQLLLIGGRKAPHQG----LSDNWIFDMKTREWSMIKSLSHTRFR 492

Query: 252 SGHCFIPTDNSAILMGG 268
              C +P D + +++GG
Sbjct: 493 HSACSLP-DGNVLILGG 508

>Smik_15.13 Chr15 (24574..26733) [2160 bp, 719 aa] {ON} YOL141W
           (REAL)
          Length = 719

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 36/77 (46%), Gaps = 7/77 (9%)

Query: 194 PSARSGHRI--IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSKPDAR 251
           P AR  H    +   +  +L GG +    G    L D W FDI   +WS I++ S    R
Sbjct: 437 PDARMCHTFTTLCSNDQLLLVGGRKAPHQG----LCDNWIFDIKKREWSMIQSLSHTRFR 492

Query: 252 SGHCFIPTDNSAILMGG 268
              C +P D + ++MGG
Sbjct: 493 HSACNLP-DGNVLIMGG 508

>TBLA0D02120 Chr4 (535081..539520) [4440 bp, 1479 aa] {ON} Anc_8.157
           YGL197W
          Length = 1479

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 50/118 (42%), Gaps = 17/118 (14%)

Query: 167 YHYSDTWLFDCVERKFNKLEFGGRDSSPSA------RSGHRIIAWKNYFILFGGFRDLGN 220
           Y  S+T+  D VER + ++     ++S +       R  H I     Y  LFGG   + +
Sbjct: 127 YISSETFNLDLVERTWVRVSTTVVNNSENTGPFFKPRILHTICYTNAYLYLFGGLT-ISD 185

Query: 221 GQTSYL---NDLWCFDISNYKWSKIETNSKPDARSGHCFI-------PTDNSAILMGG 268
           G    L   N+LW  ++   KWS +  +S   AR  H  +         D   +++GG
Sbjct: 186 GDPKILVPSNELWKLNLQTKKWSLVAKDSNIPARFSHTMVVKYEDDDSHDTKLVIIGG 243

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 40/94 (42%), Gaps = 16/94 (17%)

Query: 255 CFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEK--------- 305
            FIPT  S+ +     K + + N+   +G      + +N+ P+ +K + EK         
Sbjct: 281 MFIPTSTSSKIHQKLSKAVVRKNQRQNQGP---GTYIINMDPEVEKRELEKKQSQILRDR 337

Query: 306 ----LKNFKNQPSPRVGYSFNLWKQNKSVAFGGV 335
               LK  + Q SP VG+     KQ+   A+G  
Sbjct: 338 RKRQLKEKEKQESPDVGFETAFRKQSSPTAYGAT 371

>Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W
           (REAL)
          Length = 708

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 194 PSARSGHRIIAW--KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSKPDAR 251
           P AR  H + ++   +  +L GG +    G    L+D W FD    +WS ++  S    R
Sbjct: 450 PLARMCHTLTSFCGSSQLLLVGGRKAPHQG----LSDNWIFDTKTNEWSMVQKLSHTRFR 505

Query: 252 SGHCFIPTDNSAILMGGYCK 271
              C + +DNS ++ GG  K
Sbjct: 506 HSACNL-SDNSVLIFGGVTK 524

>Skud_15.13 Chr15 (21709..23796) [2088 bp, 695 aa] {ON} YOL141W
           (REAL)
          Length = 695

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 33/81 (40%), Gaps = 6/81 (7%)

Query: 189 GRDSSPSARSGHRIIAW--KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNS 246
           G    P AR  H + A       +L GG +    G    L+D W FD    +WS I++  
Sbjct: 432 GSSELPVARMCHTLTALYGNEQLLLIGGRKAPHQG----LSDNWIFDTKKREWSMIQSLP 487

Query: 247 KPDARSGHCFIPTDNSAILMG 267
               R   C +  DN  IL G
Sbjct: 488 HTRFRHSACNLSDDNVLILGG 508

>KNAG0D02100 Chr4 (351677..356740) [5064 bp, 1687 aa] {ON} Anc_8.157
           YGL197W
          Length = 1687

 Score = 34.7 bits (78), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 3/88 (3%)

Query: 171 DTWLFDCVERKFNKL--EFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNG-QTSYLN 227
           + +  D + RK+N+L   F   D     R  H I    +   +FGG     NG +    N
Sbjct: 115 EIFFLDLISRKWNRLPTSFKNPDVPMRERLFHTISYSHSAMYVFGGLIVSTNGYELIATN 174

Query: 228 DLWCFDISNYKWSKIETNSKPDARSGHC 255
           +LW  D++N  WS +  + +   R  H 
Sbjct: 175 ELWKLDLTNRVWSLLSEDPQITRRFNHT 202

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 219 GNGQTSYLNDLWCFDISNYKWSKIETNSKPDARS---------GHCFIPTDNSAILMGG 268
           G+ +T    D+W +DI    WS+I T+ K +A           GH  +     A+ +GG
Sbjct: 676 GSNKTDVCRDMWWYDIETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVGGMAVFVGG 734

>KNAG0A01180 Chr1 (9765..11795) [2031 bp, 676 aa] {ON} Anc_3.15
           YOL141W
          Length = 676

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 37/91 (40%), Gaps = 5/91 (5%)

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSKPDARSG 253
           P AR+ H      N  +L  G R   N      ND+W +D  +  W   +  S P  R  
Sbjct: 418 PDARTCHTWTKLGNGKVLLVGGR---NAPHRPYNDIWIYDTEHNLWE--QKTSLPYPRFR 472

Query: 254 HCFIPTDNSAILMGGYCKTIAKNNKNLMKGK 284
           HC    D + +L+ G   T++    N+   K
Sbjct: 473 HCTAQVDENCVLIYGGSSTLSVTPFNICDVK 503

>Smik_1.9 Chr1 (22221..24845) [2625 bp, 874 aa] {ON} YAL056W (REAL)
          Length = 874

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 10/57 (17%)

Query: 210 ILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSKPDARSGHCFIPTDNSAILM 266
           I+FGG+R  G+ +   +NDLW          KIE       + G+C      +AILM
Sbjct: 500 IIFGGYRQTGDDRYEAMNDLW----------KIEIPVTRRGKKGYCKFSETANAILM 546

>KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9
           YAL056W
          Length = 878

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 11/61 (18%)

Query: 219 GNGQTSYLNDLWCFDISNYKWSKIETNSKPDARS-----------GHCFIPTDNSAILMG 267
           G+  T+   D+W FD+  ++W+K+ T  KP  +            GH  + +   A+ +G
Sbjct: 701 GSDDTNVYGDMWWFDLETFQWTKVATYIKPKDQDSSLVPINIKIVGHTMMTSGCMAVCVG 760

Query: 268 G 268
           G
Sbjct: 761 G 761

>Suva_1.10 Chr1 (16429..19107) [2679 bp, 892 aa] {ON} YAL056W (REAL)
          Length = 892

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 10/58 (17%)

Query: 209 FILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSKPDARSGHCFIPTDNSAILM 266
            I+FGG+R  G+ +   +NDLW          KIE       + G+C      +AILM
Sbjct: 510 IIIFGGYRQTGDDRYEAMNDLW----------KIEIPVIRRGKKGYCKFSETANAILM 557

>ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL056W
           (KRH1) and YOR371C (KRH2)
          Length = 784

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 31/72 (43%), Gaps = 13/72 (18%)

Query: 151 ALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGRDSSPSARS-------GHRII 203
            ++HGG   S        Y D W FD  + +++++    RD     R        GH I 
Sbjct: 611 VIIHGGSDGS------RVYGDMWWFDLADERWSRIALYSRDPDSGERRPIGLPAVGHSIF 664

Query: 204 AWKNYFILFGGF 215
             ++ F+L+GG 
Sbjct: 665 HSRDEFLLYGGL 676

>NDAI0A08860 Chr1 complement(2037552..2040122) [2571 bp, 856 aa]
           {ON} Anc_7.9 YAL056W
          Length = 856

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 39/89 (43%), Gaps = 17/89 (19%)

Query: 189 GRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSKP 248
           G    P  ++G+     K+  +L GG     +       D+W F+I    WSKI+T++K 
Sbjct: 657 GHQQHPQKKNGY---GDKSVLVLHGG-----SNNNKVFGDMWWFNIETKIWSKIDTHAKT 708

Query: 249 DARS---------GHCFIPTDNSAILMGG 268
           +            GH  + T+  +I +GG
Sbjct: 709 EKDELIPIEMKLVGHTMVDTNFMSINIGG 737

>ZYRO0G19426g Chr7 complement(1614527..1619311) [4785 bp, 1594 aa]
           {ON} weakly similar to uniprot|P53094 Saccharomyces
           cerevisiae YGL197W MDS3 Protein with an N-terminal
           kelch- like domain putative negative regulator of early
           meiotic gene expression required with Pmd1p for growth
           under alkaline conditions
          Length = 1594

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 48/118 (40%), Gaps = 22/118 (18%)

Query: 171 DTWLFDCVERKFNKLE-------FGGRDSSP--SARSGHRIIAWKNYFILFGGFRDLGNG 221
           + +  D + R + +LE        G  D  P  S R  H I    +   +FGG   + + 
Sbjct: 99  EVFFLDLISRSWKRLETEMDTQYIGEHDEVPKLSERFFHSISFCSSCLYIFGGL--MVSP 156

Query: 222 QTSY----LNDLWCFDISNYKWSKIETNSKPDARSGHCF------IPT-DNSAILMGG 268
           Q  Y     N+LW  D++  KWS I  + +   R  H        I T D   +++GG
Sbjct: 157 QNGYELIASNELWKLDLTTRKWSLISRDPQIARRFAHTMHTKNENIETRDTKLVIVGG 214

>Kpol_495.2 s495 complement(6278..9313,9316..10815) [4536 bp, 1511
           aa] {ON} complement(6278..9313,9316..10815) [4536 nt,
           1512 aa]
          Length = 1511

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 11/79 (13%)

Query: 229 LWCFDISNYKWSKIET---NSKPD---ARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMK 282
           ++  D+ + KWSKI+T   N   D   +R  H  +  D++  L GG        N  L+ 
Sbjct: 143 IFHLDLISRKWSKIDTIIPNDNTDFALSRLFHSIVYLDSAIYLFGGLILCPRAENYKLVP 202

Query: 283 GKILNDAWKLNLTPDPKKW 301
               ND WKL+LT   KKW
Sbjct: 203 T---NDLWKLDLT--TKKW 216

>CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} similar
           to uniprot|P32634 Saccharomyces cerevisiae YER132c PMD1
           or uniprot|P53094 Saccharomyces cerevisiae YGL197w MDS3
          Length = 1633

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 49/116 (42%), Gaps = 17/116 (14%)

Query: 170 SDTWLFDCVERKFNKLEFGGRDSSPS--------ARSGHRIIAWKNYFILFGGFRDLGNG 221
           S+T+  D + R + +LE    +SS +         R  H +   + +  +FGG     + 
Sbjct: 125 SETFFLDLISRSWRRLETTIDESSTTDDTNIKTNGRLFHAMCFNEGFLYIFGGLMISPHN 184

Query: 222 QTSYL--NDLWCFDISNYKWSKIETNSKPDARSGHCF------IPT-DNSAILMGG 268
           +  ++  NDLW  D+   KWS +  +     R  H         PT D   +++GG
Sbjct: 185 EYEFVATNDLWQLDLRGNKWSLLSKDPGVGRRYNHEMHVLNSEDPTKDTKLVIVGG 240

>ZYRO0G05148g Chr7 complement(413934..417206) [3273 bp, 1090 aa]
           {ON} similar to uniprot|P53893 Saccharomyces cerevisiae
           YNL163C
          Length = 1090

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 592 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEE-----ERLEDTGGI--IERDVT 644
           T  I+NN+ LKG+ LK     L  D  W+  + VT+ +     E++  T GI  + RD++
Sbjct: 276 TKKITNNKGLKGRSLKPLFVSLILDNIWKIYENVTVSKNLEVIEKITKTLGINVLPRDLS 335

Query: 645 TKPSKR 650
           +K  K+
Sbjct: 336 SKDDKQ 341

>YAL056W Chr1 (39259..41901) [2643 bp, 880 aa] {ON}  GPB2Multistep
           regulator of cAMP-PKA signaling; inhibits PKA downstream
           of Gpa2p and Cyr1p, thereby increasing cAMP dependency;
           inhibits Ras activity through direct interactions with
           Ira1p/2p; regulated by G-alpha protein Gpa2p; homolog of
           Gpb1p
          Length = 880

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 10/57 (17%)

Query: 210 ILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIETNSKPDARSGHCFIPTDNSAILM 266
           I+FGG+R  G+ +   +NDLW          KIE       + G+C      +AIL+
Sbjct: 503 IIFGGYRQTGDDRYEAMNDLW----------KIEIPVIRRGKKGYCKFSETANAILL 549

>KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {ON} 
          Length = 819

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 207 NYFILFGGFRDLGNGQTSYLNDLWCFDI 234
           N  ++FGG++ +G+ +   +NDLW  DI
Sbjct: 496 NRILIFGGYKQVGDDEYEAMNDLWQVDI 523

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 219 GNGQTSYLNDLWCFDISNYKWSKIETNSKPD---------ARSGHCFIPTDNSAILMGGY 269
           G+  T   +D+W FD     W +IET ++ +         A +GH      +++I +GG 
Sbjct: 664 GSNATHIYSDMWWFDFETESWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGGM 723

Query: 270 CKT 272
            ++
Sbjct: 724 MQS 726

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,352,431
Number of extensions: 2925692
Number of successful extensions: 9288
Number of sequences better than 10.0: 89
Number of HSP's gapped: 9152
Number of HSP's successfully gapped: 176
Length of query: 651
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 535
Effective length of database: 40,180,143
Effective search space: 21496376505
Effective search space used: 21496376505
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)