Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.469singletonON29291414e-14
YPL261CsingletonOFF10230532.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.469
         (29 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.469 Chr6 (771990..772076) [87 bp, 29 aa] {ON} YPL261C (REAL)    59   4e-14
YPL261C Chr16 complement(48996..49304) [309 bp, 102 aa] {OFF} Du...    25   2.4  

>Smik_6.469 Chr6 (771990..772076) [87 bp, 29 aa] {ON} YPL261C
          (REAL)
          Length = 29

 Score = 58.9 bits (141), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 29/29 (100%), Positives = 29/29 (100%)

Query: 1  KLYKRFCSCPLFYLLSFMKIPLYQKRVMI 29
          KLYKRFCSCPLFYLLSFMKIPLYQKRVMI
Sbjct: 1  KLYKRFCSCPLFYLLSFMKIPLYQKRVMI 29

>YPL261C Chr16 complement(48996..49304) [309 bp, 102 aa] {OFF}
          Dubious open reading frame unlikely to encode a
          protein; partially overlaps the uncharacterized ORF
          YPL260W
          Length = 102

 Score = 25.0 bits (53), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 1  KLYKRFCSCP-LFYLLSFMKIPLYQKRVMI 29
          KL K  CS   L Y LSF+KIPL   RV++
Sbjct: 43 KLLKEICSSGVLSYSLSFLKIPLSVMRVIL 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.343    0.152    0.506 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 2,639,523
Number of extensions: 38064
Number of successful extensions: 177
Number of sequences better than 10.0: 2
Number of HSP's gapped: 177
Number of HSP's successfully gapped: 2
Length of query: 29
Length of database: 53,481,399
Length adjustment: 4
Effective length of query: 25
Effective length of database: 53,022,735
Effective search space: 1325568375
Effective search space used: 1325568375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 38 (21.5 bits)
S2: 59 (27.3 bits)