Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.4677.125ON54854827250.0
YPL260W7.125ON55155125540.0
Skud_16.187.125ON55051924970.0
Suva_16.447.125ON54951824520.0
NCAS0E021307.125ON52651220060.0
NDAI0E036707.125ON52250919070.0
TDEL0H028707.125ON58752219020.0
CAGL0H09108g7.125ON53251118710.0
SAKL0F05390g7.125ON59551718760.0
KNAG0L009407.125ON54952518480.0
KLLA0D14355g7.125ON58850918310.0
KLTH0F12540g7.125ON59550918220.0
ZYRO0C05192g7.125ON58852118060.0
Kwal_55.208327.125ON57551817760.0
TBLA0A009307.125ON58651717130.0
Ecym_83527.125ON57951916790.0
KAFR0L004607.125ON51150816590.0
Kpol_322.77.125ON53449815980.0
TPHA0C016107.125ON55151315640.0
ADL019W7.125ON52546914120.0
Kpol_1062.587.125ON4914414594e-50
Ecym_33822.340ON59885761.1
YLR457C (NBP1)7.531ON31994751.3
TBLA0E043708.254ON67647724.0
AFR357W1.479ON434121705.0
KLLA0A04884g4.105ON105956715.2
TPHA0A049605.113ON2077114706.5
TPHA0F026206.70ON918101697.6
KLLA0E23849g8.559ON440113689.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.467
         (548 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...  1054   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   988   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   966   0.0  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   949   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   777   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   739   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   737   0.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   725   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   727   0.0  
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   716   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   709   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   706   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   700   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   688   0.0  
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   664   0.0  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   651   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   643   0.0  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   620   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   607   0.0  
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   548   0.0  
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   181   4e-50
Ecym_3382 Chr3 (724394..726190) [1797 bp, 598 aa] {ON} similar t...    34   1.1  
YLR457C Chr12 complement(1055812..1056771) [960 bp, 319 aa] {ON}...    33   1.3  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...    32   4.0  
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...    32   5.0  
KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} simil...    32   5.2  
TPHA0A04960 Chr1 (1115122..1121355) [6234 bp, 2077 aa] {ON} Anc_...    32   6.5  
TPHA0F02620 Chr6 complement(577529..580285) [2757 bp, 918 aa] {O...    31   7.6  
KLLA0E23849g Chr5 (2119396..2120718) [1323 bp, 440 aa] {ON} simi...    31   9.1  

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score = 1054 bits (2725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/548 (95%), Positives = 522/548 (95%)

Query: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60
           MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60

Query: 61  LDDIRKNSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120
           LDDIRKNSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 61  LDDIRKNSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120

Query: 121 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNER 180
           STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNER
Sbjct: 121 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNER 180

Query: 181 KKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXX 240
           KKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLV      
Sbjct: 181 KKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVASAKKT 240

Query: 241 XXXXXXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGK 300
                 NINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGK
Sbjct: 241 MSKSSANINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGK 300

Query: 301 FKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLE 360
           FKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLE
Sbjct: 301 FKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLE 360

Query: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420
           NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK
Sbjct: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420

Query: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 480
           LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF
Sbjct: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 480

Query: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQNPXXXXXXXXXXXXXXVVDSNSE 540
           YDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQNP              VVDSNSE
Sbjct: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQNPSSSDNSDDGDNEESVVDSNSE 540

Query: 541 TESEYQRE 548
           TESEYQRE
Sbjct: 541 TESEYQRE 548

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/551 (89%), Positives = 506/551 (91%), Gaps = 3/551 (0%)

Query: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60
           MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60

Query: 61  LDDIRKNSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120
           LDDIRKNSHETPAKSAATLIH+TELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 61  LDDIRKNSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120

Query: 121 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNER 180
           STVESLLEHLNESNVFTHHDLSPIKERL+EISKIVEQKNSS  Y+EDGNDDRLREIDNER
Sbjct: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNER 180

Query: 181 KKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXX 240
           KKNKIEEDLLLRAKLKHCKDEYD LE KLEEIDPSLS+VMEKLFRIRRGLLSLV      
Sbjct: 181 KKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT 240

Query: 241 XXXXXXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGK 300
                 N NSLL+EQND Q NN  L DDKHLVSQEYVHEKLSVLK+EL+ELESNRDDSGK
Sbjct: 241 MSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 300

Query: 301 FKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLE 360
           FKSLE+HQVA  GQSVLNGLLDDCHDL+NDLSHQ NGGL+LDPYLQPIYEQLIDIKTTLE
Sbjct: 301 FKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLE 360

Query: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420
           NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK
Sbjct: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420

Query: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 480
           LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRT+GIF
Sbjct: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIF 480

Query: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQNPXXXXXXXXXXXXXXVVDSN-- 538
           YDSDGNIPEGQGILNALLAECFDILHELKVEAEE+AQN                +DSN  
Sbjct: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQNSTSSDGSDDDDNGESGIDSNSN 540

Query: 539 -SETESEYQRE 548
            SE ESEYQ+E
Sbjct: 541 DSEPESEYQQE 551

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/519 (91%), Positives = 493/519 (94%), Gaps = 1/519 (0%)

Query: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60
           MF+SAGQ HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFSSAGQ-HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 59

Query: 61  LDDIRKNSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120
           LDDIRKNSH+TPAKSAATLIH+TELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 60  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 119

Query: 121 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNER 180
           STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSS  Y ED ND R+REIDNER
Sbjct: 120 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNER 179

Query: 181 KKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXX 240
           K+NKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLS+VMEKLFRIRRGLLSLV      
Sbjct: 180 KQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT 239

Query: 241 XXXXXXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGK 300
                 NINSLL+E ND QAN+N LMDDKHLVSQEYVHEKLSVLK+EL+ELESNRDDSGK
Sbjct: 240 MSKSSANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 299

Query: 301 FKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLE 360
           FKSLETH+V   GQSVLNGLLDDCHDLI+DLSHQTNGGL+LDP+LQP YEQLIDIKTTLE
Sbjct: 300 FKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLE 359

Query: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420
           NLMITRRWTLRETDLFSYQKKLNEID+KRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK
Sbjct: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 419

Query: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 480
           LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRT+GIF
Sbjct: 420 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIF 479

Query: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQNP 519
           YDSDGNIPEGQGILNALLAECFDI+HELKVEAEERA NP
Sbjct: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERALNP 518

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  949 bits (2452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/518 (89%), Positives = 492/518 (94%), Gaps = 1/518 (0%)

Query: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60
           MF+SAGQQHPQIVPKEEESILNYLLEVRS+LAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFSSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60

Query: 61  LDDIRKNSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120
           LDDIRKNSH+TPAKSAATLIH+TELHNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYASL
Sbjct: 61  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASL 120

Query: 121 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNER 180
           STVESLLEHLNESNVFTHHDLSPIKERL+EI KIVE KN+   Y+EDGNDD+LREIDNER
Sbjct: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVE-KNTGPNYDEDGNDDQLREIDNER 179

Query: 181 KKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXX 240
            KN+IEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLS+VMEKLF+IRRGLLSLV      
Sbjct: 180 NKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKT 239

Query: 241 XXXXXXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGK 300
                 NI+SLL++ ND + NNN LMDDKHLVSQEYV+EKL+ LK+ELNELESNRD+SGK
Sbjct: 240 MSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGK 299

Query: 301 FKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLE 360
           FKSLE+H+VA NGQSVLNGLLDDCHDL+NDLSHQTNGGL+LDP LQPIYEQLIDIKTTLE
Sbjct: 300 FKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLE 359

Query: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420
           NLMITRRWTLRETDLFSYQKKLNEID+KR+ GKFPTK+QDSKGQSILLYLLRRCYAIIYK
Sbjct: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYK 419

Query: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 480
           LLESSEPVSEALQP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF
Sbjct: 420 LLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 479

Query: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQN 518
           YDSDGNIPEGQGILNALLAECFDI+HELKVEAEERAQN
Sbjct: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQN 517

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/512 (76%), Positives = 440/512 (85%), Gaps = 18/512 (3%)

Query: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HPQ VPKEEE ILNYLL+VRS L+KLKQNRTQYLNSKDVQ TYQ+VLTKVRELD+IRKNS
Sbjct: 10  HPQEVPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVRELDEIRKNS 69

Query: 69  HETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128
           H+TP+KSA TLIH+ ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV+SLLE
Sbjct: 70  HDTPSKSATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLE 129

Query: 129 HLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDR---LREIDNERKKNKI 185
           HL+ESN+FTHHDLSPIK+RL+EISKIVE K+     +E  NDD    L++ID ER KNKI
Sbjct: 130 HLSESNIFTHHDLSPIKDRLNEISKIVE-KSCGKLPDEQLNDDEEQNLKDIDTERNKNKI 188

Query: 186 EEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXXXXXXX 245
           E+DLLLRAKL+HC DEY  +ESKLEEIDPSL+S MEKLF+IRRGLLSL            
Sbjct: 189 EQDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLLSLAASTKKNM---- 244

Query: 246 XNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGKFKSLE 305
            N  SL  E+          +++KHLVSQEYV++KL  L+ E+  LE+NRD+SGKFKSLE
Sbjct: 245 -NQGSLTSEKE---------LENKHLVSQEYVNKKLHALEAEVQALEANRDESGKFKSLE 294

Query: 306 THQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLENLMIT 365
           T++VA NGQ+VLNGLLDDC DLINDLSHQTNG L+LDP LQPIYE LIDIKTTLENLMIT
Sbjct: 295 TNEVAENGQNVLNGLLDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTTLENLMIT 354

Query: 366 RRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESS 425
           RRWTLRETDLF+YQK+L EIDN R+ G+FPTK  DSKGQ ILLYLLRRCYAIIYKLLESS
Sbjct: 355 RRWTLRETDLFTYQKQLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAIIYKLLESS 414

Query: 426 EPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDG 485
           EPVSE+LQPIHNQLSTVRRCL+ELKRMGGV+N+RELYPYQMKLASLDNLR DG FYDS+G
Sbjct: 415 EPVSESLQPIHNQLSTVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDGKFYDSEG 474

Query: 486 NIPEGQGILNALLAECFDILHELKVEAEERAQ 517
           NIPEGQG LNALLA CFDI+HELKVEAEER +
Sbjct: 475 NIPEGQGTLNALLAACFDIMHELKVEAEEREE 506

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/509 (73%), Positives = 427/509 (83%), Gaps = 22/509 (4%)

Query: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HPQ+VPKEEE IL YLL+VR+ L  LK+NRTQYLNS+ VQ TYQ VLTKVRELD+IRKN+
Sbjct: 14  HPQLVPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVLTKVRELDEIRKNN 73

Query: 69  HETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128
           H TP+ SA TLIH+ ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV+SLLE
Sbjct: 74  HATPSNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLE 133

Query: 129 HLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDR----LREIDNERKKNK 184
           HLNESN+FTHHDL PIKERLD+ISKIVE+  S     ++  DD+    L E + E+ +NK
Sbjct: 134 HLNESNIFTHHDLGPIKERLDQISKIVEESCSQEIKLDNEGDDQFNQYLDETELEQNQNK 193

Query: 185 IEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXXXXXX 244
           IE+DLLLRAKL+HC DEY  +ESKLEEIDPSL+S++EKLF+IRRGLLSLV          
Sbjct: 194 IEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLFQIRRGLLSLVASAKK----- 248

Query: 245 XXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGKFKSL 304
               NSLL ++          +D+KHL+S EY+++KL  L+ E  +LESNRD+ GKFKSL
Sbjct: 249 ----NSLLSQKE---------LDEKHLISPEYLNKKLLELEKEFKDLESNRDEFGKFKSL 295

Query: 305 ETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLENLMI 364
           ET ++  NGQ+VL GL DDC+DLINDLSHQTNG L+LDP LQP+YEQLI+IKTTLE LMI
Sbjct: 296 ETGEIPENGQNVLKGLEDDCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTTLEKLMI 355

Query: 365 TRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLES 424
           TRRWTLRETDLF+YQKKL EIDN R+ GKFP+KS DSKGQ I+LYLLRRCYAIIYKLLE 
Sbjct: 356 TRRWTLRETDLFTYQKKLGEIDNLRVKGKFPSKSSDSKGQFIILYLLRRCYAIIYKLLEC 415

Query: 425 SEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSD 484
           SEPVSE+LQPIHNQLSTVRRCLL++KR+GGV+NERELYPYQMKLASLDNLR DGIFYDSD
Sbjct: 416 SEPVSESLQPIHNQLSTVRRCLLDIKRLGGVSNERELYPYQMKLASLDNLRKDGIFYDSD 475

Query: 485 GNIPEGQGILNALLAECFDILHELKVEAE 513
           GNIPEGQG LNALLA CFDI+HE+KVEAE
Sbjct: 476 GNIPEGQGTLNALLAACFDIVHEMKVEAE 504

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/522 (72%), Positives = 432/522 (82%), Gaps = 30/522 (5%)

Query: 3   ASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 62
           A++  QHPQ VPKEEESILNYLL VR+ L +LKQNR QYLNSK+VQ  YQ VLTKVRELD
Sbjct: 8   AASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELD 67

Query: 63  DIRKNSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 122
            IRK++H+TP+ SA TLIH+TELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST
Sbjct: 68  QIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 127

Query: 123 VESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQ---KNSSSTYNEDGNDDRLREIDN- 178
           V+ LLEHLNESNVFT HDL PI+ERL EISKIVE    KN  S  N +  D++L E D  
Sbjct: 128 VQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPEADRK 187

Query: 179 ---ERKKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVX 235
              ER KNKIEEDLLLRAKL+HC DEY + ESK+EEIDP L+++MEKLF IRRGLLSL  
Sbjct: 188 FYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSLAA 247

Query: 236 XXXXXXXXXXXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNR 295
                                 S+ +N  L  +K  +SQE+VHE++  L+ +L ELES+R
Sbjct: 248 S---------------------SKRSNPSL--EKSPLSQEHVHEQVEKLESQLTELESHR 284

Query: 296 DDSGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDI 355
           D++GKFKSLET +V   GQ+VLNGLLDDCHDLI+DLSHQ NGG+ LD  LQPIYEQLIDI
Sbjct: 285 DENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDI 344

Query: 356 KTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCY 415
           KT+LENL++TRRWTLRETDLF++QK+L+EID+ R++GKFPT S  SKGQSILLYLLRRC+
Sbjct: 345 KTSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCF 404

Query: 416 AIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR 475
           AIIYKLLESSEPVSE+LQPIHNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLD+LR
Sbjct: 405 AIIYKLLESSEPVSESLQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLR 464

Query: 476 TDGIFYDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQ 517
           TDG FYDSDGNIPEGQG LNALLAECFDI+HELK+EA+ERA+
Sbjct: 465 TDGKFYDSDGNIPEGQGTLNALLAECFDIVHELKIEAQERAE 506

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/511 (72%), Positives = 418/511 (81%), Gaps = 18/511 (3%)

Query: 2   FASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVREL 61
            + +G  HPQ VPKEEE ILNYLLEVRS L+KLK+NRTQYLNSKDV  TYQ VLT+VREL
Sbjct: 6   MSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVREL 65

Query: 62  DDIRKNSHETPAK--SAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 119
           D IRK+S +   +   A TLIH+T++HNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS
Sbjct: 66  DGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 125

Query: 120 LSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNE 179
           LSTV+ LLEHL ESNVFTHHDL PIKERLDEISKIVE+   S   +E       +EID E
Sbjct: 126 LSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVA---EFKEIDTE 182

Query: 180 RKKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXX 239
           R KN+IE+DLLL+AKL+HC DEY+ LESKLEEI P LS +ME+LF++RRGLLSL      
Sbjct: 183 RNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKK 242

Query: 240 XXXXXXXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSG 299
                  NI       +++      L D KH++SQEY+   L   K E+ ++E+ RD++G
Sbjct: 243 -------NI------PDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENG 289

Query: 300 KFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTL 359
           +F S  T +    GQ++LNGLLDDC+DLINDLSHQTNGGL+LDPYLQPIYE+LIDIKTTL
Sbjct: 290 QFVSKSTGKAEQRGQNILNGLLDDCNDLINDLSHQTNGGLTLDPYLQPIYEKLIDIKTTL 349

Query: 360 ENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIY 419
           ENLMITRRWTLRETDLF+YQK+L EIDN R++GKFPTKS DSKGQSI+LYLLRRCYAIIY
Sbjct: 350 ENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIY 409

Query: 420 KLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGI 479
           KLLESSEPVSE+LQP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR DG 
Sbjct: 410 KLLESSEPVSESLQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGK 469

Query: 480 FYDSDGNIPEGQGILNALLAECFDILHELKV 510
           FYDSDGNIPEGQGILNALLA CFDILHELKV
Sbjct: 470 FYDSDGNIPEGQGILNALLAGCFDILHELKV 500

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/517 (72%), Positives = 416/517 (80%), Gaps = 34/517 (6%)

Query: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HPQ VPKEEE ILNY L+VRS L+KLKQNR+Q+LNSKDV  TYQ VLTKVRELDD RK+S
Sbjct: 5   HPQEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDDTRKSS 64

Query: 69  HETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128
           H TPA SA TLIH+ +LHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ LLE
Sbjct: 65  HNTPASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 124

Query: 129 HLNESNVFTHHDLSPIKERLDEISKIVEQ------------KNSSSTYNEDGNDDRLREI 176
           HLNESNVFTHHDL PIKERLDE+S+IVE+            K       ED  D  L++ 
Sbjct: 125 HLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQEPEAQEDEQDIELKKA 184

Query: 177 DNERKKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXX 236
           D E+ KNK+EEDLLLRAKLKHC  EY  +ESKLEEIDP+L S+MEKLF+IRRGLLSL   
Sbjct: 185 DIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLLSLAAS 244

Query: 237 XXXXXXXXXXNINSLLREQNDSQANNNGLMDDK---HLVSQEYVHEKLSVLKDELNELES 293
                                  A +   ++DK   H VS  +V+ KL+ L+ EL+ELES
Sbjct: 245 TKR-------------------NARSKESLEDKKRTHTVSPNFVNSKLNELQVELSELES 285

Query: 294 NRDDSGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLI 353
           +RD SGKFKSLET +V   GQSVLNGLLDDCHDLINDLSHQT+ G+SLD  LQPIY+ LI
Sbjct: 286 HRDPSGKFKSLETDKVEERGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIYDNLI 345

Query: 354 DIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRR 413
           DIKTTLENL++TRRWTLRETDLF+YQK+L EIDN R++GKFPT+S DSKGQSILLYLLRR
Sbjct: 346 DIKTTLENLLVTRRWTLRETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLYLLRR 405

Query: 414 CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN 473
           CYAIIYKLLESSEPVSEALQ IHNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLDN
Sbjct: 406 CYAIIYKLLESSEPVSEALQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDN 465

Query: 474 LRTDGIFYDSDGNIPEGQGILNALLAECFDILHELKV 510
           +R DG FYD+DGNIPEGQG LNALLAECFDILHELK+
Sbjct: 466 MRVDGKFYDADGNIPEGQGTLNALLAECFDILHELKI 502

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/525 (69%), Positives = 433/525 (82%), Gaps = 30/525 (5%)

Query: 8   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67
           Q  Q VPKEEE ILNY L+VR++L++LK+NRTQYLNS +VQ TYQ VLTKVRELD IRK 
Sbjct: 10  QPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKK 69

Query: 68  SHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 127
           +H+  A +  TLIHN +LHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL
Sbjct: 70  NHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 129

Query: 128 EHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDG--NDDR--LREIDNERKKN 183
           +HL E+ ++THHDL PIK+RL+EISKIVE+  + +   +D   ND+   +++ID ER +N
Sbjct: 130 QHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDIDAERTRN 189

Query: 184 KIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXXXXX 243
           K+E++LLL+AKLKHC D Y+ +ESKLE+IDP+L+SVMEKLF+IRRGLLSLV         
Sbjct: 190 KLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSR----- 244

Query: 244 XXXNINSLLREQN-------DSQAN-NNGLMDD------KHLVSQEYVHEKLSVLKDELN 289
              N++S + E++        SQ+N  N L ++      K+ +S + V EK  VL+++L 
Sbjct: 245 ---NMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLK 301

Query: 290 ELESNRDDSGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGG----LSLDPYL 345
            LE++RD+ GKFKSLET +VA NGQ VLNGLLDDC+DL++DLSHQ   G    LS+DP L
Sbjct: 302 NLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSL 361

Query: 346 QPIYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQS 405
           QP+YE+L++IKTTLENLMITRRWTLRETDLFSYQKKLNEIDN R+NG+FPT++ DS+GQS
Sbjct: 362 QPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQS 421

Query: 406 ILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQ 465
           ILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQ
Sbjct: 422 ILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQ 481

Query: 466 MKLASLDNLRTDGIFYDSDGNIPEGQGILNALLAECFDILHELKV 510
           MKLASLDNLR DGIFYDSDGNIPEGQGILNALLA CFDI+HELKV
Sbjct: 482 MKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/509 (70%), Positives = 414/509 (81%), Gaps = 14/509 (2%)

Query: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HP  VP EEE IL Y L+VRS L+K+KQNR+Q+LNSKDV  TYQ VLTKVRELD++RKNS
Sbjct: 6   HPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNS 65

Query: 69  HETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128
           H TP+ SA TLIH++ELHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTV+SLLE
Sbjct: 66  HATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLE 125

Query: 129 HLNESNVFTHHDLSPIKERLDEISKIVEQK---NSSSTYNEDGNDDRLREI----DNERK 181
           HLNESNV+THHDL PIKERL+E+S IVEQ    ++S T + + + D + E     D E  
Sbjct: 126 HLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDEELN 185

Query: 182 KNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXXX 241
           KNKIEEDLLLRAKLKHC DEY+ +ESKLEEI P L S ME LF+IRRGLLSL        
Sbjct: 186 KNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKRPH 245

Query: 242 XXXXXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGKF 301
                   ++L  ++++    N L D       + + EKL  L+++L +LES+RD +GKF
Sbjct: 246 QKQLVPDPAVLSVESEASEKKNVLPD-------QVIDEKLKQLQEQLEKLESHRDINGKF 298

Query: 302 KSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLEN 361
           KSLET +V   GQ+VLNGLLDDCHDL+NDLSHQ +GG+SLD  LQPIY+QL+DIKTTLEN
Sbjct: 299 KSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLEN 358

Query: 362 LMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKL 421
           L++TRRWTLRETDLF+YQKKL EIDN R+NGKFPT   DSKGQSILLYLLRRCYAIIYKL
Sbjct: 359 LLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKL 418

Query: 422 LESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFY 481
           LESSEPVSE+LQ +HNQLSTVRRCLLELKRMGGV+N+RELYPYQMKLASLDN+R DG FY
Sbjct: 419 LESSEPVSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFY 478

Query: 482 DSDGNIPEGQGILNALLAECFDILHELKV 510
           D+DGNIPEGQG LNALLAECFDI+HELK+
Sbjct: 479 DTDGNIPEGQGTLNALLAECFDIIHELKI 507

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/509 (70%), Positives = 410/509 (80%), Gaps = 20/509 (3%)

Query: 8   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67
           +HPQ VP EEES L Y LEVR+ L++LKQNR+QYLNSKDV +TYQ VLTKVRELD IRK+
Sbjct: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62

Query: 68  SHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 127
           SH  PA SA TLIHN ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ LL
Sbjct: 63  SHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122

Query: 128 EHLNESNVFTHHDLSPIKERLDEISKIVEQKNS-SSTYNEDGNDDRLREIDNERKKNKIE 186
           EHL+ESNVFTHHDL PIKERLDEIS+IV Q +    T   DG  D   +I +E+ +NKIE
Sbjct: 123 EHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRID-FAKIQDEKDRNKIE 181

Query: 187 EDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXXXXXXXX 246
           EDLLLRAKL+HC  EY+ +ESKLEEIDP L S MEKLF++RRGLLSL             
Sbjct: 182 EDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKR------- 234

Query: 247 NINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGKFKSLET 306
             N++ ++         G+     L+ QE + ++L  L+ EL E+ES+RD SGKF SLET
Sbjct: 235 --NAMSKQ---------GVKTPDSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLET 283

Query: 307 HQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLENLMITR 366
            ++A  GQ+VLNGLLDDCHDLINDLSH  N  +SLD  LQPIY+ LIDIKTTLENL++TR
Sbjct: 284 GEIAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTR 343

Query: 367 RWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESSE 426
           RWTLRETDLFSYQK+L+EID  R+ GKFPT++ D+KGQ+ILLYLLRRCYAIIYKLLE SE
Sbjct: 344 RWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSE 403

Query: 427 PVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDGN 486
           PVSEALQ IHNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R DG FYD DGN
Sbjct: 404 PVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGN 463

Query: 487 IPEGQGILNALLAECFDILHELKVEAEER 515
           IPEGQG LNALLAECFDILHELK+EAEER
Sbjct: 464 IPEGQGTLNALLAECFDILHELKIEAEER 492

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/521 (66%), Positives = 416/521 (79%), Gaps = 26/521 (4%)

Query: 8   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67
           QHPQ VP+EEE +LNY LE+R+ L++LKQNRT+YL+SK VQ TY+ VLT+VRELDD+RK+
Sbjct: 14  QHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRKS 73

Query: 68  SHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 127
           +HETP+ SA TLIHN ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA Y+SLSTV+ LL
Sbjct: 74  NHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRLL 133

Query: 128 EHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTY----------NEDGNDDRLREID 177
           EHLNESNVFT HDL PIKERL EI KIVE+    +            N    D+  R + 
Sbjct: 134 EHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLKNAPDLDEADRNLS 193

Query: 178 NERKKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXX 237
            E ++NKIEEDLLLRAKL+HC DEY + E+K+E +DPSLS++M+KLF+IRR LLSL    
Sbjct: 194 EETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRELLSLAASA 253

Query: 238 XXXXXXXXXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDD 297
                           ++  S A+    +++KH+++ E V+ ++ +L+ ELNE+ES RD+
Sbjct: 254 ----------------KKTTSSASAEKELENKHVLAPESVNTRVELLQKELNEIESYRDE 297

Query: 298 SGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKT 357
           +GKFKS E+ Q A  GQ+VLNGLL DC+DL+ DLSHQ NGG+ LDP LQPIY +LIDIKT
Sbjct: 298 TGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKT 357

Query: 358 TLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAI 417
           TLENL+ITRRWTLRETDLF+YQK+L EID+ R+N KFPT S D+KGQ+ILLYLLRRCYAI
Sbjct: 358 TLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAI 417

Query: 418 IYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTD 477
           IYKLLESSEPVSE+LQP+HNQLSTVRRCLL L+RMGG+NN RELYPYQMKLASLD LR D
Sbjct: 418 IYKLLESSEPVSESLQPLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVD 477

Query: 478 GIFYDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQN 518
           G FYD DGNIPEGQ  LNALLAECFDI+HE+K+EAEE+ ++
Sbjct: 478 GKFYDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTES 518

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/518 (67%), Positives = 400/518 (77%), Gaps = 35/518 (6%)

Query: 7   QQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRK 66
            +HPQ VP EEE+ L Y LEVR+ L++LKQNR+QYLNSK+V + YQ VLTKVRELD+IRK
Sbjct: 2   HKHPQEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIRK 61

Query: 67  NSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESL 126
            SH  P  SA TLIHN ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ L
Sbjct: 62  RSHSAPRNSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRL 121

Query: 127 LEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDR----LREIDNERKK 182
           LEHL+ESNVFTHHDL PIKERLDEIS+IV Q   SS + E G  +       +I +E+ +
Sbjct: 122 LEHLDESNVFTHHDLRPIKERLDEISEIVTQ---SSFFKEGGEINNGSIDFTKISDEKDR 178

Query: 183 NKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXXXX 242
           NKIEEDLLLRAKLKHC  EY  +ESKLEEIDP L   MEKLF +RRGLLSL         
Sbjct: 179 NKIEEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLA-------- 230

Query: 243 XXXXNINSLLREQNDSQANNNGLMDDKHL-----VSQEYVHEKLSVLKDELNELESNRDD 297
                          +    N ++ D H      +SQE V EKL  L+ +L ++ES R+ 
Sbjct: 231 ---------------ASTKRNAMLKDGHKAPESPLSQESVKEKLHSLEAKLTQIESQRNA 275

Query: 298 SGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKT 357
           SG F S +T ++   GQSVLNGLLDDCHDLINDLSH  N  ++LD  LQPIY+ LI+IKT
Sbjct: 276 SGYFVSADTGEIVERGQSVLNGLLDDCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKT 335

Query: 358 TLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAI 417
           TLENL++TRRWTLRETDLF+YQK+L+EID  R+ GKFPT+S D+KGQ+ILLYLLRRCYAI
Sbjct: 336 TLENLLVTRRWTLRETDLFAYQKRLSEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAI 395

Query: 418 IYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTD 477
           IYKLLE SEPVSEALQ IHNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R D
Sbjct: 396 IYKLLECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVD 455

Query: 478 GIFYDSDGNIPEGQGILNALLAECFDILHELKVEAEER 515
           G FYD DGNIPEGQG LNALLAECFDILHELK+EAE R
Sbjct: 456 GKFYDEDGNIPEGQGTLNALLAECFDILHELKIEAEYR 493

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/517 (65%), Positives = 414/517 (80%), Gaps = 32/517 (6%)

Query: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68
           HPQIVP EEE ILN+LLEVR+ LAKLKQNRTQ+LN+K VQ TYQ VLTKVRELD+IRKNS
Sbjct: 14  HPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNS 73

Query: 69  HETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128
             TPAK+A TLIH+++LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPATY+SLSTV+ LLE
Sbjct: 74  LTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLE 133

Query: 129 HLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLR----------EIDN 178
           HLNES +FT HDL PIKERLDEI +IVE+   SS  N++ ND  L           EI+N
Sbjct: 134 HLNESRMFTMHDLRPIKERLDEIQEIVEK---SSYRNDEFNDSALVGLSKQEHELIEIEN 190

Query: 179 ERKKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXX 238
           ER +N+IEEDLL+RAKL+ C ++++ +ES+LE+I+P+LSS+++KL+ IRRGLLSL     
Sbjct: 191 ERTRNRIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPT- 249

Query: 239 XXXXXXXXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLK--DELNELESNRD 296
                     N  L     S+++NN +    H VS +  H++L +LK   +L E+ES RD
Sbjct: 250 ----------NDTL-----SKSDNNHIASTNHNVSDKS-HKELVLLKMKKQLVEIESQRD 293

Query: 297 DSGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIK 356
           ++G +KSLET++V + GQ ++N L+DDC+DLINDLSH  NG +  DPYLQ IY+ LIDIK
Sbjct: 294 ENGYYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIK 353

Query: 357 TTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYA 416
           T L NLM+TRRWTLRETDLFSYQKKL EID+ R+NGKF + + D+KGQSI+LYLLRRCYA
Sbjct: 354 TNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYA 413

Query: 417 IIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRT 476
           IIYKLLESSEP+SE+LQ IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD LR 
Sbjct: 414 IIYKLLESSEPISESLQSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRI 473

Query: 477 DGIFYDSDGNIPEGQGILNALLAECFDILHELKVEAE 513
           DG FYD++G+IPEGQGILNA+LAECFD++HELK +AE
Sbjct: 474 DGKFYDANGDIPEGQGILNAMLAECFDMVHELKCDAE 510

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 72/144 (50%), Gaps = 16/144 (11%)

Query: 299 GKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTT 358
           GKFKS  +      GQS++  LL  C+ +I  L   +     +   LQ I+ QL    +T
Sbjct: 389 GKFKSATSD---AKGQSIILYLLRRCYAIIYKLLESSE---PISESLQSIHTQL----ST 438

Query: 359 LENLMITRRWTLRETD---LFSYQKKLNEIDNKRINGKFPTKSQD-SKGQSILLYLLRRC 414
           +   ++T +     TD   L+ YQ KL  +D  RI+GKF   + D  +GQ IL  +L  C
Sbjct: 439 VRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPEGQGILNAMLAEC 498

Query: 415 YAIIYKLLESSEPV--SEALQPIH 436
           + ++++L   +E    SE   PI+
Sbjct: 499 FDMVHELKCDAEAYSSSENATPIN 522

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/519 (64%), Positives = 406/519 (78%), Gaps = 22/519 (4%)

Query: 4   SAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDD 63
           S+  Q  Q +PKEEE IL+Y LE+R+ L++LKQNR Q+L SKDV  TYQ VLTKVRELD 
Sbjct: 2   SSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDK 61

Query: 64  IRKNSHETPAK--SAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 121
           IRK +HE+        TLIH+ +LHNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASLS
Sbjct: 62  IRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLS 121

Query: 122 TVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRL--REIDNE 179
           TV+SLL+HLNESNV+TH+DL PIKERLDEIS+IVE KNS      DG D      +++++
Sbjct: 122 TVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVE-KNSYWNIPTDGGDGNAFADDLEDK 180

Query: 180 RKKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXX 239
           RK+N IEE+LLLRAKL++C   Y+ +E+KLE I   L   ME+LF+IRRGLLSL      
Sbjct: 181 RKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKS 240

Query: 240 XXXXXXXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSG 299
                         EQ +   N++ L     ++S E ++E+L  L+ EL ++ S+R++SG
Sbjct: 241 RV------------EQEEQDENDDELC----ILSHEKINERLKALETELADVRSHRNESG 284

Query: 300 KFKSL-ETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTT 358
           KF S+ + + V   GQ VLNGLLDDCHDLI DLSHQT+ GL LDP++QPIY+ L+ IKT 
Sbjct: 285 KFVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTI 344

Query: 359 LENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAII 418
           LENL++TRRWTLRETDLF+YQKKL E+D+ R+NGKFP++S DSKGQ+ILLYLLRRCYAII
Sbjct: 345 LENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAII 404

Query: 419 YKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDG 478
           YKLLESSEPVSE+L+ IHNQLSTVR CLLELKRMGGV+NERELYPYQMKLASLDN+R DG
Sbjct: 405 YKLLESSEPVSESLERIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDG 464

Query: 479 IFYDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQ 517
            FYD DGNIPEGQG LNALLAECFDILHE+K+EAE R +
Sbjct: 465 KFYDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVREE 503

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 78/155 (50%), Gaps = 11/155 (7%)

Query: 281 LSVLKDELNELESNRDDSGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLS 340
           L   + +L EL+S R + GKF S  +      GQ++L  LL  C+ +I  L   +     
Sbjct: 361 LFTYQKKLAELDSLRVN-GKFPSESSDS---KGQAILLYLLRRCYAIIYKLLESSE---P 413

Query: 341 LDPYLQPIYEQLIDIKTTLENLMITRRWTL-RETDLFSYQKKLNEIDNKRINGKFPTKSQ 399
           +   L+ I+ QL  ++  L  L + R   +  E +L+ YQ KL  +DN R++GKF     
Sbjct: 414 VSESLERIHNQLSTVRHCL--LELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDG 471

Query: 400 D-SKGQSILLYLLRRCYAIIYKLLESSEPVSEALQ 433
           +  +GQ  L  LL  C+ I++++   +E   EA Q
Sbjct: 472 NIPEGQGTLNALLAECFDILHEMKIEAEVREEAAQ 506

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/508 (65%), Positives = 397/508 (78%), Gaps = 43/508 (8%)

Query: 11  QIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRK---- 66
           Q VPKEEE  L+YLL+VR +L+ LKQNR+Q+LNSKD+Q TYQ VLTKVRELD+IR+    
Sbjct: 10  QAVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDEIRRQKHG 69

Query: 67  NSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESL 126
           NS ET  K   T +H+ ELHNRVD+VLDDVFQLLSLCF+T GLKNSAPATYASLSTV+SL
Sbjct: 70  NSQETEIK---TFVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLSTVQSL 126

Query: 127 LEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNE----DGNDDRLREIDNERKK 182
           LEHL ES ++THHDL PIKERLDEI+KIV+Q   S+TY +    D +D+ +  IDNER K
Sbjct: 127 LEHLIESKIYTHHDLKPIKERLDEIAKIVDQNCESNTYQDASTLDDDDNEVSRIDNERNK 186

Query: 183 NKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXXXX 242
           NKIE++LLL+AKL HC  EY+ +ES+LEE+DPS +S++EKLF+IRR L+SLV        
Sbjct: 187 NKIEQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLV-------- 238

Query: 243 XXXXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGKFK 302
                         +   +N G+        Q+ + +KL  L+ +LNE+E+NRD  G F 
Sbjct: 239 --------------EISKSNTGV--------QDQIDKKLKHLQLQLNEIENNRDPDGNFV 276

Query: 303 SLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLENL 362
           S+E+    + G +VLNGL DDCHDLI+DL+H T     LDP LQ +Y+ LID+K +LENL
Sbjct: 277 SIESGNPIIKGSNVLNGLSDDCHDLISDLTHHTKT--FLDPDLQNVYDNLIDVKGSLENL 334

Query: 363 MITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLL 422
           M+TRRWTLRETDLFSY KKLNEIDN R++GKFPTKS  +KGQ+ILLYLLRRCY +IYKLL
Sbjct: 335 MVTRRWTLRETDLFSYLKKLNEIDNLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYKLL 394

Query: 423 ESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYD 482
           ESSEPVSEALQPIHNQLSTVRRCLL+LKRMGGVNNERELYPYQMKLASLDNLR DG FYD
Sbjct: 395 ESSEPVSEALQPIHNQLSTVRRCLLDLKRMGGVNNERELYPYQMKLASLDNLRKDGKFYD 454

Query: 483 SDGNIPEGQGILNALLAECFDILHELKV 510
           S GNIPEGQGILNALLA CFDILHELK+
Sbjct: 455 SKGNIPEGQGILNALLAGCFDILHELKI 482

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/498 (66%), Positives = 387/498 (77%), Gaps = 24/498 (4%)

Query: 13  VPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNSHETP 72
           VPKEEESIL YLL+VR+ LAKLK NR+Q+LNSK+VQ  +Q VLTKVRELDDIRK      
Sbjct: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79

Query: 73  AKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLEHLNE 132
           A  + T+IHN  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+SLSTV+ LLEHL+E
Sbjct: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139

Query: 133 SNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNERKKNKIEEDLLLR 192
           SN+FT+HDL PIK+RLDEIS IVE  NS   Y+ D  +    E + +R KNKIEEDLLLR
Sbjct: 140 SNIFTNHDLRPIKDRLDEISTIVEN-NSYRNYDFDLTNPA-DETEEKRNKNKIEEDLLLR 197

Query: 193 AKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXXXXXXXXNINSLL 252
           AKLKHC DEY+ + SKLEEI P LSS+MEKL+ IRR LLSL                   
Sbjct: 198 AKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLLSLASPSRKIDT---------- 247

Query: 253 REQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGKFKSLETHQVAVN 312
             ++ SQ N           S +   E LS L+ EL ELES+RD++G FKSLET +V + 
Sbjct: 248 -REDFSQFN-----------SSKESQEALSSLEQELEELESHRDENGNFKSLETGEVVLK 295

Query: 313 GQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLENLMITRRWTLRE 372
           GQ+VL GL+D+CHDLIND ++  NG   +DP L+PIY++LI+IKT L NLMITRRWTLR+
Sbjct: 296 GQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRD 355

Query: 373 TDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESSEPVSEAL 432
           TDLF YQKKL  IDNKR+NGKFPTKS D+KGQ+ILLYLLRRCYAIIYKLLESS PVSE+L
Sbjct: 356 TDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVPVSESL 415

Query: 433 QPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDGNIPEGQG 492
           Q IHNQLST RRCLL LKRMGGVN+ERELYPYQ+KLASLD LR DG F+D++G IPEGQG
Sbjct: 416 QSIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQG 475

Query: 493 ILNALLAECFDILHELKV 510
            LNALLAECFDI+HEL++
Sbjct: 476 TLNALLAECFDIMHELEI 493

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/513 (62%), Positives = 383/513 (74%), Gaps = 30/513 (5%)

Query: 13  VPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS---- 68
           VP+ E  IL YL++VR  L +LK NR++YLNSK+V+  +Q VLTKVRELDDIRK+     
Sbjct: 17  VPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKVRELDDIRKSKLKDD 76

Query: 69  --HETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESL 126
              ++  +   TL+ N  LHN+VDS++DDVFQLLSLCFLTVGLKNSAPATY SLSTV+ L
Sbjct: 77  GQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNSAPATYTSLSTVQKL 136

Query: 127 LEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDN-ERKKNKI 185
           LEHL+ESN+FT+HDL PIKERLDEISKIV Q NS   Y  + ++    ++D+ E K+N I
Sbjct: 137 LEHLDESNIFTNHDLRPIKERLDEISKIV-QNNSYKNYEFNEDEINPNQVDDDEIKQNLI 195

Query: 186 EEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXXXXXXX 245
           EEDLLLRAKLK C DE+  + SKLEEIDP L+S+MEKL+ IRR LLSL            
Sbjct: 196 EEDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRRNLLSLASPTHKIDTT-- 253

Query: 246 XNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGKFKSLE 305
                    +N S  NNN           E   + L  L DEL ELE++RD+ G FKSLE
Sbjct: 254 ---------ENISIFNNN-----------EESRKMLKHLSDELTELETHRDEDGNFKSLE 293

Query: 306 THQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLENLMIT 365
           T++V + GQ+ L GL+D+CHDLIND ++ +     LD  LQPIY  LI+IKT L NLMIT
Sbjct: 294 TNEVKLKGQNALAGLVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMIT 353

Query: 366 RRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESS 425
           RRWTLRETDLF YQK+L EID++R+NGKFP++S ++KGQSILLYLLRRCYAIIYKLLESS
Sbjct: 354 RRWTLRETDLFQYQKRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESS 413

Query: 426 EPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDG 485
           EPVSE+LQPIHNQLST RRCLL LKRMGGVN+ RELYPYQ+KLASLD LR DG FYDS G
Sbjct: 414 EPVSESLQPIHNQLSTTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSG 473

Query: 486 NIPEGQGILNALLAECFDILHELKVEAEERAQN 518
            IPEGQG LNALLAECFD+LHEL++E+EE   N
Sbjct: 474 EIPEGQGTLNALLAECFDMLHELEIESEESVDN 506

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/469 (62%), Positives = 344/469 (73%), Gaps = 22/469 (4%)

Query: 49  TTYQHVLTKVRELDDIRKNSHETPAKSAA-TLIHNTELHNRVDSVLDDVFQLLSLCFLTV 107
            TYQ VLTKVR LD +RK  H     +   TLIH+  LHNRVDSVLDDVFQLLSL FLTV
Sbjct: 2   ATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTV 61

Query: 108 GLKNSAPATYASLSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNED 167
           GLKN+APATYASLSTV+ LLEH+ E+NV+T+ DL PIKERLDEI +IVE KNS  +  ED
Sbjct: 62  GLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVE-KNSYMSMVED 120

Query: 168 GNDDRLREIDNERKKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIR 227
             +  L E+  E++ NK+EEDLL+RAKL+HC D Y  ++SK   I P L  + +KLF IR
Sbjct: 121 --EAPLDELAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIR 178

Query: 228 RGLLSLVXXXXXXXXXXXXNINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDE 287
           R LLSL                     + D  A            S   +  +L  L+  
Sbjct: 179 RELLSLAASA-----------------KTDRAAGEGSTERSTTPASPNTLASRLKDLESM 221

Query: 288 LNELESNRDDSGKFKSLE-THQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQ 346
           + E+ES+RDDSGKF S +    V   GQS LNGLLDDC +L  DLSHQT+G L LDP LQ
Sbjct: 222 ILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQ 281

Query: 347 PIYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSI 406
           PIYE+L++IKTTLENL++TRRWTLRETDLF+YQK+L E+DN R+N K P+ S  SKGQ++
Sbjct: 282 PIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQAL 341

Query: 407 LLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQM 466
           +LYLLRRCYA IYKLLESSEPVSE+LQ IHNQLSTVRRCL ELKRMGGV++ER+LYPYQM
Sbjct: 342 ILYLLRRCYATIYKLLESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQM 401

Query: 467 KLASLDNLRTDGIFYDSDGNIPEGQGILNALLAECFDILHELKVEAEER 515
           KLASLDN+R DG FYD+DGNIPEGQG LNALLAECFDILHE+K+EAE R
Sbjct: 402 KLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVR 450

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  181 bits (459), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 137/441 (31%), Positives = 229/441 (51%), Gaps = 65/441 (14%)

Query: 115 ATYASLSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNS-------------- 160
           + Y+S+  ++ LL  LN+SN+FT +DLSP+K RLDEI  I+E   S              
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECEENDNEDNE 132

Query: 161 --------SSTYNEDGNDD---------------RLREIDNERKKNKIEEDLLLRAKLKH 197
                       NE G +                +L++ D+   K  I ++L        
Sbjct: 133 DNEDNDENIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQEL------DD 186

Query: 198 CKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVXXXXXXXXXXXXNINSLLREQND 257
           C   ++ +E K + ID +LSS+++K+  +R+ LL +V                +L++ N 
Sbjct: 187 CYKVHNVIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFSRVKSVFPQCF----VLKDPNH 242

Query: 258 SQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGKFKSLETHQVAVNGQSVL 317
               +N   D K       +   L V+K++  E +  +    K      ++  +NGQ +L
Sbjct: 243 M---SNSTFDKK----LNEIQRNLDVIKEKNTEYDEGQSQRNK------NEGNINGQRIL 289

Query: 318 NGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLENLMITRRWTLRETDLFS 377
           NGL+D C ++I+D+       +  D     ++E+ + +K  LE +++T R +L+  DLF+
Sbjct: 290 NGLVDYCQEVIHDVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFN 348

Query: 378 YQKKLNEIDNKRINGKFPTKSQDS-KGQSILLYLLRRCYAIIYKLLESSEPVSEALQPIH 436
             K+L++++ + I        +DS + +SI+++ LRRC+ IIYK+LESSEPV   L+P++
Sbjct: 349 LHKELSKLEKRTIRH---YNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLY 405

Query: 437 NQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDGNIPEGQGILNA 496
           NQLST+ R LL+LK  GGV    +L P ++KL ++ + R +  F D  GNIP GQ  LNA
Sbjct: 406 NQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNA 465

Query: 497 LLAECFDILHELKVEAEERAQ 517
           LL EC ++L  L+++ E R +
Sbjct: 466 LLHECMELLKILEIDFEGRTR 486

>Ecym_3382 Chr3 (724394..726190) [1797 bp, 598 aa] {ON} similar to
           Ashbya gossypii AFL200W
          Length = 598

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 259 QANNNGLMDDKHLVSQEYVHE--KLSVLKDELNELESNRDDSGKFKSLETHQVAVNGQSV 316
           ++N N L    HL+ QEY H   K++++K++LN  +   D   + + LE   V +N ++ 
Sbjct: 52  KSNTNELDASYHLLWQEYEHWIVKVAIMKNKLNNTDVVYDMKAEIEELEFWMVYLNAEAS 111

Query: 317 LNGLLDDCHDLINDLSHQTNGGLSL 341
              L         D S +  GGL  
Sbjct: 112 FKLL---------DYSMEKLGGLCF 127

>YLR457C Chr12 complement(1055812..1056771) [960 bp, 319 aa] {ON}
           NBP1Spindle pole body (SPB) component, required for the
           insertion of the duplication plaque into the nuclear
           membrane during SPB duplication; essential for bipolar
           spindle formation; component of the Mps2p-Bbp1p complex
          Length = 319

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 20/94 (21%)

Query: 415 YAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNL 474
           Y I+  LL+SS         IH   +  RR +  L R        E+ P ++ L+     
Sbjct: 210 YRILEDLLDSSN--------IHPSYTKSRRTMSNLAREND-----EIKPLKIDLSPSPIR 256

Query: 475 RTDGIF-------YDSDGNIPEGQGILNALLAEC 501
           RT+ +F       Y+ DGNIPE Q +   +   C
Sbjct: 257 RTNSLFTSSPMKTYNRDGNIPEMQPLQENISPAC 290

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 100 LSLCFLTVGLKNS------APATYASLSTVESLLEHLNESNVFTHHD 140
           +S+C +T+ + N       AP TY  L ++  L+ HL  S  F H D
Sbjct: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 53/121 (43%), Gaps = 28/121 (23%)

Query: 269 KHLVSQEYVH--------------EKLSVLKDELNELESNRDDSGKFKSLETHQVAVNGQ 314
           KHL    Y H              E +SVL+  + EL+S  D++ +F ++E  Q    GQ
Sbjct: 81  KHLSEMTYPHNLVDLSFLVSDSKDETMSVLRQHVRELQSQPDNARQFGNIEIFQKDF-GQ 139

Query: 315 SVLNGLLDDCHDLIND------LSHQTN--GGLSLDPYLQPIYEQLIDIKTT----LENL 362
           ++      D H           ++   N  G ++L PY   +Y + +D++T     +E+L
Sbjct: 140 AIGQS-FSDRHGFAAQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDVETVPQTIIEDL 198

Query: 363 M 363
           M
Sbjct: 199 M 199

>KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} similar
           to uniprot|P32767 Saccharomyces cerevisiae YGL016W
           KAP122 Karyopherin beta responsible for import of the
           Toa1p-Toa2p complex into the nucleus binds to
           nucleoporins Nup1p and Nup2p may play a role in
           regulation of pleiotropic drug resistance
          Length = 1059

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 100 LSLCFLTVGL------KNSAPATYASLSTVESLLEHLNESNVFTHH-DLSPIKERL 148
           LSL FLT+         N  PA    ++T   LL+H NESN+F    D S I ERL
Sbjct: 116 LSLIFLTINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLFEWRTDNSEIAERL 171

>TPHA0A04960 Chr1 (1115122..1121355) [6234 bp, 2077 aa] {ON} Anc_5.113
            YGR217W
          Length = 2077

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 52/114 (45%), Gaps = 18/114 (15%)

Query: 274  QEYVHEKLSVLKDELNELESNRDDSGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSH 333
            QEY H  L  L+     L    DD    + ++  Q  + G +++N + +D  +L++D++H
Sbjct: 1039 QEYRHATL--LRRIQRRLFKKEDD----RPVDFKQFLIRGTAIMN-IANDMENLMDDINH 1091

Query: 334  QTNGGLSLDPYLQPIYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDN 387
                GL+L            D K  + NL   + +    T+ F ++ K+  I++
Sbjct: 1092 NIEEGLNLT-----------DFKNWVLNLSFFKHFPFFTTNPFYFESKVKYIES 1134

>TPHA0F02620 Chr6 complement(577529..580285) [2757 bp, 918 aa] {ON}
           Anc_6.70 YLR273C
          Length = 918

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 48/101 (47%), Gaps = 12/101 (11%)

Query: 288 LNELESNRDDSGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQP 347
           L + E N D+  KF   E +  +  G S L+ L+++ +    DL  ++N   +  P  +P
Sbjct: 172 LRQFEINNDNDSKFPFFENNDDSDEGDSELDHLINNSYLFSKDLFFKSNKNYTFSP--KP 229

Query: 348 IYEQ---------LIDIKTTLENLMITRRWTLRETDLFSYQ 379
           + +           ID  T+L   + T+ W L ++++ S++
Sbjct: 230 MNQNQNIDDAINDFIDC-TSLHRAVTTKNWKLLKSNVSSFE 269

>KLLA0E23849g Chr5 (2119396..2120718) [1323 bp, 440 aa] {ON} similar
           to uniprot|Q02825 Saccharomyces cerevisiae YPL083C SEN54
           Subunit of the tRNA splicing endonuclease which is
           composed of Sen2p Sen15p Sen34p and Sen54p
          Length = 440

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 54/113 (47%), Gaps = 17/113 (15%)

Query: 110 KNSAPATYASLSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGN 169
           KNS  A + +L   + + + L+       H   P    +D    I E+K + S  N+ GN
Sbjct: 313 KNSKKAEFPNLKDFKGIFQRLD-------HKF-PFINDVD----IAEEKVTKS--NKTGN 358

Query: 170 DDRLREIDNERKKNKIEEDLLLRA-KLKHCKDEYDTLESKLEEIDPSLSSVME 221
            D  R + + RK NK ++ L L A K+K  K+ Y +    L  +D  L S+++
Sbjct: 359 VDAQRHLKSRRKNNKGDKTLSLYARKMKRIKEGYRSFL--LAVMDGGLVSIVK 409

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,004,660
Number of extensions: 2700862
Number of successful extensions: 13406
Number of sequences better than 10.0: 397
Number of HSP's gapped: 13885
Number of HSP's successfully gapped: 495
Length of query: 548
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 433
Effective length of database: 40,294,809
Effective search space: 17447652297
Effective search space used: 17447652297
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)