Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.464singletonON74742632e-31
Smik_11.122singletonON90901922e-20
Smik_4.615singletonON92921871e-19
Smik_1.61singletonON94941819e-19
Smik_11.26singletonON94921775e-18
Smik_6.174singletonON42331659e-17
Smik_15.45singletonON42331641e-16
Smik_16.367singletonON35331631e-16
Smik_6.198singletonON35331631e-16
Smik_10.209singletonON57331614e-16
Smik_5.356singletonON44331604e-16
Smik_15.264singletonON57331599e-16
Smik_6.173singletonON49331589e-16
Smik_4.342singletonON49331562e-15
Smik_11.83singletonON40331543e-15
Smik_10.262singletonON41331441e-13
Smik_12.31singletonON48331432e-13
Smik_12.177singletonON44331389e-13
Smik_16.392singletonON69331364e-12
Smik_13.227singletonON94301245e-10
Smik_5.2singletonON84331226e-10
Smik_4.527singletonON120931212e-09
Smik_27.5singletonON48331153e-09
Smik_3.161singletonON56331145e-09
Smik_13.310singletonON56331121e-08
Smik_8.57singletonON33231101e-08
Smik_8.76singletonON23231092e-08
Smik_8.205singletonON23231092e-08
Smik_6.90singletonOFF87871122e-08
Smik_16.117singletonON57251094e-08
Smik_6.243singletonON48331067e-08
Smik_8.147singletonON33231041e-07
Smik_15.49singletonON56231033e-07
Smik_3.62singletonON23231013e-07
Smik_10.199singletonON29231004e-07
Smik_3.63singletonON23231005e-07
YOL106WsingletonOFF117941047e-07
Smik_3.56singletonON3023988e-07
Smik_6.121singletonON3623999e-07
Smik_10.207singletonON2121981e-06
Smik_7.231singletonON2323971e-06
Smik_16.122singletonON4223981e-06
Smik_5.361singletonON94921011e-06
Smik_7.261singletonON2323935e-06
Smik_14.285singletonON2622936e-06
Smik_6.120singletonON3623937e-06
Smik_11.2singletonON3623937e-06
Smik_4.571singletonON3623937e-06
Smik_4.416singletonON3623937e-06
Smik_6.119singletonON3623937e-06
Suva_5.55singletonON4338937e-06
Smik_12.329singletonON2323901e-05
Smik_4.820singletonON5823894e-05
Smik_6.95singletonON6523895e-05
Smik_12.318singletonON4319876e-05
Smik_10.318singletonON5723876e-05
Smik_7.340singletonON3733868e-05
Smik_4.210singletonON4923868e-05
Smik_7.112singletonON5823861e-04
Smik_2.19singletonON2818841e-04
Smik_3.128singletonON7423852e-04
Smik_4.693singletonON3423823e-04
Smik_1.87singletonON5422833e-04
Smik_12.520singletonON5919833e-04
YER181CsingletonOFF10793853e-04
Smik_16.239singletonON5423825e-04
Smik_5.355singletonON4323815e-04
Smik_7.177singletonON6119808e-04
Smik_12.412singletonON2323789e-04
Smik_7.67singletonON6123790.001
Smik_13.71singletonON2521770.001
Smik_15.189singletonON2816770.001
Smik_11.174singletonON1717770.001
Smik_6.244singletonON4223770.002
Smik_13.365singletonON3519760.002
YDR366CsingletonOFF13223810.002
Smik_10.261singletonON3823760.002
Smik_3.92singletonON4421750.003
Smik_7.186singletonON7723770.003
Smik_7.154singletonON6725760.004
Smik_12.351singletonON7773750.008
Smik_12.563singletonON6020730.012
YCR018C-AsingletonOFF8421730.014
Smik_4.329singletonON3820710.015
Smik_11.265singletonON7019710.026
Smik_11.177singletonON1414680.028
Smik_11.219singletonON5519690.039
Smik_6.238singletonON2623670.039
Smik_16.393singletonON2315670.043
Smik_6.209singletonON3333660.072
Smik_7.330singletonON2816640.13
Smik_7.328singletonON1616630.16
Smik_9.162singletonON7474650.24
Smik_12.380singletonON5923630.33
Smik_12.508singletonOFF8123630.46
Skud_5.65singletonON1817590.59
Smik_3.109singletonON2813590.66
Smik_10.234singletonON4921600.66
Smik_3.198singletonON2623590.78
Smik_5.97singletonON9223610.86
Smik_15.529singletonON5417591.1
Smik_27.3singletonON5723591.3
Skud_10.212singletonON3517571.5
Smik_15.181singletonON4921562.6
Smik_3.89singletonON5319562.9
Smik_12.178singletonON6122563.1
Skud_5.1singletonON2726543.4
Suva_8.231singletonON1212535.1
Smik_15.237singletonON1414526.9
Smik_7.66singletonON1414526.9
Smik_8.38singletonON2117519.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.464
         (74 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.464 Chr6 (767126..767194,767198..767203,767207..767353) [...   105   2e-31
Smik_11.122 Chr11 complement(206340..206501,206505..206543,20654...    79   2e-20
Smik_4.615 Chr4 (1101523..1101591,1101595..1101633,1101637..1101...    77   1e-19
Smik_1.61 Chr1 (121688..121969) [282 bp, 94 aa] {ON} YOL106W (RE...    74   9e-19
Smik_11.26 Chr11 (58522..58596,58600..58638,58642..58809) [282 b...    73   5e-18
Smik_6.174 Chr6 (284801..284926) [126 bp, 42 aa] {ON} YER181C (R...    68   9e-17
Smik_15.45 Chr15 (79159..79284) [126 bp, 42 aa] {ON} YER181C (RE...    68   1e-16
Smik_16.367 Chr16 complement(654240..654344) [105 bp, 35 aa] {ON...    67   1e-16
Smik_6.198 Chr6 complement(329356..329460) [105 bp, 35 aa] {ON} ...    67   1e-16
Smik_10.209 Chr10 (348928..348960,348964..349101) [171 bp, 57 aa...    67   4e-16
Smik_5.356 Chr5 (551353..551484) [132 bp, 44 aa] {ON}  YER181C (...    66   4e-16
Smik_15.264 Chr15 complement(447824..447961,447965..447997) [171...    66   9e-16
Smik_6.173 Chr6 (284583..284591,284595..284732) [147 bp, 49 aa] ...    65   9e-16
Smik_4.342 Chr4 (612069..612077,612081..612218) [147 bp, 49 aa] ...    65   2e-15
Smik_11.83 Chr11 complement(148492..148611) [120 bp, 40 aa] {ON}...    64   3e-15
Smik_10.262 Chr10 (411983..412105) [123 bp, 41 aa] {ON} YER181C ...    60   1e-13
Smik_12.31 Chr12 complement(76648..76791) [144 bp, 48 aa] {ON}  ...    60   2e-13
Smik_12.177 Chr12 complement(355126..355161,355165..355260) [132...    58   9e-13
Smik_16.392 Chr16 complement(691144..691311,691315..691353) [207...    57   4e-12
Smik_13.227 Chr13 complement(361490..361576,361580..361657,36166...    52   5e-10
Smik_5.2 Chr5 (796..1047) [252 bp, 84 aa] {ON} YER181C (REPEAT)        52   6e-10
Smik_4.527 Chr4 complement(950709..951071) [363 bp, 120 aa] {ON}...    51   2e-09
Smik_27.5 Chr27 complement(1992..2045,2049..2129,2133..2141) [14...    49   3e-09
Smik_3.161 Chr3 complement(226612..226665,226669..226749,226753....    49   5e-09
Smik_13.310 Chr13 complement(487114..487167,487171..487251,48725...    48   1e-08
Smik_8.57 Chr8 (95346..95372,95379..95450) [99 bp, 33 aa] {ON}  ...    47   1e-08
Smik_8.76 Chr8 (113465..113533) [69 bp, 23 aa] {ON}  YOL106W (RE...    47   2e-08
Smik_8.205 Chr8 complement(335066..335134) [69 bp, 23 aa] {ON}  ...    47   2e-08
Smik_6.90 Chr6 (165837..165908,165912..165917,165921..165935,165...    48   2e-08
Smik_16.117 Chr16 complement(216838..216900,216904..216981,21698...    47   4e-08
Smik_6.243 Chr6 complement(397041..397109,397113..397127,397131....    45   7e-08
Smik_8.147 Chr8 complement(214508..214585,214589..214609) [99 bp...    45   1e-07
Smik_15.49 Chr15 (82181..82348) [168 bp, 56 aa] {ON} YOL106W (RE...    44   3e-07
Smik_3.62 Chr3 complement(88736..88804) [69 bp, 23 aa] {ON}  YOL...    44   3e-07
Smik_10.199 Chr10 (346712..346798) [87 bp, 29 aa] {ON}  YDR366C ...    43   4e-07
Smik_3.63 Chr3 (88885..88953) [69 bp, 23 aa] {ON}  YOL106W (REPEAT)    43   5e-07
YOL106W Chr15 (113226..113579) [354 bp, 117 aa] {OFF} Dubious op...    45   7e-07
Smik_3.56 Chr3 (83840..83929) [90 bp, 30 aa] {ON}  YDR366C (REPEAT)    42   8e-07
Smik_6.121 Chr6 complement(198363..198470) [108 bp, 36 aa] {ON} ...    43   9e-07
Smik_10.207 Chr10 (348819..348881) [63 bp, 21 aa] {ON}  YOL106W ...    42   1e-06
Smik_7.231 Chr7 complement(396783..396851) [69 bp, 23 aa] {ON}  ...    42   1e-06
Smik_16.122 Chr16 complement(220698..220823) [126 bp, 42 aa] {ON...    42   1e-06
Smik_5.361 Chr5 complement(559269..559463,559467..559553) [282 b...    44   1e-06
Smik_7.261 Chr7 complement(432507..432575) [69 bp, 23 aa] {ON}  ...    40   5e-06
Smik_14.285 Chr14 (520719..520796) [78 bp, 26 aa] {ON}  YOL106W ...    40   6e-06
Smik_6.120 Chr6 complement(198065..198172) [108 bp, 36 aa] {ON} ...    40   7e-06
Smik_11.2 Chr11 (1296..1403) [108 bp, 36 aa] {ON}  YOL106W (REPEAT)    40   7e-06
Smik_4.571 Chr4 complement(1027481..1027588) [108 bp, 36 aa] {ON...    40   7e-06
Smik_4.416 Chr4 (761141..761248) [108 bp, 36 aa] {ON}  YOL106W (...    40   7e-06
Smik_6.119 Chr6 complement(197767..197874) [108 bp, 36 aa] {ON} ...    40   7e-06
Suva_5.55 Chr5 (97165..97296) [132 bp, 43 aa] {ON}  (REPEAT)           40   7e-06
Smik_12.329 Chr12 (595891..595959) [69 bp, 23 aa] {ON}  YOL106W ...    39   1e-05
Smik_4.820 Chr4 complement(1437887..1437952,1437956..1437994,143...    39   4e-05
Smik_6.95 Chr6 complement(171372..171566) [195 bp, 65 aa] {ON} Y...    39   5e-05
Smik_12.318 Chr12 (572854..572886,572890..572985) [129 bp, 43 aa...    38   6e-05
Smik_10.318 Chr10 complement(503529..503594,503601..503636,50364...    38   6e-05
Smik_7.340 Chr7 (568129..568239) [111 bp, 37 aa] {ON} YER181C (R...    38   8e-05
Smik_4.210 Chr4 (390131..390244,390248..390280) [147 bp, 49 aa] ...    38   8e-05
Smik_7.112 Chr7 (198899..198967,198971..199009,199013..199078) [...    38   1e-04
Smik_2.19 Chr2 complement(29356..29439) [84 bp, 28 aa] {ON}  YOL...    37   1e-04
Smik_3.128 Chr3 (167733..167738,167742..167852,167856..167894,16...    37   2e-04
Smik_4.693 Chr4 complement(1226937..1227038) [102 bp, 34 aa] {ON...    36   3e-04
Smik_1.87 Chr1 complement(158862..158903,158907..158945,158949.....    37   3e-04
Smik_12.520 Chr12 (909372..909548) [177 bp, 59 aa] {ON} YCR018C-...    37   3e-04
YER181C Chr5 complement(551473..551796) [324 bp, 107 aa] {OFF} D...    37   3e-04
Smik_16.239 Chr16 (437266..437292,437296..437406,437410..437433)...    36   5e-04
Smik_5.355 Chr5 (551204..551314,551318..551335) [129 bp, 43 aa] ...    36   5e-04
Smik_7.177 Chr7 complement(313993..314118,314122..314178) [183 b...    35   8e-04
Smik_12.412 Chr12 (722297..722305,722309..722368) [69 bp, 23 aa]...    35   9e-04
Smik_7.67 Chr7 complement(109941..110054,110058..110126) [183 bp...    35   0.001
Smik_13.71 Chr13 (129995..130069) [75 bp, 25 aa] {ON}  YCR018C-A...    34   0.001
Smik_15.189 Chr15 (321752..321835) [84 bp, 28 aa] {ON}  YOL106W ...    34   0.001
Smik_11.174 Chr11 (294261..294311) [51 bp, 17 aa] {ON}  YDR366C ...    34   0.001
Smik_6.244 Chr6 complement(397202..397249,397253..397330) [126 b...    34   0.002
Smik_13.365 Chr13 (570650..570658,570662..570721,570725..570760)...    34   0.002
YDR366C Chr4 complement(1212438..1212836) [399 bp, 132 aa] {OFF}...    36   0.002
Smik_10.261 Chr10 (411825..411938) [114 bp, 38 aa] {ON} YOL106W ...    34   0.002
Smik_3.92 Chr3 complement(126975..127106) [132 bp, 44 aa] {ON}  ...    33   0.003
Smik_7.186 Chr7 complement(322627..322692,322699..322707,322711....    34   0.003
Smik_7.154 Chr7 complement(281248..281283,281287..281373,281377....    34   0.004
Smik_12.351 Chr12 complement(626877..627023,627033..627107,62711...    33   0.008
Smik_12.563 Chr12 complement(990482..990661) [180 bp, 60 aa] {ON...    33   0.012
YCR018C-A Chr3 complement(151608..151862) [255 bp, 84 aa] {OFF} ...    33   0.014
Smik_4.329 Chr4 (586928..586936,586940..586999,587003..587047) [...    32   0.015
Smik_11.265 Chr11 complement(444981..445088,445092..445193) [210...    32   0.026
Smik_11.177 Chr11 complement(294581..294622) [42 bp, 14 aa] {ON}...    31   0.028
Smik_11.219 Chr11 complement(366097..366162,366166..366204,36620...    31   0.039
Smik_6.238 Chr6 (392222..392299) [78 bp, 26 aa] {ON}  YDR366C (R...    30   0.039
Smik_16.393 Chr16 complement(691371..691439) [69 bp, 23 aa] {ON}...    30   0.043
Smik_6.209 Chr6 (347246..347344) [99 bp, 33 aa] {ON}  YER181C (R...    30   0.072
Smik_7.330 Chr7 (553432..553515) [84 bp, 28 aa] {ON}  YOL106W (R...    29   0.13 
Smik_7.328 Chr7 (553278..553325) [48 bp, 16 aa] {ON}  YDR366C (R...    29   0.16 
Smik_9.162 Chr9 (275247..275366,275376..275477) [222 bp, 74 aa] ...    30   0.24 
Smik_12.380 Chr12 complement(669961..670068,670072..670140) [177...    29   0.33 
Smik_12.508 Chr12 (895841..895867,895871..895885,895889..895972,...    29   0.46 
Skud_5.65 Chr5 (97653..97706) [54 bp, 18 aa] {ON}  YER181C (REPEAT)    27   0.59 
Smik_3.109 Chr3 (149590..149595,149599..149676) [84 bp, 28 aa] {...    27   0.66 
Smik_10.234 Chr10 (374037..374183) [147 bp, 49 aa] {ON} YOL106W ...    28   0.66 
Smik_3.198 Chr3 (294331..294408) [78 bp, 26 aa] {ON} YDR366C (RE...    27   0.78 
Smik_5.97 Chr5 (137480..137698,137702..137758) [276 bp, 92 aa] {...    28   0.86 
Smik_15.529 Chr15 complement(925250..925360,925364..925414) [162...    27   1.1  
Smik_27.3 Chr27 complement(1694..1864) [171 bp, 57 aa] {ON} YDR3...    27   1.3  
Skud_10.212 Chr10 complement(389330..389434) [105 bp, 35 aa] {ON...    27   1.5  
Smik_15.181 Chr15 complement(307989..308018,308022..308138) [147...    26   2.6  
Smik_3.89 Chr3 (123152..123211,123215..123244,123248..123316) [1...    26   2.9  
Smik_12.178 Chr12 complement(355239..355298,355302..355340,35534...    26   3.1  
Skud_5.1 Chr5 (3..86) [84 bp, 27 aa] {ON}   (REPEAT)                   25   3.4  
Suva_8.231 Chr8 complement(414155..414190) [36 bp, 12 aa] {ON}  ...    25   5.1  
Smik_15.237 Chr15 (404135..404176) [42 bp, 14 aa] {ON}  YOL106W ...    25   6.9  
Smik_7.66 Chr7 complement(109898..109939) [42 bp, 14 aa] {ON}  Y...    25   6.9  
Smik_8.38 Chr8 complement(69763..69825) [63 bp, 21 aa] {ON}  YOL...    24   9.2  

>Smik_6.464 Chr6 (767126..767194,767198..767203,767207..767353)
          [222 bp, 74 aa] {ON} YOL106W (REPEAT)
          Length = 74

 Score =  105 bits (263), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 56/74 (75%), Positives = 56/74 (75%)

Query: 1  ERLANFEMIVGIPLLIKAIILGMXXXXXXXXXXXXXXXXXXPITLSILAFQLPLISMTAS 60
          ERLANFEMIVGIPLLIKAIILGM                  PITLSILAFQLPLISMTAS
Sbjct: 1  ERLANFEMIVGIPLLIKAIILGMIYKFSSIISSFYMFLFIYPITLSILAFQLPLISMTAS 60

Query: 61 HNLCHLITPYMIMY 74
          HNLCHLITPYMIMY
Sbjct: 61 HNLCHLITPYMIMY 74

>Smik_11.122 Chr11
          complement(206340..206501,206505..206543,
          206547..206615) [270 bp, 90 aa] {ON} YOL106W (REPEAT)
          Length = 90

 Score = 78.6 bits (192), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 51/90 (56%), Gaps = 16/90 (17%)

Query: 1  ERLANFEMIVGIPLLIKAIILG----------------MXXXXXXXXXXXXXXXXXXPIT 44
          E+  NFEM VGIPLLIKAI+ G                +                  PIT
Sbjct: 1  EKWMNFEMTVGIPLLIKAILFGINILEVLLEDIGIQLELVILLNSVYTLFYYVVSHYPIT 60

Query: 45 LSILAFQLPLISMTASHNLCHLITPYMIMY 74
          LSILAFQLPLI MTASHN+CHL+TPYMI+Y
Sbjct: 61 LSILAFQLPLILMTASHNVCHLLTPYMIIY 90

>Smik_4.615 Chr4
          (1101523..1101591,1101595..1101633,1101637..1101804)
          [276 bp, 92 aa] {ON}  YOL106W (REPEAT)
          Length = 92

 Score = 76.6 bits (187), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/92 (47%), Positives = 52/92 (56%), Gaps = 18/92 (19%)

Query: 1  ERLANFEMIVGIPLLIKAIILGMXXX------------------XXXXXXXXXXXXXXXP 42
          ++  NFE+IVGIPLLIKAI+ G+                                    P
Sbjct: 1  KKWVNFEIIVGIPLLIKAILFGINILEVLLEDIGIPMELVILHNSVYAFIVILYAVSHYP 60

Query: 43 ITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          IT+SILAFQLPL SMTAS+NLCHL+TPYMIMY
Sbjct: 61 ITISILAFQLPLTSMTASYNLCHLLTPYMIMY 92

>Smik_1.61 Chr1 (121688..121969) [282 bp, 94 aa] {ON} YOL106W
          (REPEAT)
          Length = 94

 Score = 74.3 bits (181), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 51/94 (54%), Gaps = 20/94 (21%)

Query: 1  ERLANFEMIVGIPLLIKAIILGMXXXXXXXXXXXXXXXXXXPI----------------- 43
          E   NFEM+VGIPLLIKAI+ G+                   I                 
Sbjct: 1  EIWVNFEMLVGIPLLIKAILFGIENILEVLLGNLGIHKRESAILHNSINIIIIVLYVVIH 60

Query: 44 ---TLSILAFQLPLISMTASHNLCHLITPYMIMY 74
             TLSILAFQLPLISMTASHNLCHL+TPYMI+Y
Sbjct: 61 YLITLSILAFQLPLISMTASHNLCHLLTPYMIIY 94

>Smik_11.26 Chr11 (58522..58596,58600..58638,58642..58809) [282
          bp, 94 aa] {ON} YER181C (REPEAT)
          Length = 94

 Score = 72.8 bits (177), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/92 (48%), Positives = 49/92 (53%), Gaps = 18/92 (19%)

Query: 1  ERLANFEMIVGIPLLIKAIILGMXXXXXXX------------------XXXXXXXXXXXP 42
          E   NFE+IVGIPLLIK I+L +                                    P
Sbjct: 3  EDGVNFEIIVGIPLLIKTILLDINILKVILENIGIQMELVILPNSVCIFIAILYVVSHYP 62

Query: 43 ITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          ITLSILAFQLPL  MTASHNLCHL+TPYMIMY
Sbjct: 63 ITLSILAFQLPLTLMTASHNLCHLLTPYMIMY 94

>Smik_6.174 Chr6 (284801..284926) [126 bp, 42 aa] {ON} YER181C
          (REPEAT)
          Length = 42

 Score = 68.2 bits (165), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPLISMTASHNLCHLITPYMIMY
Sbjct: 10 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 42

>Smik_15.45 Chr15 (79159..79284) [126 bp, 42 aa] {ON} YER181C
          (REPEAT)
          Length = 42

 Score = 67.8 bits (164), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPLISMTASHNLCHLITPYMIMY
Sbjct: 10 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 42

>Smik_16.367 Chr16 complement(654240..654344) [105 bp, 35 aa] {ON}
           YER181C (REPEAT)
          Length = 35

 Score = 67.4 bits (163), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPLISMTASHNLCHLITPYMIMY
Sbjct: 3  PITLSILAFQLPLISMTASHNLCHLITPYMIMY 35

>Smik_6.198 Chr6 complement(329356..329460) [105 bp, 35 aa] {ON}
          YER181C (REPEAT)
          Length = 35

 Score = 67.4 bits (163), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPLISMTASHNLCHLITPYMIMY
Sbjct: 3  PITLSILAFQLPLISMTASHNLCHLITPYMIMY 35

>Smik_10.209 Chr10 (348928..348960,348964..349101) [171 bp, 57 aa]
          {ON} YER181C (REPEAT)
          Length = 57

 Score = 66.6 bits (161), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 32/33 (96%), Positives = 32/33 (96%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPL SMTASHNLCHLITPYMIMY
Sbjct: 25 PITLSILAFQLPLTSMTASHNLCHLITPYMIMY 57

>Smik_5.356 Chr5 (551353..551484) [132 bp, 44 aa] {ON}  YER181C
          (REPEAT)
          Length = 44

 Score = 66.2 bits (160), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 32/33 (96%), Positives = 33/33 (100%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPLISMTASHNLCHL+TPYMIMY
Sbjct: 12 PITLSILAFQLPLISMTASHNLCHLLTPYMIMY 44

>Smik_15.264 Chr15 complement(447824..447961,447965..447997) [171
          bp, 57 aa] {ON} YER181C (REPEAT)
          Length = 57

 Score = 65.9 bits (159), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 31/33 (93%), Positives = 32/33 (96%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPLISMT SHNLCHL+TPYMIMY
Sbjct: 25 PITLSILAFQLPLISMTVSHNLCHLLTPYMIMY 57

>Smik_6.173 Chr6 (284583..284591,284595..284732) [147 bp, 49 aa]
          {ON} YER181C (REPEAT)
          Length = 49

 Score = 65.5 bits (158), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 31/33 (93%), Positives = 32/33 (96%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPL SMTASHNLCHL+TPYMIMY
Sbjct: 17 PITLSILAFQLPLTSMTASHNLCHLLTPYMIMY 49

>Smik_4.342 Chr4 (612069..612077,612081..612218) [147 bp, 49 aa]
          {ON} YER181C (REPEAT)
          Length = 49

 Score = 64.7 bits (156), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/33 (93%), Positives = 33/33 (100%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPLISMTASHNLCHL+TPYMIM+
Sbjct: 17 PITLSILAFQLPLISMTASHNLCHLLTPYMIMH 49

>Smik_11.83 Chr11 complement(148492..148611) [120 bp, 40 aa] {ON} 
          YER181C (REPEAT)
          Length = 40

 Score = 63.9 bits (154), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 31/33 (93%), Positives = 32/33 (96%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPLISMTASHN+CHL TPYMIMY
Sbjct: 8  PITLSILAFQLPLISMTASHNVCHLPTPYMIMY 40

>Smik_10.262 Chr10 (411983..412105) [123 bp, 41 aa] {ON} YER181C
          (REPEAT)
          Length = 41

 Score = 60.1 bits (144), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/33 (90%), Positives = 30/33 (90%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPL SMTASHNL HL TPYMIMY
Sbjct: 9  PITLSILAFQLPLTSMTASHNLGHLQTPYMIMY 41

>Smik_12.31 Chr12 complement(76648..76791) [144 bp, 48 aa] {ON}
          YER181C (REPEAT)
          Length = 48

 Score = 59.7 bits (143), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/33 (87%), Positives = 32/33 (96%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPLISMTASHNLCHL+TP MI++
Sbjct: 16 PITLSILAFQLPLISMTASHNLCHLLTPNMIIH 48

>Smik_12.177 Chr12 complement(355126..355161,355165..355260) [132
          bp, 44 aa] {ON}  YER181C (REPEAT)
          Length = 44

 Score = 57.8 bits (138), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 30/33 (90%), Positives = 31/33 (93%), Gaps = 1/33 (3%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPLISMTASHN CHL TPY+IMY
Sbjct: 12 PITLSILAFQLPLISMTASHN-CHLRTPYIIMY 43

>Smik_16.392 Chr16 complement(691144..691311,691315..691353) [207
          bp, 69 aa] {ON} YER181C (REPEAT)
          Length = 69

 Score = 57.0 bits (136), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 27/33 (81%), Positives = 29/33 (87%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPLI M ASHNLCHL+  YMI+Y
Sbjct: 37 PITLSILAFQLPLILMAASHNLCHLLIAYMIIY 69

>Smik_13.227 Chr13
          complement(361490..361576,361580..361657,
          361661..361777) [282 bp, 94 aa] {ON} YDR366C (REPEAT)
          Length = 94

 Score = 52.4 bits (124), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%)

Query: 45 LSILAFQLPLISMTASHNLCHLITPYMIMY 74
          +SILAFQL L  MTASHNLCHL+TPYMI+Y
Sbjct: 65 ISILAFQLSLTLMTASHNLCHLLTPYMIIY 94

>Smik_5.2 Chr5 (796..1047) [252 bp, 84 aa] {ON} YER181C (REPEAT)
          Length = 84

 Score = 51.6 bits (122), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 25/33 (75%), Positives = 28/33 (84%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPL  MT S +LCHL+TP MI+Y
Sbjct: 52 PITLSILAFQLPLDLMTVSQSLCHLLTPLMILY 84

>Smik_4.527 Chr4 complement(950709..951071) [363 bp, 120 aa] {ON}
           YER181C (REPEAT)
          Length = 120

 Score = 51.2 bits (121), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 42/93 (45%), Gaps = 19/93 (20%)

Query: 1   ERLANFEMIVGIPLLIKAIIL-------------------GMXXXXXXXXXXXXXXXXXX 41
           E+  NFE+IV  P LIK I+L                    +                  
Sbjct: 23  EKQVNFEIIVEAPFLIKVILLCTHNILRVLLKDIGIYKWDSVVLHDNTPTPSFRLIRCHY 82

Query: 42  PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
           P TLSILAFQ PL SMT S++LCHL+  YM +Y
Sbjct: 83  PTTLSILAFQFPLKSMTVSYHLCHLLAQYMKIY 115

>Smik_27.5 Chr27 complement(1992..2045,2049..2129,2133..2141) [144
          bp, 48 aa] {ON}  YER181C (REPEAT)
          Length = 48

 Score = 48.9 bits (115), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/33 (78%), Positives = 29/33 (87%), Gaps = 1/33 (3%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PI LSILAFQLPLI MT SH+L HL+TPYMI+Y
Sbjct: 17 PIKLSILAFQLPLI-MTVSHHLRHLLTPYMIIY 48

>Smik_3.161 Chr3
          complement(226612..226665,226669..226749,
          226753..226785) [168 bp, 56 aa] {ON} YER181C (REPEAT)
          Length = 56

 Score = 48.5 bits (114), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/33 (75%), Positives = 29/33 (87%), Gaps = 1/33 (3%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPL +MTA  N+ H++TPYMIMY
Sbjct: 25 PITLSILAFQLPL-NMTAFRNIRHILTPYMIMY 56

>Smik_13.310 Chr13
          complement(487114..487167,487171..487251,
          487255..487287) [168 bp, 56 aa] {ON} YER181C (REPEAT)
          Length = 56

 Score = 47.8 bits (112), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/33 (78%), Positives = 29/33 (87%), Gaps = 1/33 (3%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PITLSILAFQLPLI MT SH+L HL+T YMI+Y
Sbjct: 25 PITLSILAFQLPLI-MTISHHLRHLLTSYMIIY 56

>Smik_8.57 Chr8 (95346..95372,95379..95450) [99 bp, 33 aa] {ON}
          YOL106W (REPEAT)
          Length = 33

 Score = 47.0 bits (110), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ERLANFEMIVGIPLLIKAIILGM
Sbjct: 11 ERLANFEMIVGIPLLIKAIILGM 33

>Smik_8.76 Chr8 (113465..113533) [69 bp, 23 aa] {ON}  YOL106W
          (REPEAT)
          Length = 23

 Score = 46.6 bits (109), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ERLANFEMIVGIPLLIKAIILGM
Sbjct: 1  ERLANFEMIVGIPLLIKAIILGM 23

>Smik_8.205 Chr8 complement(335066..335134) [69 bp, 23 aa] {ON}
          YOL106W (REPEAT)
          Length = 23

 Score = 46.6 bits (109), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ERLANFEMIVGIPLLIKAIILGM
Sbjct: 1  ERLANFEMIVGIPLLIKAIILGM 23

>Smik_6.90 Chr6
          (165837..165908,165912..165917,165921..165935,
          165939..165977,165981..166061,166065..166112) [261 bp,
          87 aa] {OFF} YER181C (PSEUDO)
          Length = 87

 Score = 47.8 bits (112), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 40/87 (45%), Gaps = 16/87 (18%)

Query: 1  ERLANFEMIVGIPLLIKAIILGMX---------------XXXXXXXXXXXXXXXXXPITL 45
          E L  F +I GIP   KAIIL M                                 PI L
Sbjct: 2  EILVEFVVIAGIPFFNKAIILAMTYKFSGIESMKGNLQLYTILTLLSSFYMLLFIDPIKL 61

Query: 46 SILAFQLPLISMTASHNLCHLITPYMI 72
          SILAFQL LI MT SH+L HL+TPYMI
Sbjct: 62 SILAFQLLLI-MTISHHLRHLVTPYMI 87

>Smik_16.117 Chr16
          complement(216838..216900,216904..216981,
          216985..217014) [171 bp, 57 aa] {ON}  YER181C (REPEAT)
          Length = 57

 Score = 46.6 bits (109), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 1/25 (4%)

Query: 42 PITLSILAFQLPLISMTASHNLCHL 66
          PIT SILAFQLPLISMTASHNLCHL
Sbjct: 34 PIT-SILAFQLPLISMTASHNLCHL 57

>Smik_6.243 Chr6
          complement(397041..397109,397113..397127,
          397131..397190) [144 bp, 48 aa] {ON} YER181C (REPEAT)
          Length = 48

 Score = 45.4 bits (106), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/33 (78%), Positives = 28/33 (84%), Gaps = 2/33 (6%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PIT SIL F LPL  MTASHNLCHL+TPYMI+Y
Sbjct: 18 PIT-SILTF-LPLTLMTASHNLCHLLTPYMIIY 48

>Smik_8.147 Chr8 complement(214508..214585,214589..214609) [99 bp,
          33 aa] {ON}  YOL106W (REPEAT)
          Length = 33

 Score = 44.7 bits (104), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (95%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ERL NFEMIVG+PLLIKAIILGM
Sbjct: 11 ERLVNFEMIVGVPLLIKAIILGM 33

>Smik_15.49 Chr15 (82181..82348) [168 bp, 56 aa] {ON} YOL106W
          (REPEAT)
          Length = 56

 Score = 44.3 bits (103), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (95%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E+L NFEMIVGIPLLIKAIILGM
Sbjct: 34 EKLVNFEMIVGIPLLIKAIILGM 56

>Smik_3.62 Chr3 complement(88736..88804) [69 bp, 23 aa] {ON}
          YOL106W (REPEAT)
          Length = 23

 Score = 43.5 bits (101), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ER ANFEMIVGIPLLIK IILGM
Sbjct: 1  ERWANFEMIVGIPLLIKVIILGM 23

>Smik_10.199 Chr10 (346712..346798) [87 bp, 29 aa] {ON}  YDR366C
          (REPEAT)
          Length = 29

 Score = 43.1 bits (100), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ERL NFEMIVGIPLLIK IILGM
Sbjct: 7  ERLVNFEMIVGIPLLIKVIILGM 29

>Smik_3.63 Chr3 (88885..88953) [69 bp, 23 aa] {ON}  YOL106W
          (REPEAT)
          Length = 23

 Score = 43.1 bits (100), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 21/23 (91%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ERL NFEMIVGIPLLIK IILGM
Sbjct: 1  ERLVNFEMIVGIPLLIKVIILGM 23

>YOL106W Chr15 (113226..113579) [354 bp, 117 aa] {OFF} Dubious open
           reading frame unlikely to encode a functional protein,
           based on available experimental and comparative sequence
           data
          Length = 117

 Score = 44.7 bits (104), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 45/94 (47%), Gaps = 20/94 (21%)

Query: 1   ERLANFEMIVGIPLLIKAIILGMXXXXXX----------XXXXXXXXXXXXPITLSILAF 50
           E+  NFE+IVGIP LIKAIILG+                            P ++S ++ 
Sbjct: 24  EKWVNFEIIVGIPSLIKAIILGIQNVLEVLLDDIGIPIMESIFLCTNITIIPHSISYVSL 83

Query: 51  QL----PLISMTAS------HNLCHLITPYMIMY 74
                 P IS +++      +NLCH +TPYMI+Y
Sbjct: 84  SYYIIDPCISASSNFGDSFYNNLCHYLTPYMIIY 117

>Smik_3.56 Chr3 (83840..83929) [90 bp, 30 aa] {ON}  YDR366C
          (REPEAT)
          Length = 30

 Score = 42.4 bits (98), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 20/23 (86%), Positives = 21/23 (91%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E+  NFEMIVGIPLLIKAIILGM
Sbjct: 8  EKWVNFEMIVGIPLLIKAIILGM 30

>Smik_6.121 Chr6 complement(198363..198470) [108 bp, 36 aa] {ON}
          YOL106W (REPEAT)
          Length = 36

 Score = 42.7 bits (99), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 20/23 (86%), Positives = 22/23 (95%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ERLANFEMIVGIPLLIKAI+ G+
Sbjct: 1  ERLANFEMIVGIPLLIKAILFGI 23

>Smik_10.207 Chr10 (348819..348881) [63 bp, 21 aa] {ON}  YOL106W
          (REPEAT)
          Length = 21

 Score = 42.4 bits (98), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/21 (100%), Positives = 21/21 (100%)

Query: 1  ERLANFEMIVGIPLLIKAIIL 21
          ERLANFEMIVGIPLLIKAIIL
Sbjct: 1  ERLANFEMIVGIPLLIKAIIL 21

>Smik_7.231 Chr7 complement(396783..396851) [69 bp, 23 aa] {ON}
          YOL106W (REPEAT)
          Length = 23

 Score = 42.0 bits (97), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/23 (86%), Positives = 21/23 (91%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E+  NFEMIVGIPLLIKAIILGM
Sbjct: 1  EKWVNFEMIVGIPLLIKAIILGM 23

>Smik_16.122 Chr16 complement(220698..220823) [126 bp, 42 aa] {ON}
          YOL106W (REPEAT)
          Length = 42

 Score = 42.4 bits (98), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/23 (86%), Positives = 21/23 (91%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E+  NFEMIVGIPLLIKAIILGM
Sbjct: 20 EKWVNFEMIVGIPLLIKAIILGM 42

>Smik_5.361 Chr5 complement(559269..559463,559467..559553) [282
          bp, 94 aa] {ON} YOL106W (REPEAT)
          Length = 94

 Score = 43.5 bits (101), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 41/92 (44%), Gaps = 18/92 (19%)

Query: 1  ERLANFEMIVGIPLLIKAIILGMXXXXXXXXXXXXXXXXXXPITLSILA----------F 50
          E+  NFE+IVGI LLIKA++L                     +  SIL           F
Sbjct: 3  EKWVNFEIIVGISLLIKAVLLFRHNILVLLHDIAIHKRESIILHNSILLIFCFICCHSLF 62

Query: 51 QLPLIS--------MTASHNLCHLITPYMIMY 74
           L   S        MT SHNLCH +TPYMI+Y
Sbjct: 63 LLQYQSCVSASLNLMTVSHNLCHHLTPYMIIY 94

>Smik_7.261 Chr7 complement(432507..432575) [69 bp, 23 aa] {ON}
          YOL106W (REPEAT)
          Length = 23

 Score = 40.4 bits (93), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/23 (82%), Positives = 21/23 (91%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E+  NF+MIVGIPLLIKAIILGM
Sbjct: 1  EKWVNFKMIVGIPLLIKAIILGM 23

>Smik_14.285 Chr14 (520719..520796) [78 bp, 26 aa] {ON}  YOL106W
          (REPEAT)
          Length = 26

 Score = 40.4 bits (93), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (90%)

Query: 1  ERLANFEMIVGIPLLIKAIILG 22
          E+  NFEMIVGIPLLIKAIILG
Sbjct: 1  EKWVNFEMIVGIPLLIKAIILG 22

>Smik_6.120 Chr6 complement(198065..198172) [108 bp, 36 aa] {ON}
          YOL106W (REPEAT)
          Length = 36

 Score = 40.4 bits (93), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ERLANFEMIVGIP  IKAI+ G+
Sbjct: 1  ERLANFEMIVGIPWFIKAILFGI 23

>Smik_11.2 Chr11 (1296..1403) [108 bp, 36 aa] {ON}  YOL106W
          (REPEAT)
          Length = 36

 Score = 40.4 bits (93), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ERLANFEMIVGIP  IKAI+ G+
Sbjct: 1  ERLANFEMIVGIPWFIKAILFGI 23

>Smik_4.571 Chr4 complement(1027481..1027588) [108 bp, 36 aa] {ON}
           YOL106W (REPEAT)
          Length = 36

 Score = 40.4 bits (93), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ERLANFEMIVGIP  IKAI+ G+
Sbjct: 1  ERLANFEMIVGIPWFIKAILFGI 23

>Smik_4.416 Chr4 (761141..761248) [108 bp, 36 aa] {ON}  YOL106W
          (REPEAT)
          Length = 36

 Score = 40.4 bits (93), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ERLANFEMIVGIP  IKAI+ G+
Sbjct: 1  ERLANFEMIVGIPWFIKAILFGI 23

>Smik_6.119 Chr6 complement(197767..197874) [108 bp, 36 aa] {ON}
          YOL106W (REPEAT)
          Length = 36

 Score = 40.4 bits (93), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ERLANFEMIVGIP  IKAI+ G+
Sbjct: 1  ERLANFEMIVGIPWFIKAILFGI 23

>Suva_5.55 Chr5 (97165..97296) [132 bp, 43 aa] {ON}  (REPEAT)
          Length = 43

 Score = 40.4 bits (93), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 6/38 (15%)

Query: 42 PITLSILAFQLPLISMTA------SHNLCHLITPYMIM 73
          PIT+SILA QLPLISMT       S NL HL TPY+I+
Sbjct: 2  PITISILALQLPLISMTVSILSYWSCNLRHLFTPYIIV 39

>Smik_12.329 Chr12 (595891..595959) [69 bp, 23 aa] {ON}  YOL106W
          (REPEAT)
          Length = 23

 Score = 39.3 bits (90), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/23 (86%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E   NFEMIVGIPLLIKAIILGM
Sbjct: 1  EIWVNFEMIVGIPLLIKAIILGM 23

>Smik_4.820 Chr4
          complement(1437887..1437952,1437956..1437994,
          1437998..1438066) [174 bp, 58 aa] {ON} YOL106W (REPEAT)
          Length = 58

 Score = 38.9 bits (89), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E+  NFEMIVGIPLLIKAI+ G+
Sbjct: 1  EKWVNFEMIVGIPLLIKAILFGI 23

>Smik_6.95 Chr6 complement(171372..171566) [195 bp, 65 aa] {ON}
          YOL106W (REPEAT)
          Length = 65

 Score = 38.9 bits (89), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E+  NFEMIVGIPLLIKAI+ G+
Sbjct: 6  EKWVNFEMIVGIPLLIKAILFGI 28

>Smik_12.318 Chr12 (572854..572886,572890..572985) [129 bp, 43 aa]
          {ON} YER181C (REPEAT)
          Length = 43

 Score = 38.1 bits (87), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/19 (100%), Positives = 19/19 (100%)

Query: 42 PITLSILAFQLPLISMTAS 60
          PITLSILAFQLPLISMTAS
Sbjct: 25 PITLSILAFQLPLISMTAS 43

>Smik_10.318 Chr10
          complement(503529..503594,503601..503636,
          503640..503708) [171 bp, 57 aa] {ON} YOL106W (REPEAT)
          Length = 57

 Score = 38.1 bits (87), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ER  NFE+IVGIPLLIKAI+ G+
Sbjct: 1  ERWVNFEIIVGIPLLIKAILFGI 23

>Smik_7.340 Chr7 (568129..568239) [111 bp, 37 aa] {ON} YER181C
          (REPEAT)
          Length = 37

 Score = 37.7 bits (86), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 24/33 (72%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PI L IL FQL L SMT  ++LC L+T YMI+Y
Sbjct: 5  PIILLILTFQLALKSMTVFNHLCGLLTSYMIVY 37

>Smik_4.210 Chr4 (390131..390244,390248..390280) [147 bp, 49 aa]
          {ON} YDR366C (REPEAT)
          Length = 49

 Score = 37.7 bits (86), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 21/23 (91%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E + NFE+IVGIPLLIKAI+LG+
Sbjct: 16 ENMVNFEIIVGIPLLIKAILLGI 38

>Smik_7.112 Chr7 (198899..198967,198971..199009,199013..199078)
          [174 bp, 58 aa] {ON} YOL106W (REPEAT)
          Length = 58

 Score = 37.7 bits (86), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E+  NFEMIVGIPLL+KA++ G+
Sbjct: 1  EKWVNFEMIVGIPLLVKAVLFGI 23

>Smik_2.19 Chr2 complement(29356..29439) [84 bp, 28 aa] {ON}
          YOL106W (REPEAT)
          Length = 28

 Score = 37.0 bits (84), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 18/18 (100%)

Query: 57 MTASHNLCHLITPYMIMY 74
          ++ASHNLCHL+TPYMIMY
Sbjct: 11 ISASHNLCHLLTPYMIMY 28

>Smik_3.128 Chr3
          (167733..167738,167742..167852,167856..167894,
          167898..167963) [222 bp, 74 aa] {ON} YDR366C (REPEAT)
          Length = 74

 Score = 37.4 bits (85), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E L NFEMIVGIPLLIKAI+ G+
Sbjct: 17 EILVNFEMIVGIPLLIKAILFGI 39

>Smik_4.693 Chr4 complement(1226937..1227038) [102 bp, 34 aa] {ON}
           YDR366C (REPEAT)
          Length = 34

 Score = 36.2 bits (82), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E + NFE+IVGIPLLIKAI+ G+
Sbjct: 12 ENMVNFEIIVGIPLLIKAILFGI 34

>Smik_1.87 Chr1
          complement(158862..158903,158907..158945,
          158949..159029) [162 bp, 54 aa] {ON} YDR366C (REPEAT)
          Length = 54

 Score = 36.6 bits (83), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 19/22 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILG 22
          E L NFE+IVGIPLLIK I+LG
Sbjct: 5  ENLVNFEIIVGIPLLIKVILLG 26

>Smik_12.520 Chr12 (909372..909548) [177 bp, 59 aa] {ON} YCR018C-A
          (REPEAT)
          Length = 59

 Score = 36.6 bits (83), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 19/19 (100%)

Query: 5  NFEMIVGIPLLIKAIILGM 23
          NFEMIVGIPLLIKAI+LG+
Sbjct: 1  NFEMIVGIPLLIKAILLGI 19

>YER181C Chr5 complement(551473..551796) [324 bp, 107 aa] {OFF}
           Dubious open reading frame unlikely to encode a protein,
           based on available experimental and comparative data;
           extensively overlaps a Ty1 LTR; protein product is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 107

 Score = 37.4 bits (85), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 40/93 (43%), Gaps = 19/93 (20%)

Query: 1   ERLANFEMIVGIPLLIKAIILGMXXXX-------------------XXXXXXXXXXXXXX 41
           E   NF +I+GIPLLI+A IL +                                     
Sbjct: 9   EVCVNFVIIIGIPLLIEASILCIQNILELLLKGIGILKFNRYLHTIILRLFFLSFYMLHF 68

Query: 42  PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
           PITLSILAFQLPL  +T S    HL   +MI+Y
Sbjct: 69  PITLSILAFQLPLNLLTLSQASFHLPRSHMILY 101

>Smik_16.239 Chr16 (437266..437292,437296..437406,437410..437433)
          [162 bp, 54 aa] {ON}  YDR366C (REPEAT)
          Length = 54

 Score = 36.2 bits (82), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 19/23 (82%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E   NFE+IVGIP LIKAI+LG+
Sbjct: 24 ESFVNFEIIVGIPWLIKAILLGI 46

>Smik_5.355 Chr5 (551204..551314,551318..551335) [129 bp, 43 aa]
          {ON} YOL106W (REPEAT)
          Length = 43

 Score = 35.8 bits (81), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 19/23 (82%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E+  NFEMIVGIPLLI AI+ G+
Sbjct: 1  EKWVNFEMIVGIPLLISAILFGI 23

>Smik_7.177 Chr7 complement(313993..314118,314122..314178) [183
          bp, 61 aa] {ON} YDR366C (REPEAT)
          Length = 61

 Score = 35.4 bits (80), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 17/19 (89%)

Query: 1  ERLANFEMIVGIPLLIKAI 19
          ERL N EMIVGIPLLIKAI
Sbjct: 1  ERLVNIEMIVGIPLLIKAI 19

>Smik_12.412 Chr12 (722297..722305,722309..722368) [69 bp, 23 aa]
          {ON}  YOL106W (REPEAT)
          Length = 23

 Score = 34.7 bits (78), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 22/23 (95%), Gaps = 1/23 (4%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ER+ NFE+IVGIPLLIKAI+LG+
Sbjct: 2  ERV-NFEIIVGIPLLIKAILLGI 23

>Smik_7.67 Chr7 complement(109941..110054,110058..110126) [183 bp,
          61 aa] {ON} YOL106W (REPEAT)
          Length = 61

 Score = 35.0 bits (79), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 18/23 (78%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E   NFEMI G+P+LIKAIIL M
Sbjct: 1  EIWVNFEMIAGVPMLIKAIILDM 23

>Smik_13.71 Chr13 (129995..130069) [75 bp, 25 aa] {ON}  YCR018C-A
          (REPEAT)
          Length = 25

 Score = 34.3 bits (77), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%)

Query: 1  ERLANFEMIVGIPLLIKAIIL 21
          +R  NFE+IVGIPLLIKAI+L
Sbjct: 5  KRRVNFEIIVGIPLLIKAILL 25

>Smik_15.189 Chr15 (321752..321835) [84 bp, 28 aa] {ON}  YOL106W
          (REPEAT)
          Length = 28

 Score = 34.3 bits (77), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/16 (87%), Positives = 16/16 (100%)

Query: 59 ASHNLCHLITPYMIMY 74
          ASH+LCHL+TPYMIMY
Sbjct: 13 ASHSLCHLLTPYMIMY 28

>Smik_11.174 Chr11 (294261..294311) [51 bp, 17 aa] {ON}  YDR366C
          (REPEAT)
          Length = 17

 Score = 34.3 bits (77), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/17 (100%), Positives = 17/17 (100%)

Query: 5  NFEMIVGIPLLIKAIIL 21
          NFEMIVGIPLLIKAIIL
Sbjct: 1  NFEMIVGIPLLIKAIIL 17

>Smik_6.244 Chr6 complement(397202..397249,397253..397330) [126
          bp, 42 aa] {ON}  YOL106W (REPEAT)
          Length = 42

 Score = 34.3 bits (77), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ER  +FE IVGIPL IKAI+ G+
Sbjct: 4  ERCVSFETIVGIPLFIKAILFGI 26

>Smik_13.365 Chr13 (570650..570658,570662..570721,570725..570760)
          [105 bp, 35 aa] {ON}  YDR366C (REPEAT)
          Length = 35

 Score = 33.9 bits (76), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 18/19 (94%)

Query: 5  NFEMIVGIPLLIKAIILGM 23
          NFE IVGIPLLIKAI+LG+
Sbjct: 5  NFETIVGIPLLIKAILLGI 23

>YDR366C Chr4 complement(1212438..1212836) [399 bp, 132 aa] {OFF}
          Putative protein of unknown function
          Length = 132

 Score = 35.8 bits (81), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E+  N E+IVGIPLLIKAIILG+
Sbjct: 73 EKYVNVEIIVGIPLLIKAIILGI 95

>Smik_10.261 Chr10 (411825..411938) [114 bp, 38 aa] {ON} YOL106W
          (REPEAT)
          Length = 38

 Score = 33.9 bits (76), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 19/23 (82%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E   NFE+IVGIPLLIKAI+ G+
Sbjct: 1  EIWVNFEIIVGIPLLIKAILFGI 23

>Smik_3.92 Chr3 complement(126975..127106) [132 bp, 44 aa] {ON}
          YOL106W (REPEAT)
          Length = 44

 Score = 33.5 bits (75), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (85%)

Query: 1  ERLANFEMIVGIPLLIKAIIL 21
          E   NFE+IVGIPLLIKA++L
Sbjct: 1  ENWVNFEIIVGIPLLIKAVLL 21

>Smik_7.186 Chr7
          complement(322627..322692,322699..322707,
          322711..322743,322747..322869) [231 bp, 77 aa] {ON}
          YOL106W (REPEAT)
          Length = 77

 Score = 34.3 bits (77), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (73%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E   NFEMIVGIP  IKAI+ G+
Sbjct: 2  EIWVNFEMIVGIPWFIKAILFGI 24

>Smik_7.154 Chr7
          complement(281248..281283,281287..281373,
          281377..281454) [201 bp, 67 aa] {ON} YER181C (REPEAT)
          Length = 67

 Score = 33.9 bits (76), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 19/25 (76%), Gaps = 1/25 (4%)

Query: 42 PITLSILAFQLPLISMTASHNLCHL 66
           ITLSILAFQL LI M  SH LCHL
Sbjct: 42 SITLSILAFQLSLI-MIVSHYLCHL 65

>Smik_12.351 Chr12
          complement(626877..627023,627033..627107,
          627111..627119) [231 bp, 77 aa] {ON} YER181C (REPEAT)
          Length = 77

 Score = 33.5 bits (75), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 32/73 (43%), Gaps = 14/73 (19%)

Query: 7  EMIVGIPLLIKAIILGMXXXXXXXXXX--------------XXXXXXXXPITLSILAFQL 52
          ++IVGI LLIKAI+ G+                                P+TLS   FQL
Sbjct: 5  QIIVGILLLIKAILTGIRNIKFFSKLTEGSNLGYNIIVFFLFLCTTICHPVTLSRHTFQL 64

Query: 53 PLISMTASHNLCH 65
          PL  +T SH+ CH
Sbjct: 65 PLNVVTVSHHSCH 77

>Smik_12.563 Chr12 complement(990482..990661) [180 bp, 60 aa] {ON}
          YCR018C-A (REPEAT)
          Length = 60

 Score = 32.7 bits (73), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 18/20 (90%)

Query: 4  ANFEMIVGIPLLIKAIILGM 23
           NFE+IVGIPLLIKAI+L +
Sbjct: 1  VNFEIIVGIPLLIKAILLSI 20

>YCR018C-A Chr3 complement(151608..151862) [255 bp, 84 aa] {OFF}
          Putative protein of unknown function; encoded opposite
          a Ty1 LTR
          Length = 84

 Score = 32.7 bits (73), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 18/21 (85%)

Query: 1  ERLANFEMIVGIPLLIKAIIL 21
          E   NF+++VGIPLLIKA+IL
Sbjct: 5  ENHVNFQIVVGIPLLIKAVIL 25

>Smik_4.329 Chr4 (586928..586936,586940..586999,587003..587047)
          [114 bp, 38 aa] {ON} YOL106W (REPEAT)
          Length = 38

 Score = 32.0 bits (71), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 4  ANFEMIVGIPLLIKAIILGM 23
           +FEMIVGIPLLIK I+ G+
Sbjct: 4  VDFEMIVGIPLLIKTILFGI 23

>Smik_11.265 Chr11 complement(444981..445088,445092..445193) [210
          bp, 70 aa] {ON} YOL106W (REPEAT)
          Length = 70

 Score = 32.0 bits (71), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 16/19 (84%)

Query: 56 SMTASHNLCHLITPYMIMY 74
          SMTAS+NL H +TPYMI Y
Sbjct: 52 SMTASNNLYHFLTPYMIEY 70

>Smik_11.177 Chr11 complement(294581..294622) [42 bp, 14 aa] {ON} 
          YOL106W (REPEAT)
          Length = 14

 Score = 30.8 bits (68), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 12/14 (85%), Positives = 14/14 (100%)

Query: 61 HNLCHLITPYMIMY 74
          HNLCHL+TPYMI+Y
Sbjct: 1  HNLCHLLTPYMIIY 14

>Smik_11.219 Chr11
          complement(366097..366162,366166..366204,
          366208..366267) [165 bp, 55 aa] {ON} YOL106W (REPEAT)
          Length = 55

 Score = 31.2 bits (69), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 17/19 (89%)

Query: 5  NFEMIVGIPLLIKAIILGM 23
          NFE+IVGIPLL KA+ LG+
Sbjct: 2  NFEIIVGIPLLTKALFLGI 20

>Smik_6.238 Chr6 (392222..392299) [78 bp, 26 aa] {ON}  YDR366C
          (REPEAT)
          Length = 26

 Score = 30.4 bits (67), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 17/23 (73%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E +  F++IVGIP   KAIILGM
Sbjct: 4  EIIVEFDVIVGIPFFYKAIILGM 26

>Smik_16.393 Chr16 complement(691371..691439) [69 bp, 23 aa] {ON} 
          YDR366C (REPEAT)
          Length = 23

 Score = 30.4 bits (67), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 13/15 (86%), Positives = 13/15 (86%)

Query: 1  ERLANFEMIVGIPLL 15
          ER  NFEMIVGIPLL
Sbjct: 9  ERWVNFEMIVGIPLL 23

>Smik_6.209 Chr6 (347246..347344) [99 bp, 33 aa] {ON}  YER181C
          (REPEAT)
          Length = 33

 Score = 30.0 bits (66), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 4/33 (12%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLITPYMIMY 74
          PI L +  FQ+PL S+T S    +L+TPYMI+Y
Sbjct: 5  PIALLVPKFQVPLNSVTVS----NLLTPYMIIY 33

>Smik_7.330 Chr7 (553432..553515) [84 bp, 28 aa] {ON}  YOL106W
          (REPEAT)
          Length = 28

 Score = 29.3 bits (64), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/16 (81%), Positives = 14/16 (87%)

Query: 59 ASHNLCHLITPYMIMY 74
          ASHNL HL+T YMIMY
Sbjct: 13 ASHNLRHLLTRYMIMY 28

>Smik_7.328 Chr7 (553278..553325) [48 bp, 16 aa] {ON}  YDR366C
          (REPEAT)
          Length = 16

 Score = 28.9 bits (63), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/16 (93%), Positives = 16/16 (100%)

Query: 8  MIVGIPLLIKAIILGM 23
          +IVGIPLLIKAIILGM
Sbjct: 1  IIVGIPLLIKAIILGM 16

>Smik_9.162 Chr9 (275247..275366,275376..275477) [222 bp, 74 aa]
          {ON}  YOL106W (REPEAT)
          Length = 74

 Score = 29.6 bits (65), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 4/74 (5%)

Query: 5  NFEMIVGIPLLIKAIILGMXXXXXXXXXXXXXXXXXXPITLSILAFQLP----LISMTAS 60
          N E+IVGI LL++AIILG                     T   +    P         +S
Sbjct: 1  NIEVIVGITLLLEAIILGKQNILEVLLNDIESTKRIGSPTYYFINPFFPAYIKFDDCFSS 60

Query: 61 HNLCHLITPYMIMY 74
           +LCHL   YMI+Y
Sbjct: 61 QSLCHLFPLYMIIY 74

>Smik_12.380 Chr12 complement(669961..670068,670072..670140) [177
          bp, 59 aa] {ON} YOL106W (REPEAT)
          Length = 59

 Score = 28.9 bits (63), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 17/23 (73%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E   NFE+IVG  LLIKAI+ G+
Sbjct: 1  EIWVNFEIIVGNSLLIKAILFGI 23

>Smik_12.508 Chr12
          (895841..895867,895871..895885,895889..895972,
          895976..896011,896018..896098) [243 bp, 81 aa] {OFF}
          YCR018C-A (PSEUDO)
          Length = 81

 Score = 28.9 bits (63), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E + NFE+IVGI LLIK    G+
Sbjct: 20 ENMVNFEIIVGISLLIKKYHFGI 42

>Skud_5.65 Chr5 (97653..97706) [54 bp, 18 aa] {ON}  YER181C
          (REPEAT)
          Length = 18

 Score = 27.3 bits (59), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%)

Query: 42 PITLSILAFQLPLISMT 58
          PI LSILA QLPL SMT
Sbjct: 1  PIALSILALQLPLNSMT 17

>Smik_3.109 Chr3 (149590..149595,149599..149676) [84 bp, 28 aa]
          {ON}  YER181C (REPEAT)
          Length = 28

 Score = 27.3 bits (59), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%)

Query: 42 PITLSILAFQLPL 54
          PITLSILAFQLPL
Sbjct: 16 PITLSILAFQLPL 28

>Smik_10.234 Chr10 (374037..374183) [147 bp, 49 aa] {ON} YOL106W
          (REPEAT)
          Length = 49

 Score = 27.7 bits (60), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 16/21 (76%)

Query: 1  ERLANFEMIVGIPLLIKAIIL 21
          E   NF +I GIPLLIKA++L
Sbjct: 2  EMWVNFGIIFGIPLLIKAVLL 22

>Smik_3.198 Chr3 (294331..294408) [78 bp, 26 aa] {ON} YDR366C
          (REPEAT)
          Length = 26

 Score = 27.3 bits (59), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E +  F++IV IP   KAIILGM
Sbjct: 4  EMMVEFDVIVEIPFFNKAIILGM 26

>Smik_5.97 Chr5 (137480..137698,137702..137758) [276 bp, 92 aa]
          {ON}  YOL106W (REPEAT)
          Length = 92

 Score = 28.1 bits (61), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 18/23 (78%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          ++  NFE+I GIP LIKAI+L +
Sbjct: 2  KKNWNFEIINGIPSLIKAILLSI 24

>Smik_15.529 Chr15 complement(925250..925360,925364..925414) [162
          bp, 54 aa] {ON}  YDR366C (REPEAT)
          Length = 54

 Score = 27.3 bits (59), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 16/17 (94%)

Query: 7  EMIVGIPLLIKAIILGM 23
          E+IVGIPLLIKAI+ G+
Sbjct: 1  EIIVGIPLLIKAILSGI 17

>Smik_27.3 Chr27 complement(1694..1864) [171 bp, 57 aa] {ON}
          YDR366C (REPEAT)
          Length = 57

 Score = 27.3 bits (59), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 16/23 (69%)

Query: 1  ERLANFEMIVGIPLLIKAIILGM 23
          E   N  +  GIPLLIKAIILG+
Sbjct: 2  ENEVNNWIFFGIPLLIKAIILGI 24

>Skud_10.212 Chr10 complement(389330..389434) [105 bp, 35 aa] {ON}
           YER181C (REPEAT)
          Length = 35

 Score = 26.6 bits (57), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/17 (82%), Positives = 14/17 (82%)

Query: 42 PITLSILAFQLPLISMT 58
          PI LSILA QLPL SMT
Sbjct: 18 PIALSILALQLPLNSMT 34

>Smik_15.181 Chr15 complement(307989..308018,308022..308138) [147
          bp, 49 aa] {ON}  YCR018C-A (REPEAT)
          Length = 49

 Score = 26.2 bits (56), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 16/21 (76%)

Query: 1  ERLANFEMIVGIPLLIKAIIL 21
          E L + E++VGIPL +K IIL
Sbjct: 2  ENLVDVEIVVGIPLSMKVIIL 22

>Smik_3.89 Chr3 (123152..123211,123215..123244,123248..123316)
          [159 bp, 53 aa] {ON}  YDR366C (REPEAT)
          Length = 53

 Score = 26.2 bits (56), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 15/19 (78%)

Query: 5  NFEMIVGIPLLIKAIILGM 23
          N E+I  IPLLIKAI+ G+
Sbjct: 2  NVEIIADIPLLIKAILFGI 20

>Smik_12.178 Chr12
          complement(355239..355298,355302..355340,
          355344..355403,355407..355430) [183 bp, 61 aa] {ON}
          YOL106W (REPEAT)
          Length = 61

 Score = 26.2 bits (56), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 17/22 (77%)

Query: 2  RLANFEMIVGIPLLIKAIILGM 23
           + +  +IVGIPLLIKAI+ G+
Sbjct: 7  EIVSLGIIVGIPLLIKAILFGI 28

>Skud_5.1 Chr5 (3..86) [84 bp, 27 aa] {ON}   (REPEAT)
          Length = 27

 Score = 25.4 bits (54), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 17/26 (65%), Gaps = 1/26 (3%)

Query: 42 PITLSILAFQLPLISMTASHNLCHLI 67
          PI LSILA QLPL  MT   NL  LI
Sbjct: 3  PIALSILALQLPLTLMTV-LNLISLI 27

>Suva_8.231 Chr8 complement(414155..414190) [36 bp, 12 aa] {ON}
          YOL106W (REPEAT)
          Length = 12

 Score = 25.0 bits (53), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 9/12 (75%), Positives = 12/12 (100%)

Query: 62 NLCHLITPYMIM 73
          NLCHL+TPY+I+
Sbjct: 1  NLCHLLTPYIIL 12

>Smik_15.237 Chr15 (404135..404176) [42 bp, 14 aa] {ON}  YOL106W
          (REPEAT)
          Length = 14

 Score = 24.6 bits (52), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (92%)

Query: 61 HNLCHLITPYMIMY 74
          H+L HL+TPYMI+Y
Sbjct: 1  HHLRHLLTPYMIIY 14

>Smik_7.66 Chr7 complement(109898..109939) [42 bp, 14 aa] {ON}
          YOL106W (REPEAT)
          Length = 14

 Score = 24.6 bits (52), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 13/14 (92%)

Query: 61 HNLCHLITPYMIMY 74
          H+L HL+TPYMI+Y
Sbjct: 1  HHLRHLLTPYMIIY 14

>Smik_8.38 Chr8 complement(69763..69825) [63 bp, 21 aa] {ON}
          YOL106W (REPEAT)
          Length = 21

 Score = 24.3 bits (51), Expect = 9.2,   Method: Composition-based stats.
 Identities = 13/17 (76%), Positives = 14/17 (82%)

Query: 1  ERLANFEMIVGIPLLIK 17
          ER  NFE+IV IPLLIK
Sbjct: 5  ERWVNFEIIVWIPLLIK 21

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.334    0.146    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,524,400
Number of extensions: 75885
Number of successful extensions: 393
Number of sequences better than 10.0: 112
Number of HSP's gapped: 384
Number of HSP's successfully gapped: 119
Length of query: 74
Length of database: 53,481,399
Length adjustment: 46
Effective length of query: 28
Effective length of database: 48,206,763
Effective search space: 1349789364
Effective search space used: 1349789364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 59 (27.3 bits)