Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2323.501ON2412417651e-102
YGR136W (LSB1)3.501ON2412416486e-85
Suva_7.4243.501ON2492495636e-72
Skud_7.4473.501ON2382415374e-68
Smik_16.4063.501ON2121154078e-49
Skud_16.4483.501ON2081154014e-48
YPR154W (PIN3)3.501ON2151163973e-47
Suva_16.4823.501ON2351163967e-47
NDAI0B059203.501ON2351153766e-44
Kpol_480.83.501ON2391293681e-42
TPHA0A057203.501ON2201223601e-41
KLTH0G02332g3.501ON2331203592e-41
SAKL0F02486g3.501ON2301153582e-41
KNAG0A079903.501ON2211193522e-40
Kwal_47.189053.501ON2361153471e-39
NCAS0F036003.501ON2371243436e-39
TDEL0D056903.501ON2011143336e-38
CAGL0F04829g3.501ON2021233311e-37
AFR320W3.501ON2571193342e-37
KAFR0G037403.501ON2341502982e-32
TBLA0C045303.501ON2221162964e-32
Ecym_12283.501ON2531082845e-30
KNAG0B007503.501ON2171122816e-30
KLLA0E03873g3.501ON2201102624e-27
ZYRO0D09702g3.501ON158572226e-22
ZYRO0G20372gsingletonON150551945e-18
TBLA0D029103.501ON2691231875e-16
Ecym_27471.356ON452801492e-10
TBLA0B054702.502ON539521483e-10
KAFR0D033602.502ON455651473e-10
NDAI0K021302.502ON459531464e-10
SAKL0E02200g2.502ON511671464e-10
KLTH0D06138g2.502ON489821465e-10
Smik_8.811.356ON468511455e-10
CAGL0K02761g2.502ON450521447e-10
TBLA0A025705.470ON493731447e-10
TPHA0C040202.502ON485571439e-10
NCAS0A089901.356ON434621421e-09
Suva_8.512.502ON456521422e-09
YHR016C (YSC84)1.356ON468791422e-09
NDAI0G059601.356ON423551412e-09
KLLA0B13475g2.502ON508671412e-09
Suva_15.1991.356ON457511393e-09
TDEL0A027802.502ON451521394e-09
Kpol_1056.372.502ON501521384e-09
Skud_8.681.356ON475511384e-09
CAGL0I08965g1.356ON437511376e-09
AFR140C5.470ON388671376e-09
Smik_8.472.502ON447521376e-09
TDEL0D022401.356ON433631367e-09
TPHA0O012801.356ON454511368e-09
SAKL0D09702g1.356ON428641359e-09
NDAI0A043505.470ON459551351e-08
YHL002W (HSE1)2.502ON452521351e-08
TPHA0A022101.356ON397511341e-08
Kwal_26.79022.502ON532581341e-08
KNAG0C020401.356ON464511341e-08
ZYRO0B01298g2.502ON411531341e-08
KAFR0C044001.356ON459631342e-08
Smik_7.3351.356ON460511342e-08
YFR024C-A (LSB3)1.356ON459511332e-08
Ecym_24402.502ON459531332e-08
NCAS0B072501.356ON441511332e-08
ABR008C2.502ON443501322e-08
TBLA0D049501.356ON468781323e-08
Kwal_0.3711.356ON217511284e-08
KLLA0A08360g1.356ON423681314e-08
Kwal_55.212875.470ON461561305e-08
KLTH0H12980g1.356ON399511296e-08
AEL017W1.356ON416501296e-08
CAGL0M01650g5.470ON466561296e-08
KNAG0A067102.502ON419791296e-08
SAKL0G03454g5.470ON468551296e-08
Skud_4.6615.470ON460561297e-08
Skud_8.432.502ON454521297e-08
NCAS0A050802.502ON450521297e-08
Kpol_1008.251.356ON449511288e-08
YDR388W (RVS167)5.470ON482561288e-08
Smik_4.6585.470ON472561288e-08
TDEL0A033405.470ON473651288e-08
TPHA0E015005.470ON457591289e-08
Skud_6.1081.356ON459511281e-07
Suva_6.961.356ON455511271e-07
KNAG0C046305.470ON516551281e-07
TBLA0F034901.356ON511511271e-07
KLTH0F15114g5.470ON435591271e-07
CAGL0A02145g1.356ON391521261e-07
NCAS0A119205.470ON463561271e-07
ZYRO0G00792g1.356ON469741252e-07
NDAI0B045801.356ON424511243e-07
KAFR0E036405.470ON441551225e-07
ZYRO0D11110g5.470ON459551226e-07
KNAG0I015801.356ON581511201e-06
KAFR0A009701.356ON396511182e-06
Kpol_440.105.470ON470591163e-06
KLLA0E03059g5.470ON428721145e-06
KLTH0E09790g2.159ON622631139e-06
Ecym_23165.470ON421621111e-05
Ecym_25266.366ON524511112e-05
ACR266W2.159ON626511092e-05
TPHA0B028902.159ON634561093e-05
Ecym_23082.591ON678561075e-05
Kpol_1072.562.159ON637521067e-05
TBLA0C055602.159ON673531058e-05
SAKL0E10780g2.159ON625551022e-04
KAFR0J026506.366ON553501013e-04
ZYRO0D17358g6.366ON668721003e-04
NCAS0D047406.366ON594611003e-04
AGR306C5.170ON923581004e-04
TBLA0F002806.366ON57651995e-04
Kwal_47.178942.159ON62161986e-04
SAKL0A00594g6.366ON63651979e-04
Kpol_325.126.366ON57050970.001
ABR082W2.591ON68356970.001
SAKL0G17600g4.335ON44159960.001
CAGL0C03597g6.366ON58053960.001
ZYRO0G10098g4.108ON139261970.001
NDAI0I002206.366ON61557960.001
KLLA0C12551g2.591ON60757940.002
Smik_8.1922.159ON63352940.002
AGL237C6.366ON57851930.002
Skud_8.1752.159ON63352930.003
Suva_2.1184.108ON1166102930.003
KLLA0E23365g8.539ON57562930.003
TPHA0H023806.366ON52850930.003
KLLA0A04983g4.108ON125160920.004
Kwal_23.64376.366ON63163920.004
TBLA0B096202.319ON94154920.004
Skud_3.1606.366ON58653910.005
NCAS0A034904.108ON123556910.005
CAGL0E02783g4.108ON120358910.005
Smik_3.1866.366ON59153910.005
TDEL0A078106.366ON55850910.005
Smik_2.1134.108ON123055910.005
YBL007C (SLA1)4.108ON124451910.005
Suva_3.1246.366ON60053900.006
TDEL0E055204.45ON158976910.006
YCR088W (ABP1)6.366ON59253900.006
Scer_YGOB_SDC25 (SDC25)4.45ON125266900.006
YHR114W (BZZ1)2.159ON63352890.008
Kwal_47.169434.335ON46057880.009
TDEL0B052202.159ON61352880.010
Smik_13.2022.591ON66362880.011
KLTH0A07348g6.366ON62651880.011
Ecym_72314.108ON114668880.013
KNAG0I027006.366ON57550870.013
KLLA0F10175g6.366ON57650870.014
KLLA0F23848g2.159ON64949860.018
Suva_15.3102.159ON63452860.022
NDAI0A033304.108ON122656860.023
Ecym_54262.159ON67262850.028
Skud_2.1044.108ON121451850.028
Ecym_11678.539ON55090840.037
Suva_2.564singletonON4340740.042
TDEL0G024902.319ON85053840.043
NCAS0A145707.419ON35554830.046
YMR032W (HOF1)2.591ON66962830.047
SAKL0H21912g4.108ON125368830.049
KLLA0E06953g7.419ON35753820.053
NDAI0B033302.319ON91953830.056
Ecym_11474.335ON42268820.057
Kpol_534.62.319ON88653830.058
Skud_12.2567.365ON40360820.061
NCAS0B060202.319ON86459820.064
Kwal_26.83232.591ON62762820.069
KNAG0C029104.108ON124454820.072
Kpol_1025.404.108ON120262820.072
KLLA0E09043g2.319ON81452810.079
Kpol_538.255.170ON70756810.081
TBLA0A006108.539ON59754810.083
Smik_12.474.45ON125165810.085
Skud_12.514.45ON125467810.087
ZYRO0A02662g2.319ON88653810.095
ZYRO0B16214g2.159ON65948800.10
Skud_13.1882.591ON66962800.10
Kwal_14.23134.45ON151789800.12
Ecym_47107.365ON39960790.12
Suva_13.2012.591ON66862800.12
AER140C4.335ON41456790.12
Ecym_42288.344ON26161790.12
SAKL0E06820g2.319ON90552800.13
SAKL0H24222g4.45ON152658800.13
TPHA0K016004.108ON113657800.13
CAGL0I02750g2.159ON61951790.14
SAKL0H10098g8.539ON55562790.14
SAKL0B11176g2.591ON63362790.14
AGR170C4.108ON112155790.15
ADL288C2.319ON92553790.16
TBLA0H011608.344ON22461770.17
Kwal_53.194498.344ON19950770.18
KNAG0A054902.319ON88253790.18
TPHA0G009302.319ON82453780.21
KNAG0H035002.159ON63452780.21
ZYRO0F13882g8.344ON28853770.23
KAFR0F007502.159ON60252770.24
YDL117W (CYK3)2.319ON88553770.25
TPHA0K006807.419ON35553760.30
YLL017WsingletonOFF10338720.31
Suva_2.337.413ON98266760.33
AEL241W8.539ON54978760.35
Smik_4.1192.319ON88753760.40
Suva_4.1292.319ON88753760.42
CAGL0E01045g8.344ON21350740.42
Skud_4.1372.319ON88753750.46
TDEL0F023804.108ON125560750.46
KNAG0J027504.45ON165273750.48
AGL286C7.419ON33054740.49
KLLA0B04862g4.335ON39761740.49
Suva_5.2397.419ON36867740.52
TBLA0D004507.413ON100554750.53
TDEL0C028107.419ON33781740.54
SAKL0H15048g8.344ON20750730.59
CAGL0C01881g7.413ON99955740.59
NDAI0J008508.344ON24554730.65
Suva_2.3268.344ON24066730.67
SAKL0F13112g7.419ON34053730.67
TBLA0C041004.108ON130261740.73
Skud_4.4208.344ON23366720.73
Ecym_71347.419ON33253720.87
KAFR0I010404.108ON120356730.91
ZYRO0B04004g7.419ON37185720.92
Suva_10.4064.45ON158763730.94
NDAI0A014707.419ON36755720.95
Kpol_1045.217.419ON358110720.96
YDR162C (NBP2)8.344ON23666711.0
KLTH0C06028g7.419ON34254721.0
TBLA0H027902.591ON58362721.0
Kwal_27.107077.419ON34354721.0
KNAG0C033907.419ON34254711.1
KLTH0D08580g2.591ON60061721.1
NCAS0D019505.170ON93956721.1
KAFR0K020007.419ON33260711.1
KLTH0E07744g4.108ON124960721.3
TDEL0B030708.539ON54185711.5
Kpol_1024.458.539ON55454711.5
Ecym_71617.469ON69750711.5
KLTH0G11682g8.344ON18750691.5
KNAG0B050005.170ON855107711.5
Kpol_1045.277.413ON88054711.6
Suva_10.584.45ON125977711.6
Kwal_27.120278.539ON49975701.7
KLTH0C06182g7.413ON102563711.7
TBLA0H035908.539ON60054701.8
KLLA0F14575g5.170ON85155701.8
CAGL0E03476g4.45ON156462702.1
KLLA0D16874g8.344ON22751692.1
Smik_5.2637.419ON36867692.4
KAFR0B058608.344ON24950682.5
NCAS0B033608.344ON23378682.5
TDEL0F046808.344ON26450682.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.232
         (241 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   299   e-102
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   254   6e-85
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   221   6e-72
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   211   4e-68
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   161   8e-49
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   159   4e-48
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   157   3e-47
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   157   7e-47
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   149   6e-44
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   146   1e-42
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   143   1e-41
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   142   2e-41
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   142   2e-41
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   140   2e-40
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   138   1e-39
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   136   6e-39
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   132   6e-38
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   132   1e-37
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   133   2e-37
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   119   2e-32
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   118   4e-32
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   114   5e-30
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   112   6e-30
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   105   4e-27
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...    90   6e-22
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    79   5e-18
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    77   5e-16
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    62   2e-10
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    62   3e-10
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    61   3e-10
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    61   4e-10
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    61   4e-10
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    61   5e-10
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    60   5e-10
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    60   7e-10
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    60   7e-10
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    60   9e-10
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    59   1e-09
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    59   2e-09
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    59   2e-09
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    59   2e-09
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    59   2e-09
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    58   3e-09
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    58   4e-09
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    58   4e-09
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    58   4e-09
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    57   6e-09
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    57   6e-09
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    57   6e-09
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    57   7e-09
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    57   8e-09
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    57   9e-09
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    57   1e-08
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    57   1e-08
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    56   1e-08
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    56   1e-08
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    56   1e-08
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    56   1e-08
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    56   2e-08
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    56   2e-08
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    56   2e-08
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    56   2e-08
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    56   2e-08
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    55   2e-08
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    55   3e-08
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    54   4e-08
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    55   4e-08
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    55   5e-08
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    54   6e-08
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    54   6e-08
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    54   6e-08
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    54   6e-08
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    54   6e-08
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    54   7e-08
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    54   7e-08
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    54   7e-08
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    54   8e-08
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    54   8e-08
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    54   8e-08
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    54   8e-08
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    54   9e-08
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    54   1e-07
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    54   1e-07
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    54   1e-07
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    54   1e-07
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    54   1e-07
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    53   1e-07
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    54   1e-07
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    53   2e-07
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    52   3e-07
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    52   5e-07
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    52   6e-07
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    51   1e-06
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    50   2e-06
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    49   3e-06
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    49   5e-06
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    48   9e-06
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    47   1e-05
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    47   2e-05
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    47   2e-05
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    47   3e-05
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    46   5e-05
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    45   7e-05
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    45   8e-05
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    44   2e-04
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    44   3e-04
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    43   3e-04
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    43   3e-04
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    43   4e-04
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    43   5e-04
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    42   6e-04
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    42   9e-04
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    42   0.001
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    42   0.001
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    42   0.001
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    42   0.001
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    42   0.001
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    42   0.001
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    41   0.002
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    41   0.002
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    40   0.002
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    40   0.003
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    40   0.003
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    40   0.003
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    40   0.003
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    40   0.004
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    40   0.004
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    40   0.004
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    40   0.005
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    40   0.005
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    40   0.005
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    40   0.005
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    40   0.005
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    40   0.005
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    40   0.005
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    39   0.006
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    40   0.006
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    39   0.006
Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp, ...    39   0.006
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    39   0.008
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    39   0.009
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    39   0.010
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    39   0.011
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    39   0.011
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    39   0.013
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    38   0.013
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    38   0.014
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    38   0.018
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    38   0.022
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    38   0.023
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    37   0.028
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    37   0.028
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    37   0.037
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    33   0.042
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    37   0.043
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    37   0.046
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    37   0.047
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    37   0.049
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    36   0.053
NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.3...    37   0.056
Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar t...    36   0.057
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    37   0.058
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    36   0.061
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    36   0.064
Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W...    36   0.069
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    36   0.072
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    36   0.072
KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {...    36   0.079
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    36   0.081
TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {O...    36   0.083
Smik_12.47 Chr12 (99536..103291) [3756 bp, 1251 aa] {ON} YLL016W...    36   0.085
Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016...    36   0.087
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    36   0.095
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    35   0.10 
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    35   0.10 
Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310...    35   0.12 
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    35   0.12 
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    35   0.12 
AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON} N...    35   0.12 
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    35   0.12 
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    35   0.13 
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    35   0.13 
TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON} Anc_4...    35   0.13 
CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {...    35   0.14 
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    35   0.14 
SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} simila...    35   0.14 
AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON...    35   0.15 
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    35   0.16 
TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.34...    34   0.17 
Kwal_53.19449 s53 (58..657) [600 bp, 199 aa] {ON} YDR162C (NBP2)...    34   0.18 
KNAG0A05490 Chr1 (812680..815328) [2649 bp, 882 aa] {ON} Anc_2.3...    35   0.18 
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    35   0.21 
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    35   0.21 
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    34   0.23 
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    34   0.24 
YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}  CYK3SH3-do...    34   0.25 
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    34   0.30 
YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essent...    32   0.31 
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    34   0.33 
AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {...    34   0.35 
Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W ...    34   0.40 
Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W ...    34   0.42 
CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar t...    33   0.42 
Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W ...    33   0.46 
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    33   0.46 
KNAG0J02750 Chr10 complement(521086..526044) [4959 bp, 1652 aa] ...    33   0.48 
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    33   0.49 
KLLA0B04862g Chr2 (442398..443591) [1194 bp, 397 aa] {ON} conser...    33   0.49 
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    33   0.52 
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    33   0.53 
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    33   0.54 
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    33   0.59 
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    33   0.59 
NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.3...    33   0.65 
Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}...    33   0.67 
SAKL0F13112g Chr6 complement(1037049..1038071) [1023 bp, 340 aa]...    33   0.67 
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    33   0.73 
Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}...    32   0.73 
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    32   0.87 
KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4....    33   0.91 
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    32   0.92 
Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] ...    33   0.94 
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    32   0.95 
Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON} (44320....    32   0.96 
YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}  N...    32   1.0  
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    32   1.0  
TBLA0H02790 Chr8 (653275..655026) [1752 bp, 583 aa] {ON} Anc_2.5...    32   1.0  
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    32   1.0  
KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.4...    32   1.1  
KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} simila...    32   1.1  
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     32   1.1  
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    32   1.1  
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    32   1.3  
TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 a...    32   1.5  
Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON} (1201...    32   1.5  
Ecym_7161 Chr7 (337456..339549) [2094 bp, 697 aa] {ON} similar t...    32   1.5  
KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly ...    31   1.5  
KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.1...    32   1.5  
Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON} (60698....    32   1.6  
Suva_10.58 Chr10 (117228..121007) [3780 bp, 1259 aa] {ON} YLL016...    32   1.6  
Kwal_27.12027 s27 complement(1054171..1055670) [1500 bp, 499 aa]...    32   1.7  
KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} simil...    32   1.7  
TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {O...    32   1.8  
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    32   1.8  
CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa] ...    32   2.1  
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    31   2.1  
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    31   2.4  
KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {...    31   2.5  
NCAS0B03360 Chr2 (587093..587794) [702 bp, 233 aa] {ON} Anc_8.34...    31   2.5  
TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON...    31   2.6  
Skud_2.326 Chr2 (588715..590376) [1662 bp, 553 aa] {ON} YBR200W ...    31   2.8  
Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}...    30   3.0  
CAGL0G03597g Chr7 complement(348369..349430) [1062 bp, 353 aa] {...    31   3.1  
KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.34...    31   3.1  
NCAS0C05710 Chr3 complement(1170253..1175283) [5031 bp, 1676 aa]...    31   3.2  
Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON} c...    30   3.5  
Suva_4.454 Chr4 (790985..792643) [1659 bp, 552 aa] {ON} YBR200W ...    30   4.0  
Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER11...    30   4.4  
ZYRO0B03850g Chr2 complement(320570..323839) [3270 bp, 1089 aa] ...    30   4.9  
YBR200W Chr2 (620872..622527) [1656 bp, 551 aa] {ON}  BEM1Protei...    30   5.2  
KAFR0E03160 Chr5 complement(632974..634638) [1665 bp, 554 aa] {O...    30   5.3  
SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa...    30   5.3  
TBLA0B09350 Chr2 complement(2219202..2221046) [1845 bp, 614 aa] ...    30   5.4  
Smik_2.340 Chr2 (607460..609136) [1677 bp, 558 aa] {ON} YBR200W ...    30   5.4  
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    30   5.6  
Kwal_33.15339 s33 complement(1065599..1069153) [3555 bp, 1184 aa...    30   5.7  
KLTH0E12518g Chr5 complement(1109548..1111197,1111361..1111369) ...    30   5.8  
Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar ...    30   5.8  
KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {...    30   5.9  
NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539     30   6.1  
TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON} Anc_7...    30   6.2  
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    30   7.0  
ZYRO0D04004g Chr4 (327544..327552,327618..329327) [1719 bp, 572 ...    30   7.5  
KAFR0A05500 Chr1 complement(1094398..1097571) [3174 bp, 1057 aa]...    30   8.8  
YFR038W Chr6 (229380..231941) [2562 bp, 853 aa] {ON}  IRC5Putati...    29   9.6  
Skud_5.261 Chr5 (422454..423572) [1119 bp, 372 aa] {ON} YER118C ...    29   9.7  

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  299 bits (765), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 162/241 (67%), Positives = 162/241 (67%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA 60
           MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA 60

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTKPE 120
           LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTKPE
Sbjct: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTKPE 120

Query: 121 EGDLXXXXXXXXXXXXXXXXXXXQYPPQQTPASYAPPLGYMXXXXXXXXXXXXXXXXSFT 180
           EGDL                   QYPPQQTPASYAPPLGYM                SFT
Sbjct: 121 EGDLSSKVSRPSVPPPSYEPAVSQYPPQQTPASYAPPLGYMQAPPPQQQQAPLPFPPSFT 180

Query: 181 NYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKSFGSKLXXXXXXXXXXXXXXDIVNSI 240
           NY                              FKSFGSKL              DIVNSI
Sbjct: 181 NYYQQPQQQYVPPPQQAQVEAQPQQSSAASSAFKSFGSKLGNAAIFGAGSAIGSDIVNSI 240

Query: 241 F 241
           F
Sbjct: 241 F 241

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  254 bits (648), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 137/241 (56%), Positives = 145/241 (60%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA 60
           MSA+LVNRSLKNIRNELEFL+ESNVISGDIF+LINSKLPEKW+ N RSP NADTEEYVEA
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEA 60

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTKPE 120
           LYDFEAQQDGDLSLKTGDKIQVLEKISPDWY+GK+NN++GIFPANYVKPAFTRS   K  
Sbjct: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTRSASPKSA 120

Query: 121 EGDLXXXXXXXXXXXXXXXXXXXQYPPQQTPASYAPPLGYMXXXXXXXXXXXXXXXXSFT 180
           E                      QYP QQ  A YAPP GYM                 FT
Sbjct: 121 EAASSSTVSRPSVPPPSYEPAASQYPSQQVSAPYAPPAGYMQAPPPQQQQAPLPYPPPFT 180

Query: 181 NYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKSFGSKLXXXXXXXXXXXXXXDIVNSI 240
           NY                              FKSFGSKL              DIVNSI
Sbjct: 181 NYYQQPQQQYAPPSQQAPVEAQPQQSSGASSAFKSFGSKLGNAAIFGAGSAIGSDIVNSI 240

Query: 241 F 241
           F
Sbjct: 241 F 241

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  221 bits (563), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 125/249 (50%), Positives = 139/249 (55%), Gaps = 8/249 (3%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA 60
           MSA+L+NRSLKNIRNEL+FL+ES VIS DIF+LINSKLPEKW+ N R   NA  EE+VEA
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWDVNLRPVPNASVEEFVEA 60

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTKPE 120
           LYDFE QQ+GDL LKTGDKIQ+LEKISPDWY+GKANNRVGIFPANYVKPAF RS   + E
Sbjct: 61  LYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPAFARSASPENE 120

Query: 121 EGDLXXXXXXXXXXXXXXXXXXXQYPPQQTPASYAPPLGYMXXXXXXXXXXXXXXXXSFT 180
              L                   QYP QQ PA YAP +GY+                SFT
Sbjct: 121 GASLSSKVSRPSAPPPSYEPVVSQYPSQQAPAPYAPSMGYVQAPPPQQQQAPLPFPPSFT 180

Query: 181 NY--------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKSFGSKLXXXXXXXXXXXX 232
           NY                                      FKSFGSKL            
Sbjct: 181 NYYQQPQQQYAPPPPAPVQPQQPQQPQQPQQQQSSGASSAFKSFGSKLGNAAIFGAGSTI 240

Query: 233 XXDIVNSIF 241
             DIV+SIF
Sbjct: 241 GSDIVHSIF 249

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  211 bits (537), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 138/241 (57%), Gaps = 3/241 (1%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA 60
           MSA+L+NRSL NIRNELEFL+ESNVISG++F  I+S LP KW++N++S NNA TEEYVEA
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENSKSANNASTEEYVEA 60

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTKPE 120
           LYDFEAQQDGDLSLKTGDKIQ+LEKIS DWYKGKAN+ +GIFPANYVKPAFTRS     E
Sbjct: 61  LYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFTRSTSPDFE 120

Query: 121 EGDLXXXXXXXXXXXXXXXXXXXQYPPQQTPASYAPPLGYMXXXXXXXXXXXXXXXXSFT 180
           +  L                   +Y  QQ  A   PPLGY+                SFT
Sbjct: 121 KTPLSSRVSRPSVPPPSYEPAVPEYSSQQVSAPNVPPLGYVQAPPLQQNQAPLPYPPSFT 180

Query: 181 NYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKSFGSKLXXXXXXXXXXXXXXDIVNSI 240
           N                               FKSFGSKL              DI+NSI
Sbjct: 181 N---YYQQPQQQYAPAPQQAQPQQQSSSASSAFKSFGSKLGDAAIFGAGSTIGSDIINSI 237

Query: 241 F 241
           F
Sbjct: 238 F 238

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  161 bits (407), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 77/115 (66%), Positives = 91/115 (79%), Gaps = 1/115 (0%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTE-EYVE 59
           MSA+L+NRSL NIR EL+FL+ESNVIS D+FD IN  LP +W+  + S N + T  EYVE
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRS 114
           ALY F+ QQDGDL LK GDKIQ+LEK+SP+WYKG  N R GIFPANYVKPAF+ S
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGS 115

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  159 bits (401), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 91/115 (79%), Gaps = 1/115 (0%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTE-EYVE 59
           MSA+L+NRSL  IR EL+FL+ESNVIS D+FD IN  LP +WN ++ + + +    EYVE
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRS 114
           ALY F+ QQDGDL LK GDK+Q+LEK+SP+WYKG  N RVGIFPANYVKPAF+ S
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGS 115

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  157 bits (397), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 76/116 (65%), Positives = 90/116 (77%), Gaps = 3/116 (2%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNAD--TEEYV 58
           MSA+L+NRSL NIR EL+FL+ SNVIS D++D IN  LP KW D   +P NA   + EYV
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKW-DPANAPRNASPASLEYV 59

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRS 114
           EALY F+ QQDGDL LK GDK+Q+LEK+SP+WYKG  N R GIFPANYVKPAF+ S
Sbjct: 60  EALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGS 115

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  157 bits (396), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 76/116 (65%), Positives = 92/116 (79%), Gaps = 3/116 (2%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSP--NNADTEEYV 58
           MSA+LVNRSL NIR EL+FL+ESNVIS D+FD IN  LP KW D + +P  +N+ + EYV
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKW-DPSSAPRGSNSASLEYV 77

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRS 114
           EA+Y F+ QQDGDL LK GDK+Q+LEK+SP+WYKG  N R GIFPANYVKP F+ S
Sbjct: 78  EAVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSDS 133

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  149 bits (376), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 70/115 (60%), Positives = 93/115 (80%), Gaps = 3/115 (2%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRS---PNNADTEEY 57
           MSA+L+NRSL NIR EL+FL+ESNVIS + F+ IN++LP++++ N       + A T EY
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFT 112
           VEA+Y FE QQ+GDL+LK GDKIQV+EK SP+W+KGK N +VGIFP+NYV+PAF+
Sbjct: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFS 115

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  146 bits (368), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 73/129 (56%), Positives = 97/129 (75%), Gaps = 10/129 (7%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRS---PNNADTEEY 57
           MS+  +NRSL +++ ELEFLR+SNVISG+ FD IN+ LP++ + +  S    N++   EY
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESLATNNSSPNLEY 60

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAF------ 111
           VEA+Y F+ QQDGDL+++ GDKIQVLEKISP+WYKGK N +VG+FP+NYVKPAF      
Sbjct: 61  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPAFSGGSNE 120

Query: 112 -TRSVLTKP 119
            +RS LT P
Sbjct: 121 KSRSHLTSP 129

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  143 bits (360), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 89/122 (72%), Gaps = 7/122 (5%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWN-DNTRSPNNADTE---- 55
           MS +L+NRSL  IR ELEFL+ES VIS  +F  INS LPE+++  N  S  +A T     
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 56  --EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTR 113
             EYVEA+Y F+ QQDGDL+++ GDKIQVLEKISP+WYKG  N +VG+FP+NY KPAF+ 
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120

Query: 114 SV 115
           S 
Sbjct: 121 ST 122

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  142 bits (359), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 69/120 (57%), Positives = 93/120 (77%), Gaps = 3/120 (2%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPN--NADTEEYV 58
           MSA+ +NRSL  +R ELEFLRES+VI+ + +  I S LPE++ D +R P   +A   E+V
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERY-DPSRGPQQPSATQGEFV 59

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTK 118
           EA+Y F+AQQDGDL+L+ GDK++VLEK SP+W+KGK N RVG+FP+NYVKPAF+ S  T+
Sbjct: 60  EAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPAFSGSTTTE 119

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  142 bits (358), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 89/115 (77%), Gaps = 1/115 (0%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNAD-TEEYVE 59
           MSA+L+NRSL  IR EL+FLRES VIS + F  I++ LP++++ N     ++  + EYVE
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRS 114
           A+Y F+AQQDGDL+LK GDKIQVLEK S +WYKGK N  VG+FP+NYVKPAF+ S
Sbjct: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGS 115

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  140 bits (352), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 69/119 (57%), Positives = 90/119 (75%), Gaps = 7/119 (5%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDN----TRSPNNADTE- 55
           MSA+L+NRSL N+R EL+FLRES VIS + F+ I   LP+K++ N     RS +++++  
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 56  --EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFT 112
             EYVEALY F+ QQDGDL L+ GDKIQVLEK S +WYKGK   +VG+FP+NYVKPAF+
Sbjct: 61  KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPAFS 119

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  138 bits (347), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 87/115 (75%), Gaps = 1/115 (0%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTE-EYVE 59
           MSA+ +NRSL  +R ELEFLRESNVI+   +  I   LPE++     +P    ++ E+VE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRS 114
           A+Y F+AQQDGDL+L+ GDKI+VLEK SP+WYKG+ N RVG+FP+NYVKPAF+ S
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGS 115

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  136 bits (343), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 69/124 (55%), Positives = 91/124 (73%), Gaps = 10/124 (8%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWN-DNTRSP-----NNADT 54
           MSA+ +NRSL  IR EL+FL+ESNVIS + FD I S LP K++ D +R+P     NN   
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 55  E----EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPA 110
           +    E+VEA+Y FE QQ GDL+LK GDKI+V+EK SP+W+KG+ N + G+FP+NYVKPA
Sbjct: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120

Query: 111 FTRS 114
           F+ S
Sbjct: 121 FSGS 124

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  132 bits (333), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 84/114 (73%), Gaps = 8/114 (7%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA 60
           MSA+ +NRSL  +R EL+FLRESNVIS +I+D++N  LP+  ++           EY+EA
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNASNKG--------GEYMEA 52

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRS 114
           LY F+ QQDGDL+L  GDKI+VLEK S +W+KG+ N RVG+FPANYVK A++ S
Sbjct: 53  LYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGS 106

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  132 bits (331), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 81/123 (65%), Gaps = 3/123 (2%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA 60
           MS + +NRSL NIRNEL+FLRESNVIS   F  I  KLP         P    + EYVEA
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPPPM---SLEYVEA 57

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTKPE 120
           LYDF+ QQDGDL+++ GDKIQVLEK S +WY+G  N R G+FP+NYV+PA   S    P 
Sbjct: 58  LYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPAAAPSANLAPP 117

Query: 121 EGD 123
             D
Sbjct: 118 AYD 120

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  133 bits (334), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 82/119 (68%), Gaps = 1/119 (0%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSP-NNADTEEYVE 59
           MS+TL+NRSL  IR EL FL +S VI+    + I S LP        +P NNA   EYVE
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTK 118
           ALY F+AQQ GDL  K G+KI+VLEK SP+WYKG+ N +VG+FP+NYVKPAF+   L K
Sbjct: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLMK 119

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  119 bits (298), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 86/150 (57%), Gaps = 29/150 (19%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTR------------- 47
           MS+ L+NR++ NI+ EL+FLRES +I+    D I  +LPEK++ +++             
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 48  ----------------SPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY 91
                           +P  A+  EYVEALY FE QQ+GDL L  GDK+Q+LEK S +WY
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 92  KGKANNRVGIFPANYVKPAFTRSVLTKPEE 121
           KG  N ++G+FPANYVKP    S    P +
Sbjct: 121 KGTCNGQIGMFPANYVKPVTKDSFAPPPPQ 150

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  118 bits (296), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 81/116 (69%), Gaps = 2/116 (1%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWND--NTRSPNNADTEEYV 58
           MS++L+N+SL  I  EL+FL +SN I    +  I+  LP +  +  + +  N++  EE+V
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRS 114
           EA+Y F+ QQDGDL L  GDKI V EK SP+W+KGK N +VG+FP+NYV+PAF+ S
Sbjct: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGS 116

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  114 bits (284), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 73/108 (67%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA 60
           MS++L+NRSL NI+ ELEFL ESNVIS      I S L        ++ +    +EYVEA
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSMLSNPREGTMKAASQQVLKEYVEA 60

Query: 61  LYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVK 108
           LY F  QQ GDL  K GDKI+VLEK S DWYKG+ N RVG+FP+NYVK
Sbjct: 61  LYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  112 bits (281), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 74/112 (66%), Gaps = 4/112 (3%)

Query: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWND----NTRSPNNADTEE 56
           MS   VNRS+ NIR ELE+L ES VIS D FD  N KLP+ W+          +     E
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVK 108
           YVEA++ ++ Q+  DL L+ GDK+++LEK+S DWY+GK   +VG+FP+NYVK
Sbjct: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVK 112

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  105 bits (262), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 71/110 (64%)

Query: 6   VNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEALYDFE 65
           V  S+  I++EL++L+E   ++   +  I S LP        +       E VEALY F+
Sbjct: 4   VEESVATIKSELKYLKEQGALAELAYKDIESLLPRVRPQPPVADTMGQNNEIVEALYAFQ 63

Query: 66  AQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSV 115
            QQDGDL+LK GDKI++LEK+SP+WYKGK N +VG+FP+NYVK   T+ V
Sbjct: 64  PQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVKSVDTKDV 113

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score = 90.1 bits (222), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 37/57 (64%), Positives = 50/57 (87%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFT 112
           E+VEA+Y F+ QQ+GDL+L  GDKI+VLEK SP+W++G+ N RVG+FP+NYVKPAF+
Sbjct: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFS 60

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 79.3 bits (194), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 34/55 (61%), Positives = 43/55 (78%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPA 110
           EYVE LY+F+ Q   DL +K GDK++V+EK+S DWYKGK N + G+FPANYVKP 
Sbjct: 15  EYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVKPV 69

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 76.6 bits (187), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 69/123 (56%), Gaps = 17/123 (13%)

Query: 1   MSATLVNRSLKN----IRNELEFLRESNVISGDIFDLINSKLPEK--------WNDNTR- 47
           MSA     ++K+    IR  LE L ++  IS + +D I   L  K        +++ T+ 
Sbjct: 1   MSADRREAAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKG 60

Query: 48  --SPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPAN 105
             SP N    +YVEA+Y +  +Q GDL L  GD I+V+ K SP WY+G+ N +VG+FP N
Sbjct: 61  ALSPRNG--PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTN 118

Query: 106 YVK 108
           YVK
Sbjct: 119 YVK 121

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 50/80 (62%), Gaps = 3/80 (3%)

Query: 31  FDLINSKLPEKWNDNTRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP-- 88
           F L+N+      + + R   ++ T + V ALY F+ +QDGDL  +TGD I +L+K +   
Sbjct: 372 FGLLNTGSKGSHSASIRDRPSSGTPKAV-ALYTFKGEQDGDLPFRTGDVIAILKKSNSQD 430

Query: 89  DWYKGKANNRVGIFPANYVK 108
           DW+ G+ N + GIFPANYV+
Sbjct: 431 DWWTGRVNGQEGIFPANYVE 450

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKP 109
           V A+YD  A + G+LS K GD I+V+E++  DW++G     VGIFP NYV P
Sbjct: 245 VRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYVNP 296

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%)

Query: 47  RSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANY 106
           + P+ +   + V A+YDF + +  +LS K GD I VLE++  DW++G    R+GIFP NY
Sbjct: 205 QQPSTSAGVKKVRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNY 264

Query: 107 VKPAF 111
           V P  
Sbjct: 265 VTPIM 269

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 33/53 (62%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPA 110
           V ALYD       +LS K GD I VLE++  DW+KGK  ++ GIFP NYV P 
Sbjct: 233 VRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTPV 285

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 6/67 (8%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLT 117
           V A+YD  A +  +LS K GD I V+E++  DW++G    RVGIFP NYV P      +T
Sbjct: 233 VRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYVTP------IT 286

Query: 118 KPEEGDL 124
           +P + +L
Sbjct: 287 EPTKEEL 293

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 2/82 (2%)

Query: 33  LINSKLPEKWNDNTRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYK 92
           + N K  E  + N     N  T   V AL+D   ++  +LS + GD I V+E++  DW++
Sbjct: 194 VANQKHIESSHHNESQTQN--TVRKVRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWR 251

Query: 93  GKANNRVGIFPANYVKPAFTRS 114
           G+   RVGIFP NYV P   ++
Sbjct: 252 GRLRGRVGIFPLNYVTPVAEKT 273

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 60.5 bits (145), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY+F  +Q GDL+ K GD I +L+K     DW+ G+AN + GIFPANYV+
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 60.1 bits (144), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKP 109
           V ALYD  A +  +LS + GD I VLE++  DW++G  + ++GIFP NYV P
Sbjct: 217 VRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTP 268

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 60.1 bits (144), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (61%), Gaps = 2/73 (2%)

Query: 38  LPEKWNDNTRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKA 95
           +P  +   T  P +A   E V ALY+++AQ +GDLS   G  I+++++ +   +W+ GK 
Sbjct: 417 VPPSYTSATGVPQSAPAFETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKY 476

Query: 96  NNRVGIFPANYVK 108
           N + G+FP NYVK
Sbjct: 477 NGQQGVFPGNYVK 489

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (66%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRS 114
           V A+Y+  +Q++ +LS + GD I VLE++  DW++G  + ++GIFP NYV P    S
Sbjct: 234 VRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVTPIIELS 290

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 37/62 (59%), Gaps = 2/62 (3%)

Query: 49  PNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANY 106
           P +        ALY F  +Q GDLS + GDKI +L++     DW+ G+ N + GIFPANY
Sbjct: 371 PTSGHASNEAVALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANY 430

Query: 107 VK 108
           V+
Sbjct: 431 VE 432

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKP 109
           V A+YD    +  +LS + GD I VLE++  DW+KG    R+GIFP NYV P
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYVTP 277

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 3/79 (3%)

Query: 32  DLINSKLPEKWNDNTRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--D 89
           D ++ K+ +    N  +  N+ T   V ALY+F  +Q GDL+ K GD I +L+K     D
Sbjct: 389 DDLSHKMSKTGLGNESTATNSATPTAV-ALYNFAGEQPGDLAFKKGDVITILKKSDSQND 447

Query: 90  WYKGKANNRVGIFPANYVK 108
           W+ G+ N + GIFPANYV+
Sbjct: 448 WWTGRTNGKEGIFPANYVR 466

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           E V ALY F  +Q GDL+ K GD I V++K     DW+ GK  N+ GIFPANYV+
Sbjct: 367 EKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYVE 421

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%), Gaps = 6/67 (8%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLT 117
           V A+YDF + +  +LS K GD I V+E++  DW++G     VGIFP NYV P      +T
Sbjct: 227 VRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTP------VT 280

Query: 118 KPEEGDL 124
           +P + +L
Sbjct: 281 EPSQQEL 287

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY+F  +Q GDL+ K GD I +L+K     DW+ G+ N + GIFPANYV+
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKP 109
           V A+YD  +++  +LS + GD I VLE++  DW++G    +VGIFP NYV P
Sbjct: 228 VRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNYVTP 279

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKP 109
           V A+YD  + +  +LS K GD I VLE++  DW+KG     +GIFP NYV P
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTP 291

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY+F  +Q GDL+ K GD I +L+K     DW+ G+ N + GIFPANYV+
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY F  ++ GDLS + GD I +++K     DW+ GK N R GIFPANYV+
Sbjct: 385 ALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPANYVE 435

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 42  WNDNTRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKI-SPDWYKGKANNRVG 100
           +  ++ SP      E   ALYDF AQ DGDLS      I++L++  +  W+ G+ N R G
Sbjct: 318 YGSSSASPATTAAPETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREG 377

Query: 101 IFPANYV 107
           +FPANYV
Sbjct: 378 LFPANYV 384

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKP 109
           V ALYD    +  +LS + GD I VLE++  DW+KG    ++GIFP NYV P
Sbjct: 217 VRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 268

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 3/63 (4%)

Query: 48  SPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPAN 105
           SP++++  + V ALY F  ++ GDL  + GD I +L+K     DW+ G+ N R GIFPAN
Sbjct: 370 SPSSSNAPKAV-ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPAN 428

Query: 106 YVK 108
           YV+
Sbjct: 429 YVE 431

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY F  ++ GDLS K GD I +L+K     DW+ G+ N + GIFPANYV+
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVE 452

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%), Gaps = 3/64 (4%)

Query: 47  RSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPA 104
           RSP ++   + V ALY F+ +Q GDL  + GD + +L+K     DW+ G+ N + GIFPA
Sbjct: 364 RSPASSGAPKAV-ALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGIFPA 422

Query: 105 NYVK 108
           NYV+
Sbjct: 423 NYVE 426

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           E V ALYD++AQ  GDLS   G  I+++E+ S   +W+ GK N + G+FP NYV+
Sbjct: 401 ETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPGNYVQ 455

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (61%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKP 109
           V ALYD    +  +LS + GD I VLE++  DW+KG     +GIFP NYV P
Sbjct: 222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           AL+ F+ +Q GDLS   GD + +L+K     DW+ G+ NN+ GIFPANYV+
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVE 395

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 37/58 (63%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSV 115
           V AL+D   +   +LS + GD I+V+E++  DW++G    ++GIFP NYV P   +++
Sbjct: 229 VRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYVTPVTDKTL 286

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY F  ++ GDL  + GD I VL+K     DW+ G+ N R GIFPANYV+
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYVE 462

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPA 110
           V+ALYD  + +  +L+ K GD I VLE++  DW++G     +GIFP NYV P 
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPV 284

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 48  SPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPAN 105
           +P+++       ALY F  ++ GDL  + GD I +L+K     DW+ G+ N R GIFPAN
Sbjct: 395 APSSSSNAPKAVALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPAN 454

Query: 106 YVK 108
           YV+
Sbjct: 455 YVE 457

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY F  ++ GDL  + GD I +L+K     DW+ G+ N R GIFPANYV+
Sbjct: 408 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 458

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY F  ++ GDL  + GD I +L+K     DW+ G+ N R GIFPANYV+
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 457

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPA 110
           V A+Y   A +  +LS   GD I V+E++  DW++G    +VGIFP NYV P 
Sbjct: 231 VRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYVTPC 283

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY F  ++ GDL  + GD I +L+K     DW+ G+ N R GIFPANYV+
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 439

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYV 107
           V+A++D  A +  +LS K GD I V+E++  DW++G    +VGIFP NYV
Sbjct: 215 VKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYV 264

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 4/78 (5%)

Query: 33  LINSKLPEKWNDNTRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DW 90
           L NSKL      + R  NN        ALY F+ ++ GDLS + GD I +++K     DW
Sbjct: 391 LTNSKLSNTSTLSQRQTNN--NLPKAVALYTFDGEERGDLSFRKGDIIVIIKKSESQDDW 448

Query: 91  YKGKANNRVGIFPANYVK 108
           + G+ N   GIFPANYV+
Sbjct: 449 WSGRCNGEEGIFPANYVE 466

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY F  +Q GDL  + GD I +L+K     DW+ G+ N + GIFPANYV+
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 215

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 2/68 (2%)

Query: 43  NDNTRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVG 100
           N +  SP          ALY F+ ++ GDL  + GD I +++K     DW+ G+ N + G
Sbjct: 354 NSSANSPARNSGAPKAVALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEG 413

Query: 101 IFPANYVK 108
           IFPANYV+
Sbjct: 414 IFPANYVE 421

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD---WYKGKANNRVGIFPANYVK 108
           E V ALYD++AQ +GDL+   G  I+V+E+ +PD   W+ G+ N   G+FP NYV+
Sbjct: 404 ETVTALYDYQAQAEGDLTFPAGAIIEVVER-TPDVNGWWTGRYNGYQGVFPGNYVQ 458

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY F+ +Q GDL  + GD I +L+K     DW+ G+ N + GIFPANYV+
Sbjct: 347 ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 397

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYV 107
           ALY F+ +Q GDL  + GD I +L++     DW+ G+ N + GIFPANYV
Sbjct: 364 ALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRINGQEGIFPANYV 413

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD---WYKGKANNRVGIFPANYVK 108
           E V ALYD++AQ  GDLS   G  I+V+++ +PD   W+ G+ N + G+FP NYV+
Sbjct: 410 ETVTALYDYQAQAAGDLSFPAGAVIEVVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 464

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 41/79 (51%)

Query: 46  TRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPAN 105
           T+     +T + V A+YD E     +L+ +  D I V+E+   DW+ G    RVGIFP N
Sbjct: 207 TKRETGTNTIKKVRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIFPLN 266

Query: 106 YVKPAFTRSVLTKPEEGDL 124
           YV P    +   K +E DL
Sbjct: 267 YVTPIIELTPEQKQKELDL 285

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           E V ALYD++AQ +GDL+   G  I+V+E+ +    W+ G+ N + G+FP NYV+
Sbjct: 410 ETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD---WYKGKANNRVGIFPANYVK 108
           E V ALYD++AQ  GDLS   G  I+++++ +PD   W+ G+ N + G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQR-TPDANEWWTGRYNGQQGVFPGNYVQ 456

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (61%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKP 109
           V ALYD    +  +LS +  D I VLE++  DW+KG    ++GIFP NYV P
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 276

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (59%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKP 109
           V ALYD  + +  +LS   GD I VLE++  DW++G      GIFP NYV P
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTP 271

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY F  ++ GDL  K GD I +L+K     DW+ G+ N   GIFPANYV+
Sbjct: 397 ALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSEGIFPANYVE 447

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD---WYKGKANNRVGIFPANYVK 108
           E V ALYD++AQ  GDLS   G  I+++++ +PD   W+ G+ N + G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 478

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD---WYKGKANNRVGIFPANYVK 108
           E V ALYD++AQ  GDLS   G  I+++++ +PD   W+ G+ N + G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 468

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 5/65 (7%)

Query: 46  TRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFP 103
           T +P  A+T   V ALYD++AQ  GDLS   G  I+V+++     +W+ G+ N + G+FP
Sbjct: 408 TTAPPAANT---VTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFP 464

Query: 104 ANYVK 108
            NYV+
Sbjct: 465 GNYVQ 469

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 52  ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           A   EY  +LY+++AQ  GDLS   G  IQ++++ +   DW+ G  N + G+FP NYV+
Sbjct: 396 AQAGEYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYVQ 454

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY F  ++ GDL  + GD I +L+K     DW+ G+ + R GIFPANYV+
Sbjct: 407 ALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYVE 457

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           AL+ F  ++ GDL  + GD + +L+K     DW+ G+ N R GIFPANYV+
Sbjct: 403 ALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFPANYVE 453

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           E V ALYD++AQ  GDLS   G  I+++++ +   +W+ G+ N + G+FP NYV+
Sbjct: 459 ETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQGVFPGNYVQ 513

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY F  ++ GDLS + GD I +++K     DW+ G+ + R GIFPANYV+
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYVE 509

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 52  ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKI--SPDWYKGKANNRVGIFPANYVK 108
           A   E V ALYD++AQ +GDL+   G  I+V+E+   +  W+ G+ N   G+FP NYV+
Sbjct: 374 ASAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGYQGVFPGNYVQ 432

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYV 107
           V ALYDF  QQ GDLS K  D I V +K     DW+ G A+   G+FPANYV
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD---WYKGKANNRVGIFPANYVK 108
           E V ALY+++AQ  GDLS   G  I+++E+ +PD   W+ G+ N + G+FP NYV+
Sbjct: 405 ETVTALYEYQAQAAGDLSFPAGAVIEIVER-TPDVNEWWTGRYNGQQGVFPGNYVQ 459

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 40  EKWNDNTRSPNNADT---EEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGK 94
           EK      SP+  DT        ALY F  ++ GDL  + GD I +L+K     DW+ G+
Sbjct: 394 EKAEFGAASPSAGDTFSNTPKAVALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGR 453

Query: 95  ANNRVGIFPANYVK 108
              R GIFPANYV+
Sbjct: 454 VGGREGIFPANYVE 467

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY F  ++  DL  + GD I +L+K     DW+ G+ N R GIFPANYV+
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKIS--PDWYKGKANNRVGIFPANYVK 108
           E V ALY+++AQ  GDLS   G  I+++++ +   +W+ G+ N + G+FP NYV+
Sbjct: 384 ETVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKI--SPDWYKGKANNRVGIFPANYVK 108
           E V ALYD++AQ  GDLS      I+++++   + +W+ G+ + +VG+FP NYV+
Sbjct: 401 ETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           AL+DF   + GDL+ K GD I ++++     DW+ G+ N R G+FPANYV+
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVE 579

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           ALY+F  +++GDL  K GD I ++++     DW+ G  N + G+FPANYV+
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVE 394

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 52  ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISP--DWYKGKANNRVGIFPANYVK 108
           A   E   +LY+++AQ  GDLS   G  I+++E+ +   +W+ G+ N + G+FP NYV+
Sbjct: 409 APQAETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYVQ 467

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 38  LPEKWNDNTRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKI-SPDWYKGKAN 96
           +P      + +P  +   E   ALYD+ AQ +GDL+   G  IQV+++  +  W+ G  N
Sbjct: 353 VPTTATQASYTPPTSAGVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYN 412

Query: 97  NRVGIFPANYVK 108
              G+FP NYV+
Sbjct: 413 GVQGVFPGNYVE 424

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 47  RSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEK-ISPDWYKGKANNRVGIFPAN 105
           +S N A T   V+AL+D+EAQ D ++S++ GD I VL+      W  G+ N + G+FP N
Sbjct: 563 KSGNAART---VKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGLFPTN 619

Query: 106 YVK 108
           Y +
Sbjct: 620 YCQ 622

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 48  SPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKI-SPDWYKGKANNRVGIFPANY 106
           +P+ A   E   +LY F AQ   DL+      I++L++  S  W+ G+ N + G+FP NY
Sbjct: 356 TPSTAPAPETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRYNGQEGLFPGNY 415

Query: 107 VK 108
           V+
Sbjct: 416 VR 417

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYVK 108
           A YD+EA +D +L+ K GD+I  +E +  DW+ G  K     G+FP+NYVK
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPD-WYKGKANNRVGIFPANYV 107
           V A+YD+ AQ D ++S++ GD I+VL   + + W  G+ N   G+FP+NY 
Sbjct: 575 VTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNYC 625

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 54  TEEYVEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYKGKANNRVGIFPANYVK 108
           T   V+ALYD+EAQ D ++S+  GD I V++      W  G+ N   G+FP++Y K
Sbjct: 579 TTRKVQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLFPSSYCK 634

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 57  YVEALYDFEAQQDGD-LSLKTGDKIQVLEKISPDWYKGKANN---RVGIFPANYVK 108
           Y +ALY F    + D L+ + GD + + EK++ DWY G+ +N   R G+ P NYVK
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYKGKANNRVGIFPANYVK 108
           VEA+YD+EA  D +LS+  G+ I+V+       W  G++N   G+FP++Y K
Sbjct: 586 VEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 7/53 (13%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPD----WYKGKANNRVGIFPANYVK 108
           ALY +EAQ D ++SL  GD I+V   I PD    W  G+ NN+  +FP +Y K
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKV---IKPDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 5/73 (6%)

Query: 41  KWNDNTRSPNNA--DTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEK-ISPDWYK--GKA 95
           K N +T S NN    T    + LY +    D ++S+  GD I V+EK     W K    +
Sbjct: 518 KSNISTLSANNKMYSTANSSKVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHS 577

Query: 96  NNRVGIFPANYVK 108
              +G+ P++Y++
Sbjct: 578 TGEIGLVPSSYLE 590

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 7/55 (12%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPD----WYKGKANNRVGIFPANYVK 108
           +EALYD++AQ D +LS+  G  ++VL+   PD    W  G+ +   G+FP +Y K
Sbjct: 574 IEALYDYQAQGDDELSIYAGSVVKVLK---PDDGSGWTYGELDGAKGLFPTSYCK 625

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYV 107
           A YD+EA +D +L+ +  DKI  +E +  DW+ G  + N   G+FP+NYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 38  LPEKWNDNTRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--A 95
           LP +  +N     N  +     A YD++A +D +L+ +  DKI  +E +  DW+ G+  +
Sbjct: 593 LPARHVENENESGNTSSNPSAIAEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGS 652

Query: 96  NNRVGIFPANYV 107
               G+FP+NYV
Sbjct: 653 TGEKGLFPSNYV 664

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 49  PNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANY 106
           P     E +  A YD+EA +D +L+    DKI  +E +  DW+ G  +++   G+FP+NY
Sbjct: 530 PEKKKEEPWAIAEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGEKGLFPSNY 589

Query: 107 V 107
           V
Sbjct: 590 V 590

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY-----KGKANNRVGIFPANYVKPA 110
           V A Y +E+  DGDL+ + G +I+V+      WY      G  N + GIFP NYV+ A
Sbjct: 13  VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVA 70

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYVK 108
           A YD+EA +D +L+    DKI  +E +  DW+ G  +++   G+FP+NYV+
Sbjct: 523 AQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELESSGEKGLFPSNYVE 573

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 49  PNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEK-ISPDWYKGKANNRVGIFPANYV 107
           P        VEA+Y ++AQ + + SL  GD I VL+      W  G+ N   G+FP +Y 
Sbjct: 561 PRKGGATRTVEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTSYC 620

Query: 108 K 108
           K
Sbjct: 621 K 621

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYVK 108
           A YD+EA ++ +L+   GDKI  +E +  DW+ G  +     G+FP+NYV+
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVE 633

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYV 107
           A YD++A +D +L+   GDKI  +E +  DW+ G  +     G+FP+NYV
Sbjct: 517 AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 57  YVEALYDFEAQQDGD-LSLKTGDKIQVLEKISPDWYKGKANN---RVGIFPANYVK 108
           Y  A+Y F    D D L  + GD + + EK++ DWY G+ +N   + G+ P NYV+
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVE 680

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 7/59 (11%)

Query: 57  YVEALYDF--EAQQDG---DLSLKTGDKIQVLEKISPDWYKGKA--NNRVGIFPANYVK 108
           Y  ALYD+  +  Q G   DL+ K GD I+V++K   +W+ G+     R G FP N+V+
Sbjct: 378 YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVE 436

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYV 107
           +  A YD+EA +D +L+ +  DKI  +E +  DW+ G  +     G+FP+NYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 36/61 (59%), Gaps = 8/61 (13%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPD-WYKGK-------ANNRVGIFPANYVKP 109
           V+ALYD+E Q D +L++K  D + +LEK   D W+  K       A    G+ P+NYV+P
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNYVEP 67

Query: 110 A 110
           A
Sbjct: 68  A 68

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 53  DTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYV 107
           +T+ +  A YD++A ++ +L+    DKI  +E +  DW+ G  + N   G+FP+NYV
Sbjct: 555 ETKPWATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 611

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 4/57 (7%)

Query: 56  EYVEALYDF-EAQQDGDLSLKTGDKIQVLEKISPDWYKG---KANNRVGIFPANYVK 108
           +YV+A+Y + E  ++  L   +GD + ++E I+ DWY G   + N + G+ P NYVK
Sbjct: 548 KYVKAMYSYTEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPMNYVK 604

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYKGKANNRVGIFPANYVK 108
           +EA+Y +EAQ D ++S+  GD I V+       W  G+ +   G+FP +Y K
Sbjct: 582 LEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYVK 108
           A YD+EA +D +L+ + GD I  ++ +  DW+ G  +   + G+FP+NYV+
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYKGKANNRVGIFPANYVK 108
           +EA+Y +EAQ D ++S+  GD+I V+       W  G+ +   G+FP +Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 51/102 (50%), Gaps = 14/102 (13%)

Query: 17  LEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVEA------LYDFEAQQDG 70
           LE    +     +I D+I      ++   +R P   + E   ++       YDF A+   
Sbjct: 308 LELHTGNTTTCEEIMDIIG-----EYKGASRDPGLKEVEMATKSKKRGVVQYDFLAESQD 362

Query: 71  DLSLKTGDKIQVL-EKISPDWYKGKA--NNRVGIFPANYVKP 109
           +L++K+GDK+ +L +K S DW+  +   + + G+ PA +V+P
Sbjct: 363 ELTIKSGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVEP 404

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 58  VEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYVKPA 110
           V A+YD+E  Q+ D  L+    D   VL+   PDW   K   +N  G  P NYV+ A
Sbjct: 74  VRAIYDYEQVQNADEELTFHENDVFNVLDDKDPDWLLVKSTVSNEFGFIPGNYVEGA 130

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 47  RSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRVGIFPA 104
           +S + +  E+ ++ALY+++AQ  G+LS   GD   V ++   DWY+    A+ + G+ P 
Sbjct: 57  KSKDISSPEKVIKALYNYQAQSAGELSFNKGDFFHVQQE-ENDWYEASNPADGKRGMVPK 115

Query: 105 NY 106
           NY
Sbjct: 116 NY 117

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 49  PNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRV---GIFPAN 105
           P+N  T  Y   LYDF+A++  +L+   G+ + +      +W+  K   R+   G+ P  
Sbjct: 163 PSNMGTL-YAIVLYDFQAEKADELTAYAGENLFICAHHDFEWFIAKPIGRLGGPGLVPVG 221

Query: 106 YV 107
           +V
Sbjct: 222 FV 223

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRVGIFPANYV 107
           A YD++A +D +L+   G KI  +E +  DW+ G+       G+FPANYV
Sbjct: 475 AEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGEKGLFPANYV 524

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 37/60 (61%), Gaps = 3/60 (5%)

Query: 52  ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYKGKA--NNRVGIFPANYVK 108
           A T++  +A+YDF A    +L++K GD I +L ++ S DWY  ++    + GI PA +V+
Sbjct: 409 AMTKKRAKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIVPAQFVE 468

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKIS-PDWYKGK-------ANNRVGIFPANYVKPA 110
           +ALYD+ AQ D +L++K GD + +LEK S  DW+  K        +  VG+ P  Y++ A
Sbjct: 9   QALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVKKRVIGSDQDEPVGLVPKTYIEEA 68

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 58  VEALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYVK 108
           V ALYD+E  Q+   +L     D  Q+ +    DW+  K   N+ VG  P NYV+
Sbjct: 74  VVALYDYEQVQNANEELVFHENDTFQLYDDRDADWFLVKNTKNSEVGFVPGNYVE 128

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 48  SPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPAN 105
           SP   +      A YD EA++  +L+ K GDKI  +  +  DW+ G  +     G+FP+N
Sbjct: 566 SPEQGEQLHSAIAEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSN 625

Query: 106 YVK 108
           YV+
Sbjct: 626 YVQ 628

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK-ANNR--VGIFPANYVK 108
           V+A Y +  Q  GDL    GD ++V  KI+ DWY G+   NR   G FP N+VK
Sbjct: 15  VKAKYGWSGQAKGDLGFLEGDVMEV-TKITGDWYYGRLLRNRKCSGYFPNNFVK 67

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYV 107
           +  A YD++A +D +L+    DKI  +E +  DW+ G  + +   G+FP+NYV
Sbjct: 530 WATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 4/56 (7%)

Query: 58  VEALYDF-EAQ-QDGDLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYVKP 109
           ++ALYD+ EAQ Q+ +L+    D   V +   PDW   K + +N VG  P NYV+P
Sbjct: 74  MKALYDYTEAQNQEEELTFHENDIFDVYDDKDPDWLLVKSRTSNEVGFIPGNYVEP 129

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 36/60 (60%), Gaps = 3/60 (5%)

Query: 61  LYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYKGKA--NNRVGIFPANYVKPAFTRSVLT 117
           ++DF  +   +L++K GD + +L +K S DW+  +   +++ G+ PA +V+P   +S  T
Sbjct: 374 MFDFIGEAQDELTVKEGDMVYILNDKSSKDWWTCELVDSHKRGVVPAQFVEPVKDKSSST 433

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPD-WYKGKAN-------NRVGIFPANYVKPA 110
           +A+YD+E Q   +L +   D + +LEK   D W+  K           VG+ P+NY++ A
Sbjct: 9   KAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNYIEEA 68

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 39/58 (67%), Gaps = 5/58 (8%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYKGK--ANNRVGIFPANYVKPAFTRS 114
           ALYDFEA+   +L+++ GD + V+ +K S DW+  +  +N + G+ PA +++  F++S
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFIE--FSKS 432

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 58  VEALYDFEAQQD--GDLSLKTGDKIQVLEKISPDW--YKGKANNRVGIFPANYVKPA 110
           + ALYDF+  Q+   +L  K  D   V +   PDW   +  ++N  G  P NYV+PA
Sbjct: 74  MRALYDFDQAQNPQEELVFKENDMFDVYDDKDPDWILVRSHSSNEYGFVPGNYVEPA 130

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYV 107
           +  A YD++A +D +L+    DKI  +E +  DW+ G  + +   G+FP+NYV
Sbjct: 535 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYV 107
           A YD+EA ++ +L+    DKI  ++ +  DW+ G  + N   G+FP+NYV
Sbjct: 506 AEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 62  YDFEAQQDGDLSLKTGDKIQVL-EKISPDWYKGKA--NNRVGIFPANYVKPAFTR 113
           YDF A+   +L++K+GDK+ +L +K S DW+  +   + + G+ PA +++P   +
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIEPVHDK 413

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 4/57 (7%)

Query: 58  VEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYVKPA 110
           V A+YD+   Q+ D  L+    D   V +    DW   K   +N  G  P NYV+PA
Sbjct: 74  VRAIYDYGQVQNADEELTFHENDTFDVFDDNDADWLLVKSTVSNEFGFIPGNYVEPA 130

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 34/51 (66%), Gaps = 3/51 (5%)

Query: 62  YDFEAQQDGDLSLKTGDKIQVL-EKISPDWYKGKA--NNRVGIFPANYVKP 109
           YDF A+   +L++K+GDK+ +L +K S DW+  +   + + G+ PA +++P
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEP 412

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 58  VEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYVKP 109
           V A+YD+E  Q+ D  L+    D   V +    DW   K   +N  G  P NYV+P
Sbjct: 74  VRAIYDYEQVQNADEELTFHENDVFDVFDDKDADWLLVKSTVSNEFGFIPGNYVEP 129

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYV 107
           +  A YD++A +D +L+    DKI  +E +  DW+ G  + +   G+FP+NYV
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 43  NDNTRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG---KANNRV 99
           ND +    N    + V A++D+  +   +L+L+ GD I V+ K    W+ G   +AN +V
Sbjct: 36  NDQSSPICNVSPVDVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKV 95

Query: 100 --GIFPANYVKPAFTR 113
             G FP NY + + ++
Sbjct: 96  HRGWFPQNYCRSSHSQ 111

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYV 107
           +  A YD++A +D +L+    DKI  +E +  DW+ G  + +   G+FP+NYV
Sbjct: 536 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp,
           1252 aa] {ON} ANNOTATED BY YGOB - skipping over
           frameshift in strain S288c
          Length = 1252

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG-------KANNRVGIFPANYVKPA 110
           VE  Y +  +    LSL+ GD I VL K S  W+ G         NN   I    +  P+
Sbjct: 31  VECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDGVLIRHSANNNNNSLILDRGWFPPS 90

Query: 111 FTRSVL 116
           FTRS+L
Sbjct: 91  FTRSIL 96

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYKGKANNRVGIFPANYVK 108
           +EA+Y +EAQ D ++S+  GD I V+       W  G+ +   G+FP +Y K
Sbjct: 582 MEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 57  YVEALYDFEAQ---QDGDLSLKTGDKIQVLEKISPDWYKGKA--NNRVGIFPANYVK 108
           Y  AL+D+E     Q  DL+ +  + I+V++K    W+ G+A    + G FPANYV+
Sbjct: 399 YATALFDYEPAEPDQSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKRGYFPANYVE 455

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYKGKANNRVGIFPANYVK 108
           ++A YD+EAQ D +LSL   D + V+       W  G+ N   G+FP +Y +
Sbjct: 562 MQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGLFPTSYCR 613

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDFEAQQD-GDLSLKTGDKIQVLEKISPDWYKGKA--------NNRVGIFPANY 106
           EY +A+Y     +  G  +   GD I + E ++ DWYKG+         N+RVG+ P N+
Sbjct: 596 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPYNF 655

Query: 107 VK 108
           ++
Sbjct: 656 IQ 657

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYVK 108
           A YD EA++  +L+ + GDKI  +  +  DW+ G  +     G+FP+NYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 49  PNN----ADTEEYVEALYDFEAQQ--DGDLSLKTGDKIQVLEKISPDWYKGKA--NNRVG 100
           PNN    AD    V A+YD++  Q  D +LS + GD   + +    DW+  +A  + +VG
Sbjct: 61  PNNYIEEADVLYQVHAIYDYKQVQNPDEELSFQEGDVFDIFDDRDADWFLVRAVKDKKVG 120

Query: 101 IFPANYVK 108
             P NYV+
Sbjct: 121 FIPGNYVE 128

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKIS-PDWYKGK-------ANNRVGIFPANYVKPA 110
           +A+Y +E Q D +L ++  D + VLEK    DW+  K           VG+ P NY++ A
Sbjct: 9   KAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNYIEEA 68

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYV 107
           A YD++A ++ +L+    DKI  +E +  DW+ G  + N   G+FP+NYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--KANNRVGIFPANYV 107
           A YD+EA +D +L+ +  ++I  ++ +  DW+ G  +++   G+FP+NYV
Sbjct: 523 AEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPSNYV 572

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYKGKANNRVGIFPANYV 107
           A Y +++Q   +LSL+ GDKI+VL E     W  G+ N   G+FP  Y 
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYKGKANNRVGIFPANYVK 108
           +EA Y +EA+ D ++S+  GD I V+       W  G+ +   G+FP +Y K
Sbjct: 583 LEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 634

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 58  VEALYDFEAQQ--DGDLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYVKP 109
           V+ALYD+E  Q  + +L     D   V +   PDW   K + +N VG  P NYV+P
Sbjct: 74  VKALYDYEQIQNPEEELIFHENDLFSVYDDKDPDWLLVKSQISNEVGFVPGNYVQP 129

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 52  ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYKGK--ANNRVGIFPANYVK 108
           A +++    L DF A+ + +L++K GD + +L +K S DW+  +       G+ PA +++
Sbjct: 368 AKSKKQARVLVDFIAESNDELTVKEGDMVYILNDKKSKDWWMCELVKTGEKGVVPAQFIE 427

Query: 109 P 109
           P
Sbjct: 428 P 428

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKIS-PDWYKGK-------ANNRVGIFPANYVKPA 110
           +A+YD+E Q   +L LK  D + +LEK    DW+  K       A   VG+ P+NY++ A
Sbjct: 9   KAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNYIEEA 68

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 36/62 (58%), Gaps = 4/62 (6%)

Query: 47  RSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPD-WYKGKANNRVGIFPAN 105
           R+P +  T   V A+YD+ A+   ++S++ GD I+V+   + + W  G+     G+FP+N
Sbjct: 613 RNPTSLRT---VIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSN 669

Query: 106 YV 107
           Y 
Sbjct: 670 YC 671

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 34/51 (66%), Gaps = 3/51 (5%)

Query: 62  YDFEAQQDGDLSLKTGDKIQVLE-KISPDWYKGKA--NNRVGIFPANYVKP 109
           Y+F A+   +L++K+GDK+ +L+ K S DW+  +   + + G+ PA +++P
Sbjct: 355 YNFMAESQDELTVKSGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIEP 405

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 58  VEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYVKP 109
           V A+YD+E  Q+ D  L+    D   VL+    DW   K   +N  G  P NYV+P
Sbjct: 74  VRAIYDYEQVQNADEELTFHENDVFDVLDDKDVDWLLVKSTVSNEFGFIPGNYVEP 129

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 10/90 (11%)

Query: 41  KWNDNTRSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKA--NNR 98
           K N    SP+N +    ++ALY + AQ  G+LS   G+ + V+ +   +W++  +  + R
Sbjct: 53  KNNGGGVSPSN-EVPIILKALYTYHAQSPGELSFTKGELVHVIGE-DGEWFEVSSPDSGR 110

Query: 99  VGIFPANYVKP------AFTRSVLTKPEEG 122
            G+ P +Y +P        T+S+L  P++ 
Sbjct: 111 KGMVPKSYFEPVSRSRVVSTQSILVSPQQA 140

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRV---GIFPANYV 107
           Y   LYDF+A++  +LS   G+ + +    + +W+  K   R+   G+ P  +V
Sbjct: 150 YAIVLYDFKAEKSDELSAFAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVGFV 203

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 33.1 bits (74), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 4/40 (10%)

Query: 72  LSLKTGDKIQVLEKISPD---WYKGKANNRVGIFPANYVK 108
           L+   G  I+++++ +PD   W+ G+ N + G+FP NYV+
Sbjct: 1   LTFPAGAVIEIVQR-TPDANEWWTGRYNGQQGVFPGNYVQ 39

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRV-GIFPANYV 107
           V+A Y +  Q  GDL    GD ++V  +I+ DW+ GK   N +  G FP N+V
Sbjct: 13  VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGKLLRNKKCSGYFPNNFV 64

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 58  VEALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYKG-KANNRVGIFPANYVK 108
           V+ALY ++A      +LS + GD ++V   I   W+K  K N + GI P+NYVK
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKV-SDIEGRWWKARKENGQTGIIPSNYVK 352

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDFEAQQD-GDLSLKTGDKIQVLEKISPDWYKGKA--------NNRVGIFPANY 106
           EY +A+Y     +  G  +   GD + + E ++ DWYKG+         N+R+G+ P N+
Sbjct: 602 EYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYNF 661

Query: 107 VK 108
           ++
Sbjct: 662 IQ 663

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 36.6 bits (83), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 49  PNN----ADTEEYVEALYDFEAQQ--DGDLSLKTGDKIQVLEKISPDW--YKGKANNRVG 100
           PNN    A    + +ALYD++  Q  D +L    GD+  V +   PDW     K +  +G
Sbjct: 61  PNNYIEQAPVISHAKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIG 120

Query: 101 IFPANYVK 108
             P NYV+
Sbjct: 121 FVPGNYVE 128

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 36.2 bits (82), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 4/53 (7%)

Query: 59  EALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYKGK-ANNRVGIFPANYVK 108
           EALY ++A Q    ++S + G+ ++V + I   W+K K +N   GI P+NYVK
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGD-IEGRWWKAKKSNGETGIIPSNYVK 350

>NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.319
           YDL117W
          Length = 919

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK-ANNR--VGIFPANYV 107
           V A Y +  Q  GDL    GD ++V  +++ DW+ GK   NR   G FP N+V
Sbjct: 15  VRAKYGWSGQAKGDLGFLEGDIMEVT-RVAGDWFYGKLLRNRKCAGYFPNNFV 66

>Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar to
           Ashbya gossypii AER140C
          Length = 422

 Score = 36.2 bits (82), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 45  NTRSPNNADTEEYVEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWYKGKA--NNRVG 100
           N+ S   A    Y   LYD+E Q +    LS+K GD IQ++ +    W+ G        G
Sbjct: 349 NSNSLQKAVPTMYATVLYDYEPQFNDPQYLSIKKGDTIQIITQSKNGWWYGDLLRTKTKG 408

Query: 101 IFPANYVK 108
           +FP +YV+
Sbjct: 409 LFPQSYVQ 416

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
           (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG---KANNRVGIFPANYV 107
           V A Y +  Q  GDL    GD ++V +KI+ DW+ G   +     G FP N+V
Sbjct: 10  VRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCSGYFPKNFV 61

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 56  EYVEALYDFEAQQ-DGDLSLKTGDKIQVLEKISP-----DWYKGKA-NNRVGIFPANYVK 108
           E+  ALYDF  +    +++L  GD + +L K  P     DW+K +  N ++G  P NY++
Sbjct: 326 EFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKNGKIGYIPYNYIE 385

>NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON}
           Anc_2.319 YDL117W
          Length = 864

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 4/59 (6%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKA---NNRVGIFPANYVKPAFTR 113
           V A Y +  Q  GDL    GD ++V  +++ DW+ G+        G FP N+V P   R
Sbjct: 13  VRARYGWSGQTKGDLGFLEGDIMEV-TRVAGDWFYGRLLRNKKCAGYFPNNFVIPLEER 70

>Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W
           (HOF1) - SH3 domain containing-protein [contig 59] FULL
          Length = 627

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDF-EAQQDGDLSLKTGDKIQVLEKISPDWYKGKANN--------RVGIFPANY 106
           +Y +ALY F EA +   ++ + GD + + E++  DW+ G+  +        R GI P NY
Sbjct: 563 KYAKALYTFMEANEQQIVNFRAGDYLLLTEQLDQDWFIGEVLDSHDVEPEYRYGIIPRNY 622

Query: 107 VK 108
           ++
Sbjct: 623 IE 624

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 36.2 bits (82), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 60  ALYDFEAQQ--DGDLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYVKP 109
           ALYD++  Q  D +L+ K  D   + +   PDW   + + +  VG  P NYV+P
Sbjct: 76  ALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGSVGFVPGNYVEP 129

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 36.2 bits (82), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 52  ADTEEYVEALYDFEAQQ--DGDLSLKTGDKIQVLEKISPDWYKGKA--NNRVGIFPANYV 107
           AD    V+A+YD+   Q  D +L     D   V +   PDW   ++   N+ G  P NYV
Sbjct: 68  ADVISQVKAVYDYHEVQNPDEELVFNENDTFDVYDDKDPDWILARSISTNQFGFIPGNYV 127

Query: 108 KP 109
           +P
Sbjct: 128 EP 129

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 39/67 (58%), Gaps = 5/67 (7%)

Query: 61  LYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYKGKA--NNRVGIFPANYVKPAFTRSVLT 117
           LYDF A+ + +L++K G  + ++ ++ S DW+  +   + + G+ P+++++P   +  LT
Sbjct: 388 LYDFTAESNDELTIKQGQVVYIINDQKSKDWWLCELIDSGKRGVVPSHFIEP--IQEKLT 445

Query: 118 KPEEGDL 124
               G L
Sbjct: 446 SSHTGGL 452

>KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 814

 Score = 35.8 bits (81), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRVGIFPANYV 107
           V+  + +  ++  DL    GD I+V  +++ DWY GK   N + G FP+NYV
Sbjct: 11  VKTNFAWSGEKKDDLGFLEGDFIEVT-RVTGDWYFGKLIRNKKQGYFPSNYV 61

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 35.8 bits (81), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNR-----VGIFPANYVK 108
           V A+  +E Q   DL +  GDKI VL      WY G+  ++      GIFP+++VK
Sbjct: 11  VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK 66

>TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {ON}
           Anc_8.539 YBR200W
          Length = 597

 Score = 35.8 bits (81), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRV---GIFPANYV 107
           Y   LYDFEA ++ +L++  G+ + +      +W+ G+   R+   G+ P ++V
Sbjct: 165 YALCLYDFEAAKEDELTVYAGETLFIYAHYEEEWFIGRPLGRIGGPGLVPISFV 218

>Smik_12.47 Chr12 (99536..103291) [3756 bp, 1251 aa] {ON} YLL016W
           (REAL)
          Length = 1251

 Score = 35.8 bits (81), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG----KANNRVG--IFPANYVKPAF 111
           VE + ++   +   LSL+ GD I VL K S  W+ G       N  G  +    +  P+F
Sbjct: 31  VECICEYFINKRNKLSLRIGDLIYVLNKGSSGWWDGVLIRHCANDSGPLMLDRGWFPPSF 90

Query: 112 TRSVL 116
           TRS+L
Sbjct: 91  TRSIL 95

>Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016W
           (REAL)
          Length = 1254

 Score = 35.8 bits (81), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG-----KANNRVGI-FPANYVKP 109
           + VE +Y+   +    LSL+ GD + VL K S  W+ G      AN+   +     +  P
Sbjct: 29  DVVECIYEHFTESRDKLSLRIGDMVYVLNKGSNGWWDGVLIRHCANDSSPLKLDRGWFSP 88

Query: 110 AFTRSVL 116
           +FTRS+L
Sbjct: 89  SFTRSIL 95

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 886

 Score = 35.8 bits (81), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRV-GIFPANYV 107
           V+A Y +  Q  GDL    GD ++V  +I+ DW+ G+   N +  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGRLLRNKKCSGYFPNNFV 65

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 62  YDFEAQQDGDLSLKTGDKIQVL-EKISPDWYKGKANNRVGIFPANYVK 108
           YD++AQ++ +++++ GD + VL E     W   + +   G+ P NY K
Sbjct: 612 YDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTNYCK 659

>Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032W
           (REAL)
          Length = 669

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDFEAQQD-GDLSLKTGDKIQVLEKISPDWYKGKA--------NNRVGIFPANY 106
           EY +A+Y     +  G  +   GD + + E ++ DWYKG+         ++RVG+ P N+
Sbjct: 602 EYAKAMYPLVGNEAPGLANFHKGDYMLITEIVNKDWYKGEVYDNDRIDRDHRVGLIPYNF 661

Query: 107 VK 108
           ++
Sbjct: 662 IQ 663

>Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310C
           (CDC25) - 1:1 [contig 225] FULL
          Length = 1517

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 36/89 (40%), Gaps = 13/89 (14%)

Query: 47  RSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG--------KANNR 98
           RS       + V A  DF A +   L L  GD + VL K    W+ G        +  +R
Sbjct: 15  RSGGAVRALDVVIASCDFVATKKSQLRLNVGDVVYVLGKNESGWWDGVVVSPGGVRGAHR 74

Query: 99  V--GIFPANYVKPA---FTRSVLTKPEEG 122
              G FP N+ +PA   + RS L     G
Sbjct: 75  CVRGWFPQNHTRPAPRDYKRSALAAKAGG 103

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 7/60 (11%)

Query: 56  EYVEALYDFEAQQDG-DLSLKTGDKIQVLEKISP-----DWYKGKA-NNRVGIFPANYVK 108
           E+  A+YDF  +    + SLK GD + ++ K+ P      W+K +     VG  P+NY++
Sbjct: 315 EFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSNYIE 374

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDFEAQQD-GDLSLKTGDKIQVLEKISPDWYKGKANN--------RVGIFPANY 106
           EY +A+Y     +  G  +   GD I + E ++ DW+KG+  N        RVG+ P N+
Sbjct: 601 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIPYNF 660

Query: 107 VK 108
           ++
Sbjct: 661 IQ 662

>AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON}
           NOHBY516; No homolog in Saccharomyces cerevisiae'
          Length = 414

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 57  YVEALYDFEAQQDGD--LSLKTGDKIQVLEKISPDWYKGKA--NNRVGIFPANYVK 108
           Y  ALYD++ Q +    LS+K GD IQV+ +    W+ G        G+FP +YV+
Sbjct: 353 YATALYDYDPQFNDPQYLSIKKGDIIQVITQSKNGWWYGDLLRTKTKGLFPQSYVQ 408

>Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to
           Ashbya gossypii AGL169C
          Length = 261

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 49  PNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRVGIFPANY 106
           PN    ++ V ALYDF  + D +L LK GD I +  K    W   +     R G+ P  Y
Sbjct: 110 PNEYVVDKKVVALYDFVPENDNELELKEGDVIYISYKHGQGWLVAENIDGTRTGLVPEEY 169

Query: 107 V 107
           V
Sbjct: 170 V 170

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRVGIFPANYV 107
           V+A+Y +  +++ DL     D I+V  K    WY G+   N + G FPANYV
Sbjct: 12  VKAIYSWSGEKEYDLGFIEEDIIEVT-KAKGGWYYGRLLRNKKSGSFPANYV 62

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG---KANNRV--GIFPANYVK 108
           + V A YD+   +   L L  GD + VL K    W+ G    +NN+   G FP NY K
Sbjct: 24  DVVVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDSNNKASRGWFPCNYSK 81

>TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1136

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 61  LYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYKGKA--NNRVGIFPANYVKPAFTRS 114
           + DFEA+ + +LS++ G  + ++ ++ S DW+  +A    + GI PA +++P   +S
Sbjct: 383 ILDFEAEANDELSVRVGQVVYIIDDQKSRDWWMCEAVDTGKRGIIPAQFIEPISEKS 439

>CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38822 Saccharomyces cerevisiae
           YHR114w BZZ1
          Length = 619

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYKGKANNRVGIFPANYV 107
           + A Y++ +Q D +LSL  GD + VL+      W  G+ N   G+ P +Y 
Sbjct: 568 ITAQYEYTSQGDDELSLAVGDVVTVLKGDDGSGWTYGELNGHKGLVPTSYC 618

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 47  RSPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRVGIFPA 104
           +S + +  E+ ++A+Y+++AQ  G+LS   GD   VL +   +WY     ++ + G+ P 
Sbjct: 60  KSKDISSPEKVIKAMYNYQAQSPGELSFVKGDFFHVLTE-DREWYDASNPSDGKRGMVPK 118

Query: 105 NY 106
           +Y
Sbjct: 119 SY 120

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRV---GIFPANYV 107
           Y   LYDF+A++  +L+   G+ + V    + +W+  K   R+   G+ P  +V
Sbjct: 158 YAIVLYDFQAEKSDELTSYAGENLFVCAHHNYEWFIAKPIGRLGGPGLVPVGFV 211

>SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain-containing protein
           required for cytokinesis
          Length = 633

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDF-EAQQDGDLSLKTGDKIQVLEKISPDWYKGKANN--------RVGIFPANY 106
           +Y +ALY + E  ++  ++ +  D I + ++++ DWY G+  N        R G+ PANY
Sbjct: 569 KYAKALYTYMEPNENNLVNFRVDDYILLTKRLNQDWYLGEVYNAGGIEDRYRCGLVPANY 628

Query: 107 VK 108
           ++
Sbjct: 629 IE 630

>AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL007C
           (SLA1)
          Length = 1121

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 58  VEALYDFEAQQ--DGDLSLKTGDKIQVLEKISPDW--YKGKANNRVGIFPANYVK 108
           V ++YD+E  Q  D +L  + GD+  V +    DW   + +A+  VG  P NYV+
Sbjct: 74  VRSVYDYEEAQNPDEELVFREGDEFDVYDDRDADWVLVRKRADGSVGFAPGNYVE 128

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 62  YDFEAQQDGDLSLKTGDKIQVL-EKISPDWYKGK--ANNRVGIFPANY--VKPAFTRSVL 116
           Y+F  +   +L++K GD + +L +K S DW+  +    +R G+ PA +  V+P   R  L
Sbjct: 345 YNFFGESSDELTVKEGDVVYILNDKKSADWWMCEIIGTSRQGVIPAQFIDVQPTEARKSL 404

Query: 117 T 117
           T
Sbjct: 405 T 405

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL117W
           (CYK3)
          Length = 925

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRVGIFPANYVK 108
           V+A+Y +  + + DL     D I+V  K+  +W  G+   N + G FP NYV+
Sbjct: 12  VKAVYSWSGEHEQDLGFLESDIIEV-TKVKGNWLYGRLLRNKKSGYFPVNYVQ 63

>TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.344
           YDR162C
          Length = 224

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 49  PNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRVGIFPANY 106
           PNN    +   ALYDF  + D +L L  GD I +  K    W   +   NN++G+ P  +
Sbjct: 94  PNNYIINQKAIALYDFVPENDNELQLVEGDIIFINYKHGQGWLVAQNLNNNKIGLVPEEF 153

Query: 107 V 107
           V
Sbjct: 154 V 154

>Kwal_53.19449 s53 (58..657) [600 bp, 199 aa] {ON} YDR162C (NBP2) -
           interacts with Nap1, which is involved in histone
           assembly [contig 398] FULL
          Length = 199

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRVGIFPANYV 107
           ALYDF A+ D +L LK GD + +  + +  W   +     R G+ P  YV
Sbjct: 76  ALYDFVAENDNELELKEGDVLFIGYRHAQGWLVAENMDRTRTGLVPEEYV 125

>KNAG0A05490 Chr1 (812680..815328) [2649 bp, 882 aa] {ON} Anc_2.319
           YDL117W
          Length = 882

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK-ANNR--VGIFPANYV 107
           V+A Y +  Q   DL    GD ++V  ++S +WY GK   NR   G FP N+V
Sbjct: 15  VKARYGWSGQSKRDLGFLEGDIMEV-TRVSGEWYYGKLLRNRKCAGYFPNNFV 66

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG---KANNRVGIFPANYV 107
           V+A Y +  Q  GDL    GD + V  K + DWY G   +     G FP N+V
Sbjct: 7   VKARYGWSGQAKGDLGFLEGDIMNV-TKTTGDWYYGFLLRNKKSKGYFPKNFV 58

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYKGKANNRVGIFPANYVK 108
           V A Y + AQ D +LSL+ GD ++V++      W  G+ +   G+ P +Y K
Sbjct: 583 VTAQYAYVAQGDDELSLEAGDVVKVIKGDDGSGWTYGELDGAKGLIPTSYCK 634

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNR--VGIFPANYVKPA 110
           ALYDFE + D +L L+ GD + +  +    W   +  NR   G+ P  +V  A
Sbjct: 133 ALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFVTYA 185

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLE-KISPDWYKGKANNRVGIFPANYVK 108
           +E ++D+ AQ D ++S+  GD + V++      W  G+ N   G+ P +Y K
Sbjct: 551 LEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELNGLKGLVPTSYCK 602

>YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}
           CYK3SH3-domain protein located in the mother-bud neck
           and the cytokinetic actin ring; mutant phenotype and
           genetic interactions suggest a role in cytokinesis
          Length = 885

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRV-GIFPANYV 107
           V+A Y +  Q  GDL    GD ++V  +I+  W+ GK   N +  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGKLLRNKKCSGYFPHNFV 65

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 4/53 (7%)

Query: 59  EALYDFEAQQ-DG-DLSLKTGDKIQVLEKISPDWYKGK-ANNRVGIFPANYVK 108
           +ALY ++A   DG ++S + G+ ++V   I   W+K K  N +VGI P+NYV+
Sbjct: 300 KALYSYQADDADGYEISFEQGEILKV-SDIEGRWWKSKRENGQVGIIPSNYVQ 351

>YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF}
          Non-essential Ras guanine nucleotide exchange factor
          (GEF) localized to the membrane; expressed in poor
          nutrients and on non-fermentable carbon sources;
          homologous to CDC25; contains a stop codon in S288C;
          full-length gene includes YLL016W
          Length = 103

 Score = 32.3 bits (72), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%)

Query: 56 EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKG 93
          + VE  Y +  +    LSL+ GD I VL K S  W+ G
Sbjct: 29 DVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 9/66 (13%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLE---KISPDWYKGK--ANNRVGIFPANYVKPAFTRS 114
           A+ ++  + + +LS+K GDKI+V+    + +  WY G+       G++PA + K    ++
Sbjct: 20  AVNEYSKRMEDELSMKPGDKIEVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTK----KT 75

Query: 115 VLTKPE 120
            L KPE
Sbjct: 76  TLNKPE 81

>AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR200W
           (BEM1); 1-intron
          Length = 549

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 9/78 (11%)

Query: 52  ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYK--GKANNRVGIFPANYV-- 107
            D    ++ALY + AQ  G+LS   G+  QV  +   +WY+       R G+ P +Y   
Sbjct: 61  VDVPIILKALYTYHAQSPGELSFNKGELFQVNGE-DGEWYEVTSTEGGRKGMVPKSYFEQ 119

Query: 108 ----KPAFTRSVLTKPEE 121
               +   T S+LT P++
Sbjct: 120 VSKSRVVSTHSILTSPQQ 137

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRV---GIFPANYV 107
           Y   LYDF+A++  +LS   G+ + +    + +W+  K   R+   G+ P  +V
Sbjct: 148 YAIVLYDFKAEKSDELSAFAGENLFICAHHNFEWFIAKPIGRLGGPGLVPVGFV 201

>Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRV-GIFPANYV 107
           V+A Y +  Q  GDL    GD ++V  +I+  W+ G+   N +  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRV-GIFPANYV 107
           V+A Y +  Q  GDL    GD ++V  +I+  W+ G+   N +  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar to
           uniprot|Q12163 Saccharomyces cerevisiae YDR162c NBP2
           NAP1P-binding protein
          Length = 213

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYV 107
           ALYDFE + D +L LK GD I +  +    W   +     + G+ P  +V
Sbjct: 101 ALYDFEPENDNELGLKEGDVIFISYRHCQGWLVAQNDTQTKTGLVPEEFV 150

>Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRV-GIFPANYV 107
           V+A Y +  Q  GDL    GD ++V  +I+  W+ G+   N +  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPD-WYKGK-------ANNRVGIFPANYVKPA 110
           +ALYD+E Q   +L+++  + + +LEK   D W+  K       A+  VG+ P+NYV+ A
Sbjct: 9   KALYDYEPQTTEELAIREDELLYLLEKSDVDEWWTVKKRVIGSDADEPVGLVPSNYVEQA 68

>KNAG0J02750 Chr10 complement(521086..526044) [4959 bp, 1652 aa]
           {ON} Anc_4.45 Scer_YGOB_SDC25
          Length = 1652

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 10/73 (13%)

Query: 46  TRSPNN-ADTEEYVEALYDFE---AQQDGDLSLKTGDKIQVLEKISPDWYKG----KANN 97
           T +PN+   T + V A++DF    A     LS + GD + VL K +  W+ G      +N
Sbjct: 80  TPTPNSRVCTLDIVVAVHDFNYPPASATNKLSFQRGDTVYVLAKSASGWWDGLSIADTDN 139

Query: 98  RV--GIFPANYVK 108
           +V  G FP N+V+
Sbjct: 140 KVIRGWFPYNHVR 152

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 58  VEALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYKGK-ANNRVGIFPANYVK 108
            +ALY +EA      ++S + G+ ++V + I   W+K K AN   GI P+NYV+
Sbjct: 270 AKALYAYEADASDAYEISFQQGEILRVGD-IEGRWWKAKKANGETGIIPSNYVE 322

>KLLA0B04862g Chr2 (442398..443591) [1194 bp, 397 aa] {ON} conserved
           hypothetical protein
          Length = 397

 Score = 33.1 bits (74), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 49  PNNADTEEYVEALYDF---EAQQDGDLSLKTGDKIQVLEKISPDWYKGKA--NNRVGIFP 103
           P    + +Y +A+ DF   E   +  LSL+  D I++  K +  W+ G++   N++G FP
Sbjct: 329 PYQKHSPQYCKAIADFVPTEEDSENSLSLRKEDVIKIYRKEAEVWWYGQSLRTNKIGYFP 388

Query: 104 A 104
            
Sbjct: 389 V 389

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 33.1 bits (74), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 10/67 (14%)

Query: 58  VEALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYKGK-ANNRVGIFPANYVKPAFTRS 114
            +ALY ++A  D   ++S +  + +QV + I   W+K + AN   GI P+NYV+      
Sbjct: 306 AKALYPYDADGDDAYEISFEQNEILQVSD-IEGRWWKARRANGETGIIPSNYVQ------ 358

Query: 115 VLTKPEE 121
           ++  PEE
Sbjct: 359 LIDSPEE 365

>TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7.413
           YER114C
          Length = 1005

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKIS---PDWYKG--KANNRVGIFPANYVK 108
           A+ +++ + D +L++  GDKIQVL   S     WY G     N  G++P N+ +
Sbjct: 26  AVAEYQKRMDDELNMMPGDKIQVLNDDSLYNDGWYLGINLTTNEKGLYPLNFTQ 79

>TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {ON}
           Anc_7.419 YER118C
          Length = 337

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 17/81 (20%)

Query: 43  NDNTRSPNNADTEEYVEA-----------LYDFEAQQDGD---LSLKTGDKIQVLEKISP 88
           NDNT +  +   E Y +A           LY ++A   GD   +S   G+ ++V   I  
Sbjct: 252 NDNTDTTMSGTLELYSDAGDESFPYTAKTLYSYQADA-GDAYEISFDQGEILKV-SDIEG 309

Query: 89  DWYKGK-ANNRVGIFPANYVK 108
            W+K K AN   GI P+NYV+
Sbjct: 310 RWWKAKRANGETGIIPSNYVQ 330

>SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some
           similarities with uniprot|Q12163 Saccharomyces
           cerevisiae YDR162C NBP2 Protein involved in the HOG
           (high osmolarity glycerol) pathway negatively regulates
           Hog1p by recruitment of phosphatase Ptc1p the
           Pbs2p-Hog1p complex found in the nucleus and cytoplasm
           contains an SH3 domain that binds Pbs2p
          Length = 207

 Score = 32.7 bits (73), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNR--VGIFPANYV 107
           A+YDF  + D +L+LK GD + +  K    W   +   R   G+ P  YV
Sbjct: 95  AIYDFIPENDNELALKEGDVVYISYKHGQGWLVAENEERTKTGLVPEEYV 144

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%), Gaps = 5/55 (9%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVL---EKISPDWYKGK--ANNRVGIFPANYVKP 109
            + ++  + + ++ +K GDKI+VL    +    WY+GK     +VG++PA + +P
Sbjct: 7   CVNEYRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGKNLRTAQVGLYPAVFTQP 61

>NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.344
           YDR162C
          Length = 245

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNR--VGIFPANYV 107
           ++  ALYDFE + D +L LK  D + +  K    W   +   R   G+ P  YV
Sbjct: 107 QWAVALYDFEPENDNELGLKENDIVFISYKHGQGWLVAENEKRTQTGLVPEEYV 160

>Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}
           YDR162C (REAL)
          Length = 240

 Score = 32.7 bits (73), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 9/66 (13%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYVKPAFTRSVLT 117
           ALYDFE + D +L L  GD + +  K    W   + ++ ++ G+ P  +V          
Sbjct: 117 ALYDFEPENDNELKLTEGDLVFISYKHGQGWLVAENESRSKTGLVPEEFV-------TYI 169

Query: 118 KPEEGD 123
           +PE+G+
Sbjct: 170 QPEDGE 175

>SAKL0F13112g Chr6 complement(1037049..1038071) [1023 bp, 340 aa]
           {ON} similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 340

 Score = 32.7 bits (73), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 59  EALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYKGK-ANNRVGIFPANYVK 108
           +ALYD+ A +    ++S + G+ ++V + I   W+K K A    GI P+NYV+
Sbjct: 281 KALYDYNASESDAYEISFEQGEILRVGD-IEGRWWKAKKATGETGIIPSNYVQ 332

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 36/61 (59%), Gaps = 3/61 (4%)

Query: 52  ADTEEYVEALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYKGK--ANNRVGIFPANYVK 108
           + T+   +  YDF A+   +L++  GD + V+ ++ S +W+  +  +  + G+ PA++V+
Sbjct: 393 SQTKRKAQISYDFLAESHDELTVHAGDAVYVIDDQKSSEWWMVELISTGKKGVVPADFVE 452

Query: 109 P 109
           P
Sbjct: 453 P 453

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 58  VEALYDFEAQQ--DGDLSLKTGDKIQVLEKISPDW--YKGKANNRVGIFPANYVKP 109
           V+A+Y+++  Q  D +L     +   V +    DW   K ++ N+VG  P NYV+P
Sbjct: 74  VKAIYNYDEAQNPDEELLFNENEIFDVFDDRDQDWLLVKSRSANQVGFVPGNYVEP 129

>Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}
           YDR162C (REAL)
          Length = 233

 Score = 32.3 bits (72), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 9/66 (13%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYVKPAFTRSVLT 117
           ALYDFE + D +L L  GD + +  K    W   + ++ ++ G+ P  +V          
Sbjct: 117 ALYDFEPENDNELKLTEGDIVFISYKHGQGWLVAENESRSKTGLVPEEFVS-------YI 169

Query: 118 KPEEGD 123
           +PE+G+
Sbjct: 170 QPEDGE 175

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 32.3 bits (72), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 59  EALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYKGK-ANNRVGIFPANYVK 108
            ALY +EA +    ++S + G+ ++V + I   W+K K +N   GI P+NYV+
Sbjct: 273 RALYAYEADESDAYEISFQQGEILRVGD-IEGRWWKAKRSNGETGIIPSNYVE 324

>KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4.108
           YBL007C
          Length = 1203

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 58  VEALYDFEAQQ--DGDLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYVKP 109
           V+A YD+E  Q  D +L+    D  +V +    DW   K  + N  G  P NYV+P
Sbjct: 74  VKASYDYEQVQNPDEELTFHENDIFEVYDDKDQDWLLVKSLSTNEFGFVPGNYVEP 129

>ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 371

 Score = 32.3 bits (72), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 15/85 (17%)

Query: 38  LPEKWNDNTRSPNNADTEEYVEA-----------LYDFEAQQDG--DLSLKTGDKIQVLE 84
           + E  N NT +      E Y +A           LY ++A +D   ++S + G+ ++V  
Sbjct: 280 MTETSNGNTDTTMGGTLELYSDAGEESFPYTAQTLYRYQADEDDAYEISFEQGEILKV-S 338

Query: 85  KISPDWYKGK-ANNRVGIFPANYVK 108
            I   W+K K +    GI P+NYVK
Sbjct: 339 DIEGRWWKAKRSTGETGIIPSNYVK 363

>Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa]
           {ON} YLR310C (REAL)
          Length = 1587

 Score = 32.7 bits (73), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 11/63 (17%)

Query: 58  VEALYDFE--AQQDGD---LSLKTGDKIQVLEKISPDWYKG----KANNRV--GIFPANY 106
           V A YDF    ++DG    LS++ GD I +L K S  W+ G     ++ +V  G FP N+
Sbjct: 66  VVAAYDFNHPTKKDGSSQLLSVQQGDTIYILNKNSSGWWDGLVIDDSSGKVDRGWFPQNF 125

Query: 107 VKP 109
            +P
Sbjct: 126 GRP 128

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 32.3 bits (72), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 6/55 (10%)

Query: 58  VEALYDFEAQQDGD---LSLKTGDKIQVLEKISPDWYKGK-ANNRVGIFPANYVK 108
           V+ALY ++A  D D   +S   G+ ++V   I   W+K K  N + GI P+NYV+
Sbjct: 311 VKALYSYQAD-DADAYEISFDQGEILKV-SDIEGRWWKAKRENGQTGIIPSNYVE 363

>Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON}
           (44320..45396) [1077 nt, 359 aa]
          Length = 358

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 22/110 (20%)

Query: 13  IRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTEEYVE-----------AL 61
           IRN  + L+ SN       + +N+ + E  N NT +        Y E           AL
Sbjct: 249 IRNPTDTLKTSN-------ENVNTFVTESSNGNTETTMGDTLGLYSEFGDESFPYTARAL 301

Query: 62  YDFEAQ-QDG-DLSLKTGDKIQVLEKISPDWYKGKA-NNRVGIFPANYVK 108
           Y ++A   DG ++S + G+ ++V   I   W+K K     VGI P+NYV+
Sbjct: 302 YSYQADDADGYEVSFEQGEILKV-SDIEGRWWKSKKETGEVGIIPSNYVQ 350

>YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}
           NBP2Protein involved in the HOG (high osmolarity
           glycerol) pathway, negatively regulates Hog1p by
           recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex, found in the nucleus and cytoplasm, contains an
           SH3 domain that binds Pbs2p
          Length = 236

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 9/66 (13%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYVKPAFTRSVLT 117
           ALYDFE + D +L L  GD + +  K    W   + ++ ++ G+ P  +V          
Sbjct: 117 ALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVS-------YI 169

Query: 118 KPEEGD 123
           +PE+G+
Sbjct: 170 QPEDGE 175

>KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} similar
           to uniprot|P40073 Saccharomyces cerevisiae YER118C SHO1
           Transmembrane osmosensor participates in activation of
           both the Cdc42p- and MAP kinase-dependent filamentous
           growth pathway and the high- osmolarity glycerol
           response pathway
          Length = 342

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 58  VEALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYKGK-ANNRVGIFPANYVK 108
            +ALY + A  +   ++S + G+ ++V + I   W+K K AN   GI P+NYV+
Sbjct: 283 AKALYTYTADSNDAYEVSFEQGEMLRVGD-IEGRWWKAKRANGETGIIPSNYVE 335

>TBLA0H02790 Chr8 (653275..655026) [1752 bp, 583 aa] {ON} Anc_2.591
           YMR032W
          Length = 583

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 9/62 (14%)

Query: 56  EYVEALYDFEAQQDGDLS-LKTGDKIQVLEKISPDWYKGK--------ANNRVGIFPANY 106
           +Y +ALY        +L+    GD + +   I  DWYKG+        A ++ G+ P+N+
Sbjct: 519 QYAKALYPLVDNPATELAHFHKGDYLLLTHIIDKDWYKGEVYANDMIDATHKYGLIPSNF 578

Query: 107 VK 108
           V+
Sbjct: 579 VR 580

>Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118C
           (SHO1) - Transmembrane osmosensor [contig 33] FULL
          Length = 343

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 58  VEALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYKGK-ANNRVGIFPANYVK 108
            +ALY + A  +   ++S + G+ ++V + I   W+K K AN   GI P+NYV+
Sbjct: 284 AKALYTYTADSNDAYEVSFEQGETLRVGD-IEGRWWKAKRANGETGIIPSNYVE 336

>KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.419
           YER118C
          Length = 342

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 58  VEALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYKGK-ANNRVGIFPANYVK 108
            +ALY ++A  +   ++S + G+ ++V   I   W+K + AN   GI P+NYV+
Sbjct: 286 AKALYSYDADSNDQYEVSFEQGEILKV-SDIEGRWWKARRANGETGIIPSNYVE 338

>KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain- containing protein
           required for cytokinesis
          Length = 600

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 9/61 (14%)

Query: 57  YVEALYDF-EAQQDGDLSLKTGDKIQVLEKISPDWYKGKANN--------RVGIFPANYV 107
           Y +ALY F E  +   ++   GD + + E++  DW+ G+  +        R GI P NY+
Sbjct: 537 YAKALYTFMEPNEQQIVNFHVGDYLLLTEQLDQDWFIGEVLDSQNVDPEYRYGIIPRNYI 596

Query: 108 K 108
           +
Sbjct: 597 E 597

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%)

Query: 53  DTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVK 108
           DT   V+A + ++++ + DL+      I V      +WY G+  ++ GIFP ++VK
Sbjct: 5   DTPFKVQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVK 60

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 53  DTEEYV-EALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYKGK-ANNRVGIFPANYVK 108
           D   YV +ALY ++A +    ++S + G+ ++V   I   W+K K  N   GI P+NYV+
Sbjct: 266 DNFAYVAKALYSYQADESDQYEISFEQGEILRV-SDIEGRWWKAKRENGETGIIPSNYVQ 324

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKIS-PDWYKGK-------ANNRVGIFPANYVKPA 110
           +A++ +E Q D +L++  GD + +L+K    DW+  K       A   VG+ P NY++ A
Sbjct: 9   KAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNYIEEA 68

>TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 aa]
           {ON} Anc_8.539 YBR200W
          Length = 541

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 40/85 (47%), Gaps = 8/85 (9%)

Query: 31  FDLINSKLPEKWNDNTRSPNNADTEE-----YVEALYDFEAQQDGDLSLKTGDKIQVLEK 85
           F++I+   P   N +  S  ++  +      Y   LYDF+A++  +L+   G+ + +   
Sbjct: 121 FEVIDKTRPHSRNGSIVSRRSSHDQSKMGTLYAIVLYDFQAEKSDELTAYAGENLFICAH 180

Query: 86  ISPDWYKGKANNRV---GIFPANYV 107
            + +W+  K   R+   G+ P  +V
Sbjct: 181 HNYEWFIAKPIGRLGGPGLVPVAFV 205

>Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON}
           (120171..121835) [1665 nt, 555 aa]
          Length = 554

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRV---GIFPANYV 107
           Y   LYDF+A++  +L++  G+ + +    + +W+  K   R+   G+ P ++V
Sbjct: 156 YAIVLYDFQAEKSDELTVYVGENLFICAHHNYEWFIAKPIGRLGGPGLVPVDFV 209

>Ecym_7161 Chr7 (337456..339549) [2094 bp, 697 aa] {ON} similar to
           Ashbya gossypii AGL313C
          Length = 697

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%)

Query: 51  NADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVG 100
           N+D EE +E    F  Q  G L++  GD +Q++ K   +    K  NR+G
Sbjct: 86  NSDEEEEIEVQRGFVGQSSGYLNIHQGDIVQLINKGHNNLLYVKLVNRLG 135

>KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly
           similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 187

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYV 107
           ALYDF  + D +L L+ GD + +  +    W   +     R G+ P  YV
Sbjct: 73  ALYDFVPENDNELELREGDVLFIGYRHGQGWLVAENAERTRTGLVPEEYV 122

>KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.170
           YJL020C
          Length = 855

 Score = 32.0 bits (71), Expect = 1.5,   Method: Composition-based stats.
 Identities = 27/107 (25%), Positives = 42/107 (39%), Gaps = 15/107 (14%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK-----ANNRVGIFPANYVKPAFTRS 114
           A + +E++ + DL+ K G KI V      +WY G+          GIFP ++V      +
Sbjct: 12  AQFAYESEFEDDLNFKAGQKITVTAIEDDEWYAGEYEADGGTVASGIFPKSFV------T 65

Query: 115 VLTKPEEGDLXXXXXXXXXXXXXXXXXXXQYPPQQTP----ASYAPP 157
           V+TK  E                        PP+ T     A++ PP
Sbjct: 66  VVTKQTEAQEVPAAPAAPAAEPQSDAPKTTAPPKATALPQTAAFPPP 112

>Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON}
           (60698..63340) [2643 nt, 881 aa]
          Length = 880

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVL---EKISPDWYKGK--ANNRVGIFPANYVK 108
           A+ ++  + + +L  K GDKIQV+   E+ +  WY GK     + G++PA + +
Sbjct: 38  AINEYSRRMEDELDFKPGDKIQVITDDEEYNDGWYYGKNLRTQQEGLYPAVFTQ 91

>Suva_10.58 Chr10 (117228..121007) [3780 bp, 1259 aa] {ON} YLL016W
           (REAL)
          Length = 1259

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 16/77 (20%)

Query: 56  EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRV-----------GIFPA 104
           + VE  Y+  ++    LSL+ GD + VL K +  W+ G                 G FP 
Sbjct: 28  DVVECTYEHFSESRDKLSLRLGDLVYVLNKGTNGWWDGVLIRHCADDSSPLMLDRGWFPC 87

Query: 105 NYVKPAFTRSVLTKPEE 121
                +FTR++L  P +
Sbjct: 88  -----SFTRTILHDPRK 99

>Kwal_27.12027 s27 complement(1054171..1055670) [1500 bp, 499 aa]
           {ON} YBR200W (BEM1) - contains two SH3 domains [contig
           24] FULL
          Length = 499

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 38  LPEKWNDNTRSPNNADTEE--YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKA 95
           L ++  +N  S NN+      Y   LYDF A++  +L+   G+ + +    + +W+  K 
Sbjct: 76  LSQQGQNNHASMNNSQKSGSLYAIVLYDFRAEKSDELTTYAGENLFICAHHNYEWFIAKP 135

Query: 96  NNRV---GIFPANYV 107
             R+   G+ P  +V
Sbjct: 136 IGRLGGPGLVPVGFV 150

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 4/62 (6%)

Query: 54  TEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK--ANNRVGIFPANYVKPAF 111
           T++ ++ALY+++AQ   +LS   G+   V++    +WY      ++R G+ P +Y + +F
Sbjct: 4   TDKVIKALYNYQAQSPRELSFVKGEFF-VVQAEDKEWYDAANPQDHRRGMVPKSYFE-SF 61

Query: 112 TR 113
            R
Sbjct: 62  AR 63

>KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} similar
           to uniprot|P39969 Saccharomyces cerevisiae YER114C BOI2
           Protein implicated in polar growth functionally
           redundant with Boi1p interacts with bud- emergence
           protein Bem1p contains an SH3 (src homology 3) domain
           and a PH (pleckstrin homology) domain
          Length = 1025

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 9/63 (14%)

Query: 61  LYDFEAQQDGDLSLKTGDKIQVL---EKISPDWYKGK--ANNRVGIFPANYV----KPAF 111
           + ++  + + +L +K GDKIQV+   E+ +  WY G+    N  G++P  +     KP+ 
Sbjct: 39  ITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLYPKVFTQEISKPSL 98

Query: 112 TRS 114
            R+
Sbjct: 99  VRA 101

>TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {ON}
           Anc_8.539 YBR200W
          Length = 600

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRV---GIFPANYV 107
           Y   LYDF+A++  +L++  G+ + +    + +W+  K   R+   G+ P ++V
Sbjct: 162 YAIVLYDFQAEKSDELTVFAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVDFV 215

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 58  VEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGK-----ANNRVGIFPANYV 107
           VEAL+ + +  + DL    G  I VLE    +W+ G+        + GIFP  +V
Sbjct: 7   VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFV 61

>CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310c CDC25 GDP/GTP exchange factor for RAS1P and
           RAS2P
          Length = 1564

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 8/62 (12%)

Query: 56  EYVEALYDFEA--QQDGDLSLKTGDKIQVLEKISPDWYKG-----KANNRV-GIFPANYV 107
           + V   ++F A  +++  LS++ GD + VL K    W+ G     K++  V G FP NY 
Sbjct: 20  DVVVVQFEFNAGNKKEKYLSMQPGDTVYVLAKDQSGWWDGLIIDEKSDKAVRGWFPQNYT 79

Query: 108 KP 109
           KP
Sbjct: 80  KP 81

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNR--VGIFPANYVK 108
           A+Y F  + D +L LK GD + +  K    W   + ++R   G+ P  YV+
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQ 117

>Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 10/67 (14%)

Query: 58  VEALYDFEAQQDG--DLSLKTGDKIQVLEKISPDWYKGK-ANNRVGIFPANYVKPAFTRS 114
            +ALY ++A  +   ++S +  + +QV   I   W+K + AN   GI P+NYV+      
Sbjct: 306 AKALYPYDADDEDAYEISFEQNEILQV-SDIEGRWWKARRANGETGIIPSNYVQ------ 358

Query: 115 VLTKPEE 121
           ++  PEE
Sbjct: 359 LIDGPEE 365

>KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {ON}
           Anc_8.344 YDR162C
          Length = 249

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYV 107
           ALYDFE + D +L L  GD + +  +    W   + +   + G+ P  +V
Sbjct: 117 ALYDFEPENDNELGLHEGDIVFISYRHGQGWLVAENQPRTKTGLVPEEFV 166

>NCAS0B03360 Chr2 (587093..587794) [702 bp, 233 aa] {ON} Anc_8.344
           YDR162C
          Length = 233

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 8/78 (10%)

Query: 49  PNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANY 106
           PN+    ++  A+YDF  + + +L LK  D + +  K    W   + +A  + G+ P  +
Sbjct: 104 PNDYVVNQWAVAIYDFVPENENELDLKENDIVFISYKHGQGWLVAENEARTKTGLVPEEF 163

Query: 107 VKPAFTRSVLTKPEEGDL 124
           V      S L   EE D+
Sbjct: 164 V------SYLQPEEEADM 175

>TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON}
           Anc_8.344 YDR162C
          Length = 264

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY--KGKANNRVGIFPANYV 107
           ALYDFE + D +L L  GD + +  +    W   + +   + G+ P  +V
Sbjct: 121 ALYDFEPENDNELGLTEGDIVYISYRHGQGWLVAENQEGTKTGLVPEEFV 170

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.133    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,527,952
Number of extensions: 728094
Number of successful extensions: 2580
Number of sequences better than 10.0: 316
Number of HSP's gapped: 2521
Number of HSP's successfully gapped: 350
Length of query: 241
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 135
Effective length of database: 41,326,803
Effective search space: 5579118405
Effective search space used: 5579118405
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)