Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2313.499ON25825812950.0
YGR135W (PRE9)3.499ON25825812811e-180
Suva_7.4233.499ON25825812791e-180
Skud_7.4463.499ON25825812651e-178
NDAI0G008903.499ON25424712211e-171
Kpol_480.103.499ON25924712111e-170
NCAS0E007603.499ON25924711961e-167
KAFR0C020203.499ON25824711831e-166
ZYRO0D09746g3.499ON25324611741e-164
SAKL0F02530g3.499ON25224711611e-162
TDEL0D056703.499ON25524711591e-162
CAGL0I10406g3.499ON25724711591e-162
TPHA0A057003.499ON25624711561e-161
KNAG0B007603.499ON25924711441e-160
Ecym_12303.499ON25124711171e-156
AFR318W3.499ON25124711151e-155
KLTH0G02376g3.499ON25124711071e-154
Kwal_47.188983.499ON25124711031e-153
KLLA0E03917g3.499ON24924711021e-153
TBLA0D029203.499ON25824810311e-142
Ecym_81518.871ON2502474249e-51
ADL354W8.871ON2502474134e-49
KLTH0E16324g8.871ON2502134074e-48
TPHA0C049308.871ON2502474049e-48
KNAG0J001808.871ON2502194031e-47
NDAI0C034005.64ON2632403997e-47
CAGL0H07007g8.871ON2502133988e-47
NCAS0D013405.64ON2612043972e-46
KLLA0D10373g8.871ON2502133952e-46
NDAI0E001608.871ON2502133944e-46
SAKL0H02068g5.64ON2612033944e-46
KLLA0B11836g7.120ON2542043934e-46
KLTH0H00528g5.64ON2612043911e-45
Kwal_56.247805.64ON2622193921e-45
KAFR0L020808.871ON2502133901e-45
Kpol_455.58.871ON2492473901e-45
TBLA0C063408.871ON2562533902e-45
NCAS0F010307.120ON2532043892e-45
Ecym_51005.64ON2612043884e-45
Smik_13.438.871ON2502133865e-45
Kpol_1062.25.64ON2602043875e-45
TPHA0H011905.64ON2602033875e-45
SAKL0D00440g8.871ON2502473865e-45
KLLA0A05093g5.64ON2622043866e-45
Suva_13.568.871ON2502133849e-45
CAGL0I02442g5.64ON2602043851e-44
TBLA0J019807.120ON2542043841e-44
KAFR0G030307.120ON2542043841e-44
AER296W5.64ON2602033841e-44
TBLA0C066205.64ON2622193841e-44
KAFR0B044405.64ON2602043842e-44
KNAG0K004505.64ON2672193842e-44
Skud_13.518.871ON2502133822e-44
YML092C (PRE8)8.871ON2502133822e-44
TDEL0G008805.64ON2602033822e-44
NDAI0H015207.120ON2522043813e-44
SAKL0F04224g7.120ON2522043804e-44
Kwal_YGOB_Anc_7.1207.120ON2542043805e-44
NCAS0B001508.871ON2502133796e-44
KLTH0F13574g7.120ON2542043796e-44
TDEL0B004008.871ON2502413771e-43
TPHA0I020707.120ON2562163771e-43
AAR012C7.120ON2512043762e-43
ZYRO0G04136g7.120ON2542183762e-43
Smik_15.1297.120ON2542043762e-43
CAGL0F01199g7.120ON2542073753e-43
Suva_15.1317.120ON2542043743e-43
YOL038W (PRE6)7.120ON2542043744e-43
Skud_15.1197.120ON2542043736e-43
ZYRO0A00616g8.871ON2502473727e-43
Kpol_1023.1087.120ON2542043711e-42
ZYRO0C11770g5.64ON2602043711e-42
Ecym_12727.120ON2512043701e-42
YGR253C (PUP2)5.64ON2602043622e-41
Suva_7.5495.64ON2602043623e-41
Skud_7.5865.64ON2602043613e-41
TDEL0H033007.120ON2562043614e-41
Smik_16.545.64ON2602043604e-41
KNAG0L010207.120ON2661763537e-40
ZYRO0C00792g7.20ON2901953216e-35
TBLA0E006907.20ON2781953172e-34
CAGL0H06105g7.20ON2901943122e-33
Smik_15.5467.20ON2881723084e-33
Kpol_538.407.20ON2741953076e-33
ADR401C7.20ON2792313041e-32
Suva_8.4197.20ON2921723052e-32
KLTH0D00902g7.20ON2771723042e-32
Skud_15.5307.20ON2881953042e-32
KAFR0C050007.20ON2811723023e-32
NCAS0I002507.20ON2921723023e-32
YOR362C (PRE10)7.20ON2881723024e-32
KLLA0A03487g7.20ON2751722989e-32
AGL089W4.110ON2461822942e-31
KNAG0E002307.20ON2791882953e-31
Ecym_50197.20ON2851722945e-31
NDAI0A087707.20ON2921952946e-31
TPHA0N002407.20ON2771722911e-30
TDEL0H043107.20ON2741722902e-30
Ecym_72334.110ON2461822882e-30
KNAG0E011805.1ON2332352872e-30
SAKL0D14476g7.20ON2811942893e-30
KLLA0A05027g4.110ON2461912821e-29
TBLA0C040804.110ON2531822812e-29
Kwal_27.97208.871ON1731392752e-29
KLTH0B09504g5.1ON2332192783e-29
Kpol_1061.454.110ON2561772787e-29
YMR314W (PRE5)5.1ON2342362732e-28
KLTH0E07788g4.110ON2461822733e-28
CAGL0M14003g5.1ON2332312723e-28
Kwal_47.174934.110ON2461822724e-28
ZYRO0C01144g5.1ON2332232697e-28
Smik_13.5315.1ON2342362689e-28
Skud_13.4885.1ON2342362681e-27
Kwal_26.94835.1ON2332212681e-27
SAKL0H21956g4.110ON2481912681e-27
TPHA0F006704.110ON2571772691e-27
ZYRO0G10164g4.110ON2532022672e-27
NCAS0A016404.110ON2531772663e-27
YGL011C (SCL1)4.110ON2521772663e-27
NCAS0D023105.1ON2332192644e-27
AGL336W5.1ON3062212685e-27
Suva_7.2704.110ON2521772646e-27
Suva_13.5075.1ON2342202636e-27
Smik_7.2794.110ON2521772621e-26
Kpol_1060.15.1ON2332192611e-26
Ecym_56505.1ON2332192592e-26
Skud_7.2764.110ON2521772602e-26
KLLA0A10153g5.1ON2331932583e-26
TDEL0F023604.110ON2531792593e-26
TPHA0A056705.1ON2332232583e-26
CAGL0A00407g4.110ON2541772584e-26
NDAI0I026405.1ON2332192557e-26
KAFR0I027205.1ON2352352532e-25
KNAG0D035404.110ON2521772542e-25
TBLA0C071905.1ON2332192487e-25
SAKL0H00946g5.1ON2332192435e-24
KAFR0F034304.110ON2521792392e-23
TDEL0G002405.1ON2382242234e-21
Kwal_26.68197.20ON1961171602e-12
NDAI0D035604.110ON172801512e-11
Smik_15.3375.507ON2611611295e-08
Skud_15.3215.507ON2611611271e-07
Suva_8.2085.507ON2611611252e-07
KAFR0C053005.507ON2611861233e-07
KNAG0B038005.507ON2611611233e-07
YOR157C (PUP1)5.507ON2611611233e-07
SAKL0G04290g5.507ON2611831215e-07
NDAI0C011705.507ON2631651215e-07
TDEL0A037105.507ON2611831215e-07
KLLA0F12936g5.216ON2152121206e-07
TPHA0E020505.507ON2611721208e-07
CAGL0L04312g5.507ON2611611172e-06
ZYRO0D12034g5.507ON2611641172e-06
AGL324W7.480ON2431581162e-06
Kpol_534.575.216ON2152121143e-06
Kpol_2002.1095.216ON2152121143e-06
Ecym_54585.507ON2581641145e-06
KLLA0A02233g5.507ON2621611145e-06
Suva_12.805.216ON2152111126e-06
TBLA0D017505.507ON2591681136e-06
Skud_10.2225.216ON2152121126e-06
TDEL0E041305.216ON2192081127e-06
YJL001W (PRE3)5.216ON2152111119e-06
Kpol_218.15.507ON2611611111e-05
NCAS0A148807.480ON2412291111e-05
Kwal_33.151935.216ON1932041091e-05
KAFR0B006507.480ON2412251101e-05
NDAI0J006007.480ON2412381101e-05
Kwal_47.187485.507ON2631711102e-05
TPHA0N007405.216ON2162131092e-05
Smik_10.2785.216ON2162111092e-05
NCAS0H024805.507ON2641881102e-05
KLLA0E05633g7.480ON2401591092e-05
TPHA0E029905.216ON2162131092e-05
KNAG0F035907.480ON2482251092e-05
ZYRO0B10142g5.216ON2152111072e-05
Ecym_82765.216ON2152081073e-05
KLTH0G03168g5.507ON2631711074e-05
KLTH0E01826g7.480ON2421791064e-05
SAKL0G12584g5.216ON2152121054e-05
SAKL0F15092g7.480ON2611831064e-05
AAL172C5.216ON2152081055e-05
TBLA0C062005.216ON2162101038e-05
NDAI0C024205.216ON2162121038e-05
Suva_16.4293.417ON2872121048e-05
Ecym_71717.480ON2422091021e-04
CAGL0F04477g7.480ON2421731021e-04
Kpol_1028.927.480ON2421871021e-04
Skud_16.3883.417ON2872121022e-04
Kwal_55.198827.480ON2421741012e-04
TDEL0C034407.480ON2411771012e-04
AAR119W5.507ON2591741012e-04
TBLA0F026807.480ON2412061003e-04
YPR103W (PRE2)3.417ON287212994e-04
KAFR0C063505.216ON216209975e-04
Suva_2.777.480ON241173976e-04
TPHA0E004207.480ON241229967e-04
KLTH0B03102g5.216ON215209967e-04
KLTH0D03058g3.417ON287181977e-04
KNAG0H024505.216ON216209968e-04
NCAS0A114403.417ON287173978e-04
ZYRO0G17842g7.480ON244206968e-04
Smik_16.3433.417ON287212969e-04
TPHA0M017503.417ON286173960.001
TDEL0C055403.417ON287218950.001
AEL326C3.417ON285173950.001
KNAG0A075203.417ON287177950.001
CAGL0D03058g5.216ON215209930.002
ZYRO0C17688g3.417ON287217940.002
NDAI0A048603.417ON287173940.002
YBL041W (PRE7)7.480ON241215910.003
TBLA0F017603.417ON287181920.003
Skud_2.617.480ON241215910.003
Smik_2.737.480ON241215910.003
CAGL0G01804g3.417ON286203910.004
NCAS0A014805.216ON216210900.004
Kwal_26.72733.417ON287173900.005
Kpol_1018.1443.417ON288173890.007
SAKL0B09262g3.417ON287173870.013
Ecym_26143.417ON285173860.018
KLLA0F08228g3.417ON285173850.021
KAFR0D042103.417ON287173850.026
Smik_7.1736.159ON34942750.49
Kwal_23.29492.191ON161767702.7
KLTH0G00550g3.574ON265179673.5
TDEL0B071102.618ON88856675.6
TPHA0A007303.106ON717104666.5
TDEL0D023501.364ON678163667.2
YER012W (PRE1)7.162ON198161647.6
Skud_5.1167.162ON198161647.8
KLTH0C07348g3.269ON316127649.1
ZYRO0G06600g5.702ON182054659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.231
         (258 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W (...   503   0.0  
YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3...   498   e-180
Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W (...   497   e-180
Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W (...   491   e-178
NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON...   474   e-171
Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON} ...   471   e-170
NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499     465   e-167
KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.49...   460   e-166
ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {O...   456   e-164
SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {O...   451   e-162
TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3....   451   e-162
CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa] ...   451   e-162
TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....   449   e-161
KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON...   445   e-160
Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON} ...   434   e-156
AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic h...   434   e-155
KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {O...   431   e-154
Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR13...   429   e-153
KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {O...   429   e-153
TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON...   401   e-142
Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa] ...   167   9e-51
ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON} S...   163   4e-49
KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 2...   161   4e-48
TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8....   160   9e-48
KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871...   159   1e-47
NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON...   158   7e-47
CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {O...   157   8e-47
NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64      157   2e-46
KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {O...   156   2e-46
NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON} ...   156   4e-46
SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly ...   156   4e-46
KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highl...   155   4e-46
KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly si...   155   1e-45
Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa] ...   155   1e-45
KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.8...   154   1e-45
Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432) ...   154   1e-45
TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {...   154   2e-45
NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120     154   2e-45
Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON} ...   154   4e-45
Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON} ...   153   5e-45
Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906...   153   5e-45
TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON...   153   5e-45
SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,...   153   5e-45
KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly ...   153   6e-45
Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON} ...   152   9e-45
CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {O...   152   1e-44
TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.1...   152   1e-44
KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON...   152   1e-44
AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic h...   152   1e-44
TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {...   152   1e-44
KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64...   152   2e-44
KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}...   152   2e-44
Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON} ...   151   2e-44
YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}  PR...   151   2e-44
TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64...   151   2e-44
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120     151   3e-44
SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 a...   150   4e-44
Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131...   150   5e-44
NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON} ...   150   6e-44
KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893) ...   150   6e-44
TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871 ...   149   1e-43
TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.12...   149   1e-43
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...   149   2e-43
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...   149   2e-43
Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W...   149   2e-43
CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {O...   149   3e-43
Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W...   148   3e-43
YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha ...   148   4e-43
Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W...   148   6e-43
ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}...   147   7e-43
Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON} (2523...   147   1e-42
ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {O...   147   1e-42
Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa] ...   147   1e-42
YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}  P...   144   2e-41
Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}...   144   3e-41
Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}...   143   3e-41
TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON...   143   4e-41
Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C (R...   143   4e-41
KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {O...   140   7e-40
ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly si...   128   6e-35
TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON...   126   2e-34
CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly ...   124   2e-33
Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {O...   123   4e-33
Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON} ...   122   6e-33
ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 ...   121   1e-32
Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}...   122   2e-32
KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {...   121   2e-32
Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {O...   121   2e-32
KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20...   120   3e-32
NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON} ...   120   3e-32
YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}...   120   4e-32
KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 a...   119   9e-32
AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic hom...   117   2e-31
KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20 Y...   118   3e-31
Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}...   117   5e-31
NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {...   117   6e-31
TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20 ...   116   1e-30
TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON...   116   2e-30
Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to...   115   2e-30
KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON...   115   2e-30
SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369) ...   115   3e-30
KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly ...   113   1e-29
TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON...   112   2e-29
Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON} ...   110   2e-29
KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {O...   111   3e-29
Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {...   111   7e-29
YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha ...   109   2e-28
KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly ...   109   3e-28
CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} high...   109   3e-28
Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C...   109   4e-28
ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}...   108   7e-28
Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W...   107   9e-28
Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W...   107   1e-27
Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {...   107   1e-27
SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highl...   107   1e-27
TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.11...   108   1e-27
ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly ...   107   2e-27
NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON...   107   3e-27
YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}  S...   107   3e-27
NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON...   106   4e-27
AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homol...   107   5e-27
Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}...   106   6e-27
Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W...   105   6e-27
Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}...   105   1e-26
Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON} c...   105   1e-26
Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON...   104   2e-26
Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}...   104   2e-26
KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {O...   103   3e-26
TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON...   104   3e-26
TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON}             103   3e-26
CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly si...   103   4e-26
NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1       102   7e-26
KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1 ...   102   2e-25
KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON...   102   2e-25
TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5....   100   7e-25
SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly ...    98   5e-24
KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON...    97   2e-23
TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON} ...    91   4e-21
Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C (P...    66   2e-12
NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON...    63   2e-11
Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {O...    54   5e-08
Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {O...    54   1e-07
Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}...    53   2e-07
KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5....    52   3e-07
KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON...    52   3e-07
YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}  ...    52   3e-07
SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly ...    51   5e-07
NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON...    51   5e-07
TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.50...    51   5e-07
KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590) ...    51   6e-07
TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON...    51   8e-07
CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {...    50   2e-06
ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highl...    50   2e-06
AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic hom...    49   2e-06
Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON} (145742....    49   3e-06
Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON} (2589...    49   3e-06
Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to...    49   5e-06
KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {O...    49   5e-06
Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa...    48   6e-06
TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON...    48   6e-06
Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 a...    48   6e-06
TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 ...    48   7e-06
YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {...    47   9e-06
Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON} comp...    47   1e-05
NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {...    47   1e-05
Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL00...    47   1e-05
KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.48...    47   1e-05
NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.4...    47   1e-05
Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {O...    47   2e-05
TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.2...    47   2e-05
Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 a...    47   2e-05
NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507      47   2e-05
KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {O...    47   2e-05
TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON...    47   2e-05
KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON...    47   2e-05
ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648...    46   2e-05
Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp...    46   3e-05
KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly ...    46   4e-05
KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly ...    45   4e-05
SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137) ...    45   4e-05
SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highl...    45   4e-05
AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 ...    45   5e-05
TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5....    44   8e-05
NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON...    44   8e-05
Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W...    45   8e-05
Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON} ...    44   1e-04
CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {O...    44   1e-04
Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON} (21109...    44   1e-04
Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W...    44   2e-04
Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W...    44   2e-04
TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON...    44   2e-04
AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic hom...    44   2e-04
TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON...    43   3e-04
YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5...    43   4e-04
KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [...    42   5e-04
Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W (R...    42   6e-04
TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480 ...    42   7e-04
KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648...    42   7e-04
KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {O...    42   7e-04
KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 ...    42   8e-04
NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3....    42   8e-04
ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa] ...    42   8e-04
Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W...    42   9e-04
TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.4...    42   0.001
TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.41...    41   0.001
AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON} Synt...    41   0.001
KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3....    41   0.001
CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {O...    40   0.002
ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highl...    41   0.002
NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {...    41   0.002
YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6 ...    40   0.003
TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON...    40   0.003
Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W (R...    40   0.003
Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W (R...    40   0.003
CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {O...    40   0.004
NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON...    39   0.004
Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON...    39   0.005
Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa] ...    39   0.007
SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly ...    38   0.013
Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar ...    38   0.018
KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {O...    37   0.021
KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.41...    37   0.026
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    33   0.49 
Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C ...    32   2.7  
KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly si...    30   3.5  
TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa] ...    30   5.6  
TPHA0A00730 Chr1 (131951..134104) [2154 bp, 717 aa] {ON} Anc_3.1...    30   6.5  
TDEL0D02350 Chr4 (456952..458988) [2037 bp, 678 aa] {ON} Anc_1.3...    30   7.2  
YER012W Chr5 (177835..178431) [597 bp, 198 aa] {ON}  PRE1Beta 4 ...    29   7.6  
Skud_5.116 Chr5 (174986..175582) [597 bp, 198 aa] {ON} YER012W (...    29   7.8  
KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly ...    29   9.1  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    30   9.4  

>Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  503 bits (1295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/258 (96%), Positives = 249/258 (96%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240

Query: 241 KTGITKKXXXXXXXXXMK 258
           KTGITKK         MK
Sbjct: 241 KTGITKKDEDEEADEEMK 258

>YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3
           subunit of the 20S proteasome, the only nonessential 20S
           subunit; may be replaced by the alpha 4 subunit (Pre6p)
           under stress conditions to create a more active
           proteasomal isoform
          Length = 258

 Score =  498 bits (1281), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 245/258 (94%), Positives = 248/258 (96%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSTEKLYKLNDKI+VAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KDDMKVDDAI+LALKTLSKTTDSSALTYDRLEFATIRKG NDGEVYQKIFKPQEIKD+LV
Sbjct: 181 KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV 240

Query: 241 KTGITKKXXXXXXXXXMK 258
           KTGITKK         MK
Sbjct: 241 KTGITKKDEDEEADEDMK 258

>Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  497 bits (1279), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 244/258 (94%), Positives = 248/258 (96%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSTEKLYKLNDKI+VAVAGLTADAEILINTAR+HAQNYLK+YNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAG+DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKG NDGEVYQKIFKPQEIKDLLV
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLV 240

Query: 241 KTGITKKXXXXXXXXXMK 258
           KTGITKK         MK
Sbjct: 241 KTGITKKDEDEEADEEMK 258

>Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  491 bits (1265), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 242/258 (93%), Positives = 247/258 (95%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSTEKLYKLNDKI+VAVAGLTADAEILINTAR+HAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAG+DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           K+DMKVD AIDLALKTLSKTTDSSALTYDRLEFATIRKG NDGEVYQKIFKPQEIKDLLV
Sbjct: 181 KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKGPNDGEVYQKIFKPQEIKDLLV 240

Query: 241 KTGITKKXXXXXXXXXMK 258
           KTGI+KK         MK
Sbjct: 241 KTGISKKDEDDEADQEMK 258

>NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON}
           Anc_3.499
          Length = 254

 Score =  474 bits (1221), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/247 (92%), Positives = 241/247 (97%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKI+VAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KDDM++D+AI+LALKTLSKTTDSS+LTYD+LEFATI+KG NDGEVYQKI+KP EIK+LL+
Sbjct: 181 KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKGKNDGEVYQKIYKPDEIKELLI 240

Query: 241 KTGITKK 247
           KTG+TKK
Sbjct: 241 KTGVTKK 247

>Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON}
           complement(20212..20991) [780 nt, 260 aa]
          Length = 259

 Score =  471 bits (1211), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/247 (92%), Positives = 243/247 (98%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSTEK+Y+LNDKI+VAVAGLTADAEILINTAR+HAQ YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KDD+KVD+AI+LALKTLSKTTDSSALTYDR+EFATI+KG ND ++YQKIFKP+EIK LL+
Sbjct: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEND-KIYQKIFKPEEIKQLLL 239

Query: 241 KTGITKK 247
           KTGITKK
Sbjct: 240 KTGITKK 246

>NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499
          Length = 259

 Score =  465 bits (1196), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 224/247 (90%), Positives = 241/247 (97%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSTEKLYKLNDKI+VAVAGLTADAEILINTAR++AQ+YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KD+MK+DDAI+LALKTLSKTTDSS+LTYD+LE ATI+KG    EVYQKI+KP+E+K+LL+
Sbjct: 181 KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKGTTTDEVYQKIYKPEELKELLL 240

Query: 241 KTGITKK 247
           KTGITKK
Sbjct: 241 KTGITKK 247

>KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.499
           YGR135W
          Length = 258

 Score =  460 bits (1183), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/247 (90%), Positives = 235/247 (95%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKI+VAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KD++ +DDA++LALKTLSK TDSS LTYDRLEFATI+KG  + ++YQKIF P EIK LLV
Sbjct: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240

Query: 241 KTGITKK 247
           KTGI+KK
Sbjct: 241 KTGISKK 247

>ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 253

 Score =  456 bits (1174), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 224/246 (91%), Positives = 237/246 (96%), Gaps = 1/246 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSTEKLY+LNDKI VAVAGLT+DAEILINTARIHAQNYLKTYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KDD+KVD AI+LALKTLSKTTDSSALTYDR+EFATI+ G N G++YQK+FKP+EI+ LLV
Sbjct: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGEN-GKLYQKVFKPEEIQTLLV 239

Query: 241 KTGITK 246
           K GITK
Sbjct: 240 KNGITK 245

>SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 252

 Score =  451 bits (1161), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 220/247 (89%), Positives = 238/247 (96%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS+EKLYKLND I+VAVAGLTADAEILINTAR++AQNYL+TYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KD + +D AI+LALKTLSKTTDSSALT+DR+EFATI+KG N G++YQKI+KPQEI+ LL 
Sbjct: 181 KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKGSN-GQLYQKIYKPQEIQTLLS 239

Query: 241 KTGITKK 247
           KTGITKK
Sbjct: 240 KTGITKK 246

>TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3.499
           YGR135W
          Length = 255

 Score =  451 bits (1159), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 221/247 (89%), Positives = 239/247 (96%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSTEKLY+LNDKI+VAVAGLTADAEILINTAR++AQNYL+TYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KDD+K++ AI+LALKTLSKTTDSSALT DR+EFATI+K   DG++YQKIFKP+EI+ LLV
Sbjct: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKA-PDGKLYQKIFKPEEIQSLLV 239

Query: 241 KTGITKK 247
           K GITKK
Sbjct: 240 KHGITKK 246

>CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa]
           {ON} highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135w proteasome subunit Y13
          Length = 257

 Score =  451 bits (1159), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 218/247 (88%), Positives = 235/247 (95%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM S+GIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSTEKLYKLND+ +VAVAGLTADAEILINTARIHAQNYLKTYNE+IPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQ+GGLRP+GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KD+M +DDA++LALKTLSKTTDSS+LTYDRLEFAT++K     E  QKIFKP EIK LL+
Sbjct: 181 KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKKGETEEFEQKIFKPAEIKQLLI 240

Query: 241 KTGITKK 247
           KTGI+KK
Sbjct: 241 KTGISKK 247

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score =  449 bits (1156), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 218/247 (88%), Positives = 237/247 (95%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSTEKLYKLND I+VAVAGLTADAEILINTAR+ AQNYL+TYNEDIPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KDD+K++ AI+LALKTLSKTTDSSALTYDR+EFATI+KG N+ +VYQKI+KP+EIK LL 
Sbjct: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN-KVYQKIYKPEEIKQLLS 239

Query: 241 KTGITKK 247
           K GITKK
Sbjct: 240 KAGITKK 246

>KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON}
           Anc_3.499 YGR135W
          Length = 259

 Score =  445 bits (1144), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 211/247 (85%), Positives = 234/247 (94%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A DGIV+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSTEKLY+LNDKI VAVAGLTADAEILINTAR+H QNYLKTY EDIPVE+LV+R+SDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KD++ +++A +LALKTLSKTTDSSALTYDR+EF+TI++G  +G+V QKI+KP EIK LLV
Sbjct: 181 KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240

Query: 241 KTGITKK 247
           K+GITKK
Sbjct: 241 KSGITKK 247

>Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON}
           similar to Ashbya gossypii AFR318W
          Length = 251

 Score =  434 bits (1117), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 211/247 (85%), Positives = 232/247 (93%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS+EKLY+LND I+VAVAGLTADAEILINTAR+HAQNYLK YNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KD++  ++AI+LALKTLSKTTD+S+LT DRLEFATI++  N G++ QKI+KP EIK+LL 
Sbjct: 181 KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQDSN-GKLVQKIYKPSEIKELLQ 239

Query: 241 KTGITKK 247
           K+GI K+
Sbjct: 240 KSGIMKQ 246

>AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR135W (PRE9)
          Length = 251

 Score =  434 bits (1115), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 211/247 (85%), Positives = 229/247 (92%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS+EKLY+LND I+VAVAGLTADAEIL+NTAR+HAQNYLK YNE+IPVE+LVRRLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KDD+  DDAI LALKTLSKTTDSS+L+++RLEFATI++   DG+V QKI+K  EIKDLL 
Sbjct: 181 KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQRNA-DGKVVQKIYKLGEIKDLLE 239

Query: 241 KTGITKK 247
           KTGI K+
Sbjct: 240 KTGINKQ 246

>KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 251

 Score =  431 bits (1107), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/247 (84%), Positives = 232/247 (93%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +S+EKLYKLND I+VAVAGLTADAEILINTAR+ AQNYLK+YNE+IPVEILVRRLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KDD+ V++A +LALKTLSKTTDSS LT +R+EF+TI K +++G++ QKIFKPQEI+ LL 
Sbjct: 181 KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITK-LDNGKIAQKIFKPQEIETLLN 239

Query: 241 KTGITKK 247
           KTG+TKK
Sbjct: 240 KTGVTKK 246

>Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR135W
           (PRE9) - proteasome component Y13 [contig 189] FULL
          Length = 251

 Score =  429 bits (1103), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 208/247 (84%), Positives = 229/247 (92%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +S+EKLYKLND I+VAVAGLTADAEILINTAR+ AQNYLKTYNE+IPVEILVRRLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDR+GYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KDD+ V +A +LALKTLSKTTDSS LT +R+EFATI K + +G++ QKIFKP+EI+ LL 
Sbjct: 181 KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITK-LENGKIAQKIFKPREIETLLN 239

Query: 241 KTGITKK 247
           +TGI KK
Sbjct: 240 ETGINKK 246

>KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 249

 Score =  429 bits (1102), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 210/247 (85%), Positives = 227/247 (91%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM   GIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS+EKLYKLND I+VAVAGLTADAEILINTAR+ AQ+YLKTYNE+IPVE+LVRRLSD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240
           KDD+ +D AI+LALKTLSKTTDSS LT++RLEFATI K   +G++YQKI+KP EI  LL 
Sbjct: 181 KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISKDA-EGKIYQKIYKPTEIATLLE 239

Query: 241 KTGITKK 247
           KT I KK
Sbjct: 240 KTEIVKK 246

>TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON}
           Anc_3.499 YGR135W
          Length = 258

 Score =  401 bits (1031), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 218/248 (87%), Gaps = 1/248 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ DGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
              EKLYKL+DKI++AVAGLTADAEILIN AR  AQNYL TYNE+IPVEILV++LSDIKQ
Sbjct: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180

Query: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIR-KGVNDGEVYQKIFKPQEIKDLL 239
           KDDM ++DA++L LKTLSKTTDSS LTYDR+E + I+    ND ++ QKI+ P EIK LL
Sbjct: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL 240

Query: 240 VKTGITKK 247
           +K GI KK
Sbjct: 241 IKFGINKK 248

>Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa]
           {ON} similar to Ashbya gossypii ADL354W 1-intron
          Length = 250

 Score =  167 bits (424), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 148/247 (59%), Gaps = 15/247 (6%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K  STL   DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANSTLTLTDT-LD 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHA-QNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+ K+   I    +G+  D  +LIN +R  A  +Y+KTY E  P +ILV +++ I Q  T
Sbjct: 63  KISKITPDIGAVYSGMGPDFRVLINKSRKTAYGSYMKTYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+   + LY  +PSG+Y  WKA ++G   +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDNHNEFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNNE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVND-----------GEVYQKIFKP 232
           ++++DAI +AL TL ++ +      + +E A I +  +D           G  ++K F P
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGETIEVAVIGEENDDLLGYKGDATARGPRFRK-FTP 240

Query: 233 QEIKDLL 239
           QEI D L
Sbjct: 241 QEINDRL 247

>ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML092C
           (PRE8); 1-intron
          Length = 250

 Score =  163 bits (413), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 147/247 (59%), Gaps = 15/247 (6%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K  +TL  +DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANTTLTIKDT-LD 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHA-QNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+ ++   I    +G+  D  +LIN +R  A  +Y K Y E  P +ILV +++ I Q  T
Sbjct: 63  KVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVND-----------GEVYQKIFKP 232
           ++++DAI +AL TL ++ +      + +E A + +  +D           G  ++K F  
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGETIELAVVGEENDDMLGYKGDASAKGPRFRK-FTA 240

Query: 233 QEIKDLL 239
           QEI D L
Sbjct: 241 QEINDRL 247

>KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 250
           aa] {ON} similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  161 bits (407), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 133/213 (62%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+++A E+K TS+L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIRATNGVIIATEKKSTSSLALTE-SLS 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I  A +G+  D  +LI+ +R  A  +Y + YNE  P +ILV  ++ I Q  T
Sbjct: 63  KVAHITPDIGAAYSGMGPDFRVLIDKSRKVAHTHYKRIYNEYPPTKILVAEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATI 216
           ++++DAI +AL TL ++ +      D +E A +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVV 214

>TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  160 bits (404), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 91/247 (36%), Positives = 146/247 (59%), Gaps = 15/247 (6%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++GI A++G+++A E+K +S+L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKTSSSLALTEDIS- 62

Query: 64  EKLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGY 122
            K+  L   I    +G+  D  +L++ +R  A  NY + Y E    ++LV  ++ + Q  
Sbjct: 63  -KISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPSTKLLVSEIAKVMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA S+G  ++AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNN 181

Query: 183 DMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVND--------GEVYQKIFK--P 232
           +++++DAI +AL TL ++ +      D +E A +    ND        GEV  +  K  P
Sbjct: 182 ELELEDAIHIALLTLKESVEGE-FNGDTIEIAVVGDENNDLLGYKGVEGEVGPRFRKLSP 240

Query: 233 QEIKDLL 239
           QEI D L
Sbjct: 241 QEINDRL 247

>KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  159 bits (403), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 83/219 (37%), Positives = 135/219 (61%), Gaps = 3/219 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   DT + 
Sbjct: 4   RYAFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKSSSPLALTDTLS- 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y + YNE  P ++LV  ++++ Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEVMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYDD  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDDHRGFSLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVND 222
           ++++DAI +AL TL ++ +      D +E   I +  ND
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIGIIGEPNND 220

>NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON}
           Anc_5.64
          Length = 263

 Score =  158 bits (399), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 92/240 (38%), Positives = 141/240 (58%), Gaps = 9/240 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G+VL  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ ++   +  A++GLTADA  +I  AR+ A N+   Y+ED+ VE L + + D+     +
Sbjct: 66  KIVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLYYDEDMKVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AGYDD  GYQLY + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDL 238
           ++   + + +A  L LK L +  +   L  +  + + I K  N  ++Y      + IK++
Sbjct: 186 EWHSSLTLREAEVLVLKILKQVMEEK-LDENNAQLSCITKD-NGFQIYDNAKTAEIIKEM 243

>CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092c PRE8
          Length = 250

 Score =  157 bits (398), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 132/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA S+G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNNE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATI 216
           ++++DAI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVI 214

>NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64
          Length = 261

 Score =  157 bits (397), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/204 (41%), Positives = 126/204 (61%), Gaps = 7/204 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G+VL  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ ++   I  A++GLTADA  +I  AR+ A N+   Y+EDI VE L + + D+     +
Sbjct: 66  KIVEIEHHIGCAMSGLTADARSMIEHARVAAVNHNLYYDEDIKVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIAGYDNDEGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTD 202
           ++   + + +A  L LK L +  +
Sbjct: 186 EWHSSLTLKEAELLVLKILKQVME 209

>KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type
           subunit,
          Length = 250

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI +++GIV+A E+K +S+L   DT   
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIVIATEKKSSSSLALPDT-VS 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ AR  A  NY + Y E  P +ILV  ++ I Q  T
Sbjct: 63  KVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYGEYPPTKILVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG Y  WKA ++G  +SAA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWKATAIGKGSSAAKTFLEKRWNEE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATI 216
           ++++DAI +AL TL ++ +      D +E A +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAIV 214

>NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  156 bits (394), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 132/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T+IGI A++GIV+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R +   NY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATI 216
           ++++DAI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVI 214

>SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  156 bits (394), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 126/203 (62%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR+ A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARVSAVTHNLYYDEDIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYDAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMKVDDAIDLALKTLSKTTD 202
           +   + + +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P40303 Saccharomyces cerevisiae
           YOL038W PRE6 20S proteasome alpha-type subunit
          Length = 254

 Score =  155 bits (393), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 127/204 (62%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGADCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K+++ + ++ AGL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY-KDD 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A S+G N++  +  L+ +Y K++
Sbjct: 124 GGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWCAQSIGRNSNTVREFLEKNYNKNE 183

Query: 184 MKVD--DAIDLALKTLSKTTDSSA 205
              D  + + L +K+L +   + A
Sbjct: 184 PPADEKECVKLTIKSLLEVVQTGA 207

>KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  155 bits (391), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 125/204 (61%), Gaps = 7/204 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIG+  S+G+VL  E++VTS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ ++   +  A++GLTADA  +I  AR+ +  +   Y+EDI +E L + + D+     +
Sbjct: 66  KIVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYDEDISIESLTQSICDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTD 202
           ++   + + +A  L LK L +  +
Sbjct: 186 EWHSSLTLKEAELLVLKILKQVME 209

>Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa]
           {ON} YGR253C (PUP2) - 1:1 [contig 160] FULL
          Length = 262

 Score =  155 bits (392), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/219 (38%), Positives = 132/219 (60%), Gaps = 8/219 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+  S+G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + ++   +  A++GLTADA  +I  AR+ A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSAVTHNLYYDEEISVESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDQEQGYQLYHAEPSGTFYRFNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRK 218
           +   + + +A  L L+ L +  +   L  D  + +++ K
Sbjct: 187 WHSSLTLKEAELLVLRILKQVMEEK-LDEDNAQLSSVTK 224

>KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  154 bits (390), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 133/213 (62%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y + YNE  P ++LV  +++I Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHQGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATI 216
           ++++DAI +AL TL ++ +      D +E   I
Sbjct: 183 LELEDAIHIALLTLKESIEGE-FNGDTIEIGVI 214

>Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432)
           [750 nt, 250 aa]
          Length = 249

 Score =  154 bits (390), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 146/247 (59%), Gaps = 16/247 (6%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++GI A++G+++A E+K +S L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTEDVS- 62

Query: 64  EKLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGY 122
            K+  L   I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ I Q  
Sbjct: 63  -KISLLTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATAIGKGSIAAKTFLEKRWNN 181

Query: 183 DMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIR---------KGVND-GEVYQKIFKP 232
           +++++DAI +AL TL ++ +      D +E A +          KG +D G  ++K+   
Sbjct: 182 ELELEDAIHIALLTLKESVEGE-FNGDTIEIAIVGNNNQDMLGYKGTDDKGPRFRKL-TA 239

Query: 233 QEIKDLL 239
           QEI D L
Sbjct: 240 QEINDRL 246

>TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {ON}
           Anc_8.871 YML092C
          Length = 256

 Score =  154 bits (390), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/253 (37%), Positives = 139/253 (54%), Gaps = 21/253 (8%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    TA+GI A++G+VLA E+K  S+L   + S +
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYALTAVKQGVTALGIKATNGVVLATEKKSGSSLALAE-SLD 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    AG+  D  +L++ AR  A  NY + Y E  P   LV  ++ I Q  T
Sbjct: 63  KISLLTPNIGTVYAGMGPDCRVLVDKARKAAHTNYKRVYGEYPPTRQLVADVAAIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDD------RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
           Q GG+RPFGVS + AG+D+        G+ LY  +PSG Y  WKA +VG    AA+T L+
Sbjct: 123 QSGGVRPFGVSLLVAGHDNANENDSNSGFALYQVDPSGAYFPWKATAVGRGAVAAKTFLE 182

Query: 178 MDYKDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVND-----------GEVY 226
             + D+++++DA+ +AL  L +  +      D LE A + +  ND           G  +
Sbjct: 183 KRWHDELELEDAVHIALLALREAVEGE-FNGDTLEIAVVGEPNNDMLGFTGVEGQLGPRF 241

Query: 227 QKIFKPQEIKDLL 239
           +K+  PQEI D L
Sbjct: 242 RKL-TPQEINDRL 253

>NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120
          Length = 253

 Score =  154 bits (389), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDNKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --MKVDDAIDLALKTLSKTTDSSA 205
               V++ + L +K+L +   + A
Sbjct: 184 PPKNVEECVRLTVKSLLEVVQTGA 207

>Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON}
           similar to Ashbya gossypii AER296W
          Length = 261

 Score =  154 bits (388), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 126/204 (61%), Gaps = 7/204 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++VTS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ +++  I  A++GLTADA  +I  ARI +  +   Y+E+I VE L + + D+     +
Sbjct: 66  KIVEVDKHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEISVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIAGYDKEEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTD 202
           ++   + + +A  L LK L +  +
Sbjct: 186 EWYSSLTLKEAELLVLKILKQVME 209

>Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  153 bits (386), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAISETLS- 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  NY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATI 216
           ++++DAI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906)
           [783 nt, 261 aa]
          Length = 260

 Score =  153 bits (387), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 124/204 (60%), Gaps = 7/204 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTREGVVLGVEKRATSPLLESD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ ++++ I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +
Sbjct: 66  KIVEIDNHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVETLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIAGYDRDQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTD 202
           ++   + + +A  L LK L +  +
Sbjct: 186 EWHSSLTLKEAELLVLKILKQVME 209

>TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON}
           Anc_5.64 YGR253C
          Length = 260

 Score =  153 bits (387), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  ILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++GA +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYNAKAIGAGSEGAQSELQNE 186

Query: 180 YKDDMKVDDAIDLALKTLSKTTD 202
           +   + + +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKVLKQVME 209

>SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,
           250 aa] {ON} highly similar to uniprot|P23639
           Saccharomyces cerevisiae YML092C PRE8 20S proteasome
           beta-type subunit
          Length = 250

 Score =  153 bits (386), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 87/247 (35%), Positives = 143/247 (57%), Gaps = 15/247 (6%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+++A E+K +S L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTE-SLS 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y + Y E  P +ILV  ++   Q  T
Sbjct: 63  KVALITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKILVSEIAKTMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA ++G + +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKSATAAKTFLEKRWNEE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVND-----------GEVYQKIFKP 232
           ++++DAI +AL TL ++ +      D +E A + +  ND           G  ++K+   
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAIVSEENNDLLGYTGDARAKGPRFRKL-SS 240

Query: 233 QEIKDLL 239
           QEI D L
Sbjct: 241 QEINDRL 247

>KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 262

 Score =  153 bits (386), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 126/204 (61%), Gaps = 7/204 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIG++ ++GIVL  E++VTS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEGIVLGVEKRVTSALLESD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ +++  I  A++GLTADA  ++  AR++A  +   Y+E I VE L + + D+     +
Sbjct: 66  KIVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYDEKITVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ +  GYD   G+QLY + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTD 202
           ++   + + +A  L LK L +  +
Sbjct: 186 EWHSSLTLKEAESLVLKILKQVME 209

>Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  152 bits (384), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKTSSPLAMSETLS- 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATI 216
           ++++DAI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253c PUP2
          Length = 260

 Score =  152 bits (385), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 126/204 (61%), Gaps = 7/204 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIG++ S+G+VL  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSEGVVLGVEKRATSPLLESD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ +++  +  A++GLTADA  ++  AR+ A  +   Y+EDI +E L + + D+     +
Sbjct: 66  KIVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLYYDEDIKIESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTD 202
           ++   + + +A  L LK L +  +
Sbjct: 186 EWHSSLTLKEAEQLVLKILKQVME 209

>TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.120
           YOL038W
          Length = 254

 Score =  152 bits (384), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++      +GI  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCTVGIKGTDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K+++ I ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHKLTVEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDM 184
           GG+RPFG+S + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGISTLIAGFDPRDNTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYDRDE 183

Query: 185 K---VDDAIDLALKTLSKTTDSSA 205
                ++ I L +K+L +   + A
Sbjct: 184 PPSTAEECIKLTIKSLLEVVQTGA 207

>KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON}
           Anc_7.120 YOL038W
          Length = 254

 Score =  152 bits (384), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  ++ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGTNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K+++ I ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDM 184
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGLDPRDNTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNKDE 183

Query: 185 K---VDDAIDLALKTLSKTTDSSA 205
               V++ + L +K+L +   + A
Sbjct: 184 PPSTVEECVKLTIKSLLEVVQTGA 207

>AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR253C (PUP2)
          Length = 260

 Score =  152 bits (384), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 126/203 (62%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  ARI +  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMKVDDAIDLALKTLSKTTD 202
           +   + + +A  L LK L +  +
Sbjct: 187 WYSSLTLKEAELLVLKILKQVME 209

>TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {ON}
           Anc_5.64 YGR253C
          Length = 262

 Score =  152 bits (384), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 130/219 (59%), Gaps = 8/219 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSRLLESD-SIEK 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----QG 121
           + ++   I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIEKHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRK 218
           +   + + +A  L LK L +  +   L  + ++ + + K
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LNENNVQLSCVTK 224

>KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  152 bits (384), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 126/204 (61%), Gaps = 7/204 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TA+GI  S+G+VL  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAVGICTSEGVVLGVEKRATSPLLESD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ +++  +  A++GLTADA  +I  AR+ A ++   Y+EDI +E L + + D+     +
Sbjct: 66  KIVEIDRHVGCAMSGLTADARSMIEHARVAAVSHNLYYDEDIKIESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIAGYDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTD 202
           ++   + + +A  L LK L +  +
Sbjct: 186 EWHSSLTLKEAELLVLKILKQVME 209

>KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}
           Anc_5.64 YGR253C
          Length = 267

 Score =  152 bits (384), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 128/219 (58%), Gaps = 8/219 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTSAITHDLYYDENIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDADDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRK 218
           +   + + DA  L LK L +  +   L  + ++   I K
Sbjct: 187 WHSSLNMRDAEVLTLKILKQVMEEK-LDQNNVQLCCITK 224

>Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATI 216
           ++++DAI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}
           PRE8Alpha 2 subunit of the 20S proteasome
          Length = 250

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATI 216
           ++++DAI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 81/203 (39%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A  +   Y+ED+ VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDMSVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDKESGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMKVDDAIDLALKTLSKTTD 202
           +   + + +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score =  151 bits (381), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  ARI AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARIEAQSHRLTLEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNREE 183

Query: 184 --MKVDDAIDLALKTLSKTTDSSA 205
               VD+ + L +++L +   + A
Sbjct: 184 PPENVDECVRLTVRSLLEVVQTGA 207

>SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 aa]
           {ON} highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 252

 Score =  150 bits (380), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  + ++ AGL AD+ ILI  AR+ AQ++  T  + + ++ L R ++ I+Q YTQ 
Sbjct: 64  ISQIDTHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSIDYLTRYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDM 184
           GG+RPFGVS + AG+D   G  +LY + PSG Y+ W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDGVPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKEE 183

Query: 185 KV---DDAIDLALKTLSKTTDSSA 205
                 +A+ L +K+L +   + A
Sbjct: 184 PPATEQEAVKLTVKSLLEVVQTGA 207

>Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131)
           [765 bp, 254 aa] {ON} ANNOTATED BY YGOB -
          Length = 254

 Score =  150 bits (380), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 120/204 (58%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVVGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ AGL AD+ ILI  AR+ AQ++  T  + + V+ L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDM 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYVRDA 183

Query: 185 KV---DDAIDLALKTLSKTTDSSA 205
                 D + L +K L +   + A
Sbjct: 184 PPATEQDCVKLTVKALLEVVQTGA 207

>NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  150 bits (379), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  NY + Y    P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGVYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHKGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATI 216
           ++++DAI +AL TL ++ +      D +E   I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIGVI 214

>KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893)
           [765 bp, 254 aa] {ON} highly similar to uniprot|P40303
           Saccharomyces cerevisiae YOL038W PRE6 20S proteasome
           alpha-type subunit
          Length = 254

 Score =  150 bits (379), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 120/204 (58%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVIGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ AGL AD+ ILI  AR+ AQ++  T  + + V+ L R ++ ++Q YTQ 
Sbjct: 64  IAKIDSHVVLSFAGLNADSRILIEKARVEAQSHKLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDM 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGVYSAWSAQAIGRNSKTVREFLEKNYARDA 183

Query: 185 KV---DDAIDLALKTLSKTTDSSA 205
                 + + L +K L +   + A
Sbjct: 184 PPATEQECVKLTVKALLEVVQTGA 207

>TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 139/241 (57%), Gaps = 18/241 (7%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IGI A++G+V+A+E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVVIASEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSVITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  +  +
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWKATAIGRGSTAAKTFLEKRWNAE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLVKTG 243
           ++++DAI + L TL ++ +      D +E A +                +E KDLL  TG
Sbjct: 183 LELEDAIHIVLLTLKESVEGE-FNGDTIEIAVVG---------------EENKDLLGYTG 226

Query: 244 I 244
           +
Sbjct: 227 V 227

>TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.120
           YOL038W
          Length = 256

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 127/216 (58%), Gaps = 7/216 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K+++ I ++ +GL AD+ ILI  ARI AQ++  T  + + +E L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLEDPVSIEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDM 184
           GG+RPFGVS + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYNKDE 183

Query: 185 KV---DDAIDLALKTLSKTTDSSALTYDRLEFATIR 217
                ++ I L +K+L +   + A     +E   +R
Sbjct: 184 PPKNKEECIKLTVKSLLEVVQTGA---KNIEITVVR 216

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score =  149 bits (376), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 119/204 (58%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + ++++ + ++ AGL AD+ ILI  AR+ AQ++  T  + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDM 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y    
Sbjct: 124 GGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQAIGRNSKTVREFLEKNYSKHT 183

Query: 185 KV---DDAIDLALKTLSKTTDSSA 205
                 D + L +K+L +   + A
Sbjct: 184 PPASEQDCVKLTVKSLLEVVQTGA 207

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score =  149 bits (376), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 125/218 (57%), Gaps = 7/218 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLGCERRSTLKLQDSRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVSVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGV+ + AG+D D    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --MKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKG 219
                D+ + L  ++L +   + A     +E   +R G
Sbjct: 184 PPATADECVRLTTRSLLEVVQTGA---KNIEITVVRPG 218

>Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  149 bits (376), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDMKVDDAIDLALKTLSKTTDSSA 205
               V+D + L +++L +   + A
Sbjct: 184 PPATVEDCVKLTVRSLLEVVQTGA 207

>CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038w PRE6
          Length = 254

 Score =  149 bits (375), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 123/207 (59%), Gaps = 9/207 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTST-- 63
           YD   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+  STL  QDT    
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLGCERR--STLKLQDTRVIA 61

Query: 64  EKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
            K+  ++  + ++ AGL AD+ IL+N AR+ AQ++  T  + + VE + R ++ ++Q YT
Sbjct: 62  SKVLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPVTVEYMARYVAGVQQKYT 121

Query: 124 QHGGLRPFGVSFIYAGYDDR--YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Q GG+RPFGVS + AG+D R     +LY + PSG Y+ W A ++G N+   +  L+ +Y 
Sbjct: 122 QSGGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQAIGRNSKTVREFLEKNYN 181

Query: 182 DDMKV---DDAIDLALKTLSKTTDSSA 205
            +      ++ I L +K L +   + A
Sbjct: 182 REEPPSNKEECIRLTVKALLEVVQTGA 208

>Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  148 bits (374), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDSRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDMKVDDAIDLALKTLSKTTDSSA 205
               V++ + L +++L +   + A
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA 207

>YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha 4
           subunit of the 20S proteasome; may replace alpha 3
           subunit (Pre9p) under stress conditions to create a more
           active proteasomal isoform; GFP-fusion protein relocates
           from cytosol to the mitochondrial surface upon oxidative
           stress
          Length = 254

 Score =  148 bits (374), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDMKVDDAIDLALKTLSKTTDSSA 205
               V++ + L +++L +   + A
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA 207

>Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  148 bits (373), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDARDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDMKVDDAIDLALKTLSKTTDSSA 205
               V++ + L +++L +   + A
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA 207

>ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  147 bits (372), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 142/247 (57%), Gaps = 15/247 (6%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IG+ A++G+V+A E+K +S L   +T   
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVIATEKKSSSPLALTET-LN 62

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+ ++   I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RP+G S + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNEE 182

Query: 184 MKVDDAIDLALKTLSKTTDSSALTYDRLEFATIR---------KGV--NDGEVYQKIFKP 232
           ++++DAI   L TL ++ +      D +E A I          KGV  + G  ++K+   
Sbjct: 183 LELEDAIHTVLLTLKESVEGE-FNGDTIEIAVIGDENKDLLGYKGVPGDKGPRFRKL-TA 240

Query: 233 QEIKDLL 239
           QEI D L
Sbjct: 241 QEINDRL 247

>Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON}
           (252377..253141) [765 nt, 255 aa]
          Length = 254

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGENCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K+++ + ++ +GL AD+ ILI  ARI AQ++  T  + I VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVILSFSGLNADSRILIEKARIEAQSHKLTLEDPISVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFG+S + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGISTLIAGFDPNDKTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYDRNE 183

Query: 182 DDMKVDDAIDLALKTLSKTTDSSA 205
               V++ + L +K+L +   + A
Sbjct: 184 PPKTVEECVKLTVKSLLEVVQTGA 207

>ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253C PUP2 Alpha subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit zeta
          Length = 260

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 123/204 (60%), Gaps = 7/204 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G++L  E++  S LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRANSPLLEAD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ +++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +
Sbjct: 66  KILEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDENISVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTD 202
           ++   + + +A  L LK L +  +
Sbjct: 186 EWHSSLTLKEAELLVLKILKQVME 209

>Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa]
           {ON} similar to Ashbya gossypii AAR012C  1-intron
          Length = 251

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 119/204 (58%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +G+  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGVKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ AGL AD+ ILI  AR+ AQ++  T  + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISKIDRHVILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y    
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTRPRLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKHN 183

Query: 182 DDMKVDDAIDLALKTLSKTTDSSA 205
                +  + L +K+L +   + A
Sbjct: 184 PPTSEEACVKLTVKSLLEVVQTGA 207

>YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}
           PUP2Alpha 5 subunit of the 20S proteasome involved in
           ubiquitin-dependent catabolism; human homolog is subunit
           zeta
          Length = 260

 Score =  144 bits (362), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 121/204 (59%), Gaps = 7/204 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +
Sbjct: 66  KIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  
Sbjct: 126 GASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTD 202
           ++   + + +A  L LK L +  +
Sbjct: 186 EWHSSLTLKEAELLVLKILKQVME 209

>Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  144 bits (362), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 121/204 (59%), Gaps = 7/204 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +
Sbjct: 66  KIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  
Sbjct: 126 GASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTD 202
           ++   + + +A  L LK L +  +
Sbjct: 186 EWHSSLTLKEAELLVLKILKQVME 209

>Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  143 bits (361), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 121/204 (59%), Gaps = 7/204 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTKEGVVLGVEKRATSPLLESD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +
Sbjct: 66  KIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  
Sbjct: 126 GASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTD 202
           ++   + + +A  L LK L +  +
Sbjct: 186 EWHSSLSLKEAELLILKILKQVME 209

>TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON}
           Anc_7.120 YOL038W
          Length = 256

 Score =  143 bits (361), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 120/204 (58%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGV+ + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVATLIAGFDPQDDTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --MKVDDAIDLALKTLSKTTDSSA 205
                ++ + L +++L +   + A
Sbjct: 184 PPATAEECVKLTVRSLLEVVQTGA 207

>Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C
           (REAL)
          Length = 260

 Score =  143 bits (360), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 121/204 (59%), Gaps = 7/204 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIE 65

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK----Q 120
           K+ +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +
Sbjct: 66  KIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  
Sbjct: 126 GASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLN 185

Query: 179 DYKDDMKVDDAIDLALKTLSKTTD 202
           ++   + + +A  L LK L +  +
Sbjct: 186 EWHSSLTLKEAELLILKILKQVME 209

>KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {ON}
           Anc_7.120 YOL038W
          Length = 266

 Score =  140 bits (353), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 108/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+     +VL  ER+ T  L +  T+  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVRRGTCAVGVKGPRCVVLGCERRSTLKLQDPRTTPSK 63

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  ++++ AGL+ADA +LI  AR  AQ++  T  + + VE + R ++ I+Q YTQ 
Sbjct: 64  VALVDTHVALSFAGLSADARVLIERARTEAQSHRLTLEDPVSVEYMARYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D      +LY + PSG Y+ W A ++G N    +  L+ +Y
Sbjct: 124 GGVRPFGVSTLVAGFDSGDDTPRLYHTEPSGIYSAWTAQTIGRNAKTVREFLEKNY 179

>ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 290

 Score =  128 bits (321), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 110/195 (56%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ V+S LL    +  K
Sbjct: 8   YDLANSVFSPDGRNFQVEYAVKAVENGTTSIGIRCNDGVVFAVEKLVSSKLLVPKRNV-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  +    +GL  D   L+N  R  AQ++ KT+ E IP++ L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCVYSGLIPDGRHLVNRGREEAQSHKKTFGESIPLQALADRLGYYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGV+ I+ G DD+ G  LY   PSG + G+K  + G     A+  L+     + +
Sbjct: 127 NSVRPFGVTAIFGGVDDK-GPHLYMLEPSGTFWGYKGAATGKGRQTAKAELEKVIDQHPE 185

Query: 183 DMKVDDAIDLALKTL 197
            +   DA+  A K +
Sbjct: 186 GLSAKDAVKEAAKVI 200

>TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON}
           Anc_7.20 YOR362C
          Length = 278

 Score =  126 bits (317), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 106/195 (54%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCDDGVVFAVEKIISSKLLVPKRNV-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A N+ K Y + IPV  L  R+S   Q YT +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRYLVNRGREEASNFKKLYTKPIPVSALADRISQYVQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK---D 182
             +RPFG+S I  G D+  G  LY   PSG   G+K  + G    AA+  L+  +    D
Sbjct: 127 NSVRPFGISAIIGGIDED-GSHLYMVEPSGTCWGYKGAATGKGRQAAKAELEKLFDRSTD 185

Query: 183 DMKVDDAIDLALKTL 197
            + V DAI  A + +
Sbjct: 186 GLSVKDAIKEAARVI 200

>CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362c PRE10
          Length = 290

 Score =  124 bits (312), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 106/194 (54%), Gaps = 4/194 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI  +DG+V A E+ +TS LL  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDGVVFAVEKIITSKLLVPNKNL-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I V  +GL  D   L+N AR  +QN+ K Y   IPV+    R+    Q +T  
Sbjct: 67  IQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYGSAIPVDAFAERVGQYVQAHTLF 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDD 183
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G     A+  L+  +D   +
Sbjct: 127 NSVRPFGVTAIFGGC-DKNGPHLYMLEPSGTYWGYNGAATGKGRQTAKAELEKLLDKTPE 185

Query: 184 MKVDDAIDLALKTL 197
           M   +A   A + +
Sbjct: 186 MSAKEAAKHAARII 199

>Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  123 bits (308), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K YN  IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYNTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON}
           complement(86524..87348) [825 nt, 275 aa]
          Length = 274

 Score =  122 bits (307), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 64/195 (32%), Positives = 110/195 (56%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI  +DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCNDGVVFAVEKLISSKLLVPKKNV-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  ++++ + Y++ IP+     R+    Q +T +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESKSFSQMYSKRIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---KD 182
             +RPFGVS I+ G DD  G  LY   PSG+Y G+K  + G+    A+T L+  +    D
Sbjct: 127 NSVRPFGVSAIFGGIDDE-GSHLYMIEPSGSYWGYKGAAAGSGRQIAKTELEKLFDKNPD 185

Query: 183 DMKVDDAIDLALKTL 197
            +   +AI  A + +
Sbjct: 186 GLSAREAIKQAARII 200

>ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 bp,
           279 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YOR362C (PRE10); 1-intron
          Length = 279

 Score =  121 bits (304), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 119/231 (51%), Gaps = 8/231 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS LL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIRCKDGVVFAVEKLITSKLL-VPHKNKK 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y + IP+     R+    Q +T +
Sbjct: 67  IQTVDKHIGCVYSGLMPDGRHLVNIGRQEAADFRKYYRQPIPLPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFG+  I+ G D++ G  LY   PSG Y G++  + G    AA+  L+    + K 
Sbjct: 127 NSVRPFGIIAIFGGVDEK-GPHLYMLEPSGAYWGYRGAAAGKGRQAAKAELEKLIGNDKS 185

Query: 183 DMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDG---EVYQKIF 230
           ++   DA+  A + +    + +      +E +       DG   EV +++F
Sbjct: 186 ELSARDAVKEAARIIYVAHEDNKEKEFEIELSWCSASETDGLHKEVPKELF 236

>Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}
           YOR362C (REAL)
          Length = 292

 Score =  122 bits (305), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS LL    +T K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCDDGVVFAVEKLITSKLLVPQKNT-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {ON}
           highly similar to uniprot|P21242 Saccharomyces
           cerevisiae YOR362C PRE10 20S proteasome alpha-type
           subunit
          Length = 277

 Score =  121 bits (304), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA+++  +  T++G+   DGIVLA E+ VTS LL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDGIVLAVEKLVTSKLL-VPGKNKK 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  +  A +GL  D   L+N  R  A ++ KTY   IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYATPIPLPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG++ I  G DD  G  LY   PSG Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGITAIVGGVDDD-GAHLYMLEPSGTYWGYKGAATGKGRQSAKAELE 177

>Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  121 bits (304), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 106/195 (54%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y   IPV     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYKTPIPVPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+     + D
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDQHTD 185

Query: 183 DMKVDDAIDLALKTL 197
            +   +A+  A + +
Sbjct: 186 GLTAKEAVKQAARII 200

>KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20
           YOR362C
          Length = 281

 Score =  120 bits (302), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS L+  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCNDGVVFAVEKLITSKLMVPNKNI-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + ++ K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRHLVNRGREESSSFKKLYGKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG++ I+ G D+  G  LY   PSG+Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGITAIFGGVDED-GSHLYMLEPSGSYWGYKGAATGKGRQTAKAELE 177

>NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  120 bits (302), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ VTS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCDDGVVFAVEKIVTSKLLVPKRNV-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D    +N  R  A N+ K Y+  IP+     R+    Q +T +
Sbjct: 67  IQGIDRHIGCVYSGLIPDGRHFVNRGREEASNFKKLYSNAIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  G  LY   PSG Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEN-GPHLYMLEPSGTYWGYKGAATGKGRQTAKAELE 177

>YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}
           PRE10Alpha 7 subunit of the 20S proteasome
          Length = 288

 Score =  120 bits (302), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 aa]
           {ON} similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 275

 Score =  119 bits (298), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+VLA E+ +TS LL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDGVVLAVEKLITSKLL-VPGKNKK 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y+  IP+     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYSTPIPIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D   G  LY   PSG Y G+K+ + G    +A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDSD-GAHLYMLEPSGTYWGYKSAATGKGRQSAKAELE 177

>AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL011C (SCL1)
          Length = 246

 Score =  117 bits (294), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 63/182 (34%), Positives = 93/182 (51%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I      VL  ++KV   LLE 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCTVLVNQKKVPDKLLEP 60

Query: 60  DTSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T T  L+ +   I +   G  ADA  +    R  A  +   Y  D+PV +L +R +++ 
Sbjct: 61  STVT-YLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGYDMPVHVLAKRFANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20
           YOR362C
          Length = 279

 Score =  118 bits (295), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/188 (34%), Positives = 100/188 (53%), Gaps = 10/188 (5%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T++G++  DG+VLA E+ V S LL + +   K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAAKAVENGATSVGLLCEDGVVLAVEKLVASKLLVKASPQNK 67

Query: 66  LYKLNDK-------ISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDI 118
               N K       I  A +GL  D   L+N AR  +Q + + Y  DIP   L  R+   
Sbjct: 68  GSGANTKIQTVGRHIGCACSGLVPDGRHLVNRAREESQQFKQLYKRDIPPVALADRMGQY 127

Query: 119 KQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            Q +T +  +RPFGV+ I+ G D       LY   PSG Y G++  + G    +A+  L+
Sbjct: 128 VQAHTLYNSVRPFGVAAIFGGVDPETAEPHLYMLEPSGVYWGYRGAATGKGRQSAKAELE 187

Query: 178 --MDYKDD 183
             +  +DD
Sbjct: 188 KLISSRDD 195

>Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}
           similar to Ashbya gossypii ADR401C
          Length = 285

 Score =  117 bits (294), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ + S LL   +  EK
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSIGIKCKDGVVFAVEKLINSKLL-VPSKNEK 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y + I +     R+    Q +T +
Sbjct: 67  IQTIDKHIGCVYSGLMPDGRHLVNIGRQEANSFRKLYRKPITIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+  I+ G DD  G  LY   PSG Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDDE-GAHLYMLEPSGAYWGYKGAATGKGRQSAKAELE 177

>NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  117 bits (294), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 102/195 (52%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI   DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAGKAVENGATSIGIKCKDGVVFAVEKIITSKLLVPKKNV-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y+  IP+     RL    Q +T +
Sbjct: 67  IQGVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYDLPIPISAFAERLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGV+ I+ G D++ G  LY   PSG   G+   + G     A+  L+     + D
Sbjct: 127 NSVRPFGVTSIFGGIDEK-GPHLYMLEPSGTCWGYNGAATGKGRQTAKAELEKLADQHPD 185

Query: 183 DMKVDDAIDLALKTL 197
            +   DA+  A K +
Sbjct: 186 GLTTRDAVKYAAKII 200

>TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20
           YOR362C
          Length = 277

 Score =  116 bits (291), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR++QVEYA +++ +  T+IGI  +DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRIFQVEYANKAVENGATSIGIKCTDGVVFAVEKIISSKLLVPKKNV-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + N+ K Y + I +     R+    Q YT +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESANFKKVYGQPIGIPAFADRIGQYIQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G D   G  LY   P+G + G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSAIFGGIDSE-GPHLYMVEPNGAFWGYKGAATGKGRQSAKAELE 177

>TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON}
           Anc_7.20 YOR362C
          Length = 274

 Score =  116 bits (290), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QV+YA++++ +  T+IGI   DG+V A E+ VTS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKDGVVFAVEKLVTSKLLVPKKNV-K 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + ++ K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKLYQKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  G  LY   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEE-GPHLYMLEPSGAHWGYKGAATGKGRQTAKAELE 177

>Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to
           Ashbya gossypii AGL089W
          Length = 246

 Score =  115 bits (288), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 96/182 (52%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   + +VL  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIKGKNCVVLVNQKKVPDKLLDP 60

Query: 60  DTSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T +  ++ ++  I +   G   DA  +    +  A  +   Y  DIPV +L +RL+++ 
Sbjct: 61  ATVS-YMFPISKHIGMCATGPIGDARNVAVRCKSMAAEFRYEYGYDIPVHVLAKRLANLA 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEKGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON}
           Anc_5.1 YMR314W
          Length = 233

 Score =  115 bits (287), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 118/235 (50%), Gaps = 13/235 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +S    L A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYACLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLK-TYNEDIPVEILVRRLSDIK 119
           +  +K+ K +D + +++AGL  DA +L N  R H  NY K  YN ++ +E +   LSD  
Sbjct: 58  SYQKKIIKCDDHVGLSLAGLAPDARVLSNFVRQHC-NYSKLVYNRELSMEKIGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q  TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  ++T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLVGY-DKSGPHLIEFQPSGNILELYGAAIGARSQGSRTYLERV 175

Query: 180 YKDDMKVDDAIDL---ALKTLSKTTDSSALTYDRLEFATIRKG----VNDGEVYQ 227
             D + V+DA +L    ++ L ++     L+   L  A + +     V DGE  Q
Sbjct: 176 MDDFLPVEDATELIKQGVEALRQSLKDETLSVKNLSIAIVGEDLPFTVYDGEAVQ 230

>SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369)
           [846 bp, 281 aa] {ON} similar to uniprot|P21242
           Saccharomyces cerevisiae YOR362C PRE10 20S proteasome
           alpha-type subunit
          Length = 281

 Score =  115 bits (289), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 64/194 (32%), Positives = 106/194 (54%), Gaps = 4/194 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +++SP+GR +QVEYA++++ +  T++GI   DG+V A E+ VTS LL    + +K
Sbjct: 8   YDLSNSVYSPDGRNFQVEYAVKAVENGATSVGIKFRDGVVFAVEKLVTSKLLVPGKN-KK 66

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y++ IPV     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSQPIPVPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDD 183
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G    +A+  L+     K D
Sbjct: 127 NSVRPFGVTAIFGGV-DKDGAHLYMLEPSGTYWGYTGAATGKGRQSAKAELEKLATSKPD 185

Query: 184 MKVDDAIDLALKTL 197
           +   +A+  A + +
Sbjct: 186 LSPREAVKEAARII 199

>KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  113 bits (282), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 99/191 (51%), Gaps = 4/191 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I +    V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTASVVISQKKVPDKLLDP 60

Query: 60  DTSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T +  ++ +   I     G   DA  +    +  A  +   Y  DIP  +L +R++++ 
Sbjct: 61  KTVS-YIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGYDIPCSVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP G+   +  YD+  G  ++  +P+G YTG+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKATATGPKQQELNSALEKH 179

Query: 180 YK--DDMKVDD 188
           +K   D K+D+
Sbjct: 180 FKKLKDDKIDE 190

>TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  112 bits (281), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/182 (33%), Positives = 98/182 (53%), Gaps = 3/182 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I  +   V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNKCAVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA+     A+     Y   Y  D+P ++L +R+++I Q YTQ
Sbjct: 71  YIFPISKTIGLVANGPIPDAKNAATKAKTETAEYRYKYGYDMPCDVLAKRMANIAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY-KDD 183
              +RP GV   +  YD+  G  +Y ++P+G Y G+KA + G       T L+  + K+D
Sbjct: 131 RAYMRPLGVILTFISYDEELGPSIYKTDPAGYYVGYKATATGPKQQEINTGLENWFKKND 190

Query: 184 MK 185
           +K
Sbjct: 191 VK 192

>Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON}
           YML092C (PRE8) - proteasome component Y7 [contig 336]
           FULL
          Length = 173

 Score =  110 bits (275), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 87/139 (62%), Gaps = 4/139 (2%)

Query: 80  LTADAEILINTAR--IHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIY 137
           +  D  +LI+ +R   H Q Y + YNE  P +ILV  ++ I Q  TQ GG+RPFGVS + 
Sbjct: 1   MGPDFRVLIDKSRKVAHTQ-YKRIYNEYPPTKILVAEVAKIMQEATQSGGVRPFGVSLLV 59

Query: 138 AGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTL 197
           AGYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+++++DAI +AL TL
Sbjct: 60  AGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDELELEDAIHIALLTL 119

Query: 198 SKTTDSSALTYDRLEFATI 216
            ++ +      D +E A +
Sbjct: 120 KESVEGE-FNGDTIEIAVV 137

>KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  111 bits (278), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/219 (32%), Positives = 108/219 (49%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  D  +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERTL 176

Query: 181 KDDMKVDDAIDL---ALKTLSKTTDSSALTYDRLEFATI 216
           +D +++DDA DL   A++ L +      L+   L  A +
Sbjct: 177 QDYLELDDADDLIRVAVEALRQCLKDEVLSTKNLSIAVV 215

>Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {ON}
           complement(125355..126125) [771 nt, 257 aa]
          Length = 256

 Score =  111 bits (278), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I  ++  V+  ++KV   LL+ +T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNNCSVIINQKKVPDKLLDAETVS- 71

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            +++++  I +   G   DA       +  A  +   Y  D+PV++L +R++++ Q YTQ
Sbjct: 72  YIFQISRTIGMVANGPIPDARNAAIRCKAEAAEFRYKYGYDMPVDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y S+PSG Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSLDEEKGPSIYKSDPSGYYVGYKATATGPKQQEISTSLENFFK 188

>YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha 6
           subunit of the 20S proteasome
          Length = 234

 Score =  109 bits (273), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/236 (31%), Positives = 114/236 (48%), Gaps = 12/236 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN T     ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDMKV----DDAIDLALKTLSKTTDSSALTYDRLEFATIRKG----VNDGEVYQK 228
              +K+    D+ I   ++ +S++    +LT D L  A + K     + DGE   K
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAK 232

>KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  109 bits (273), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 94/182 (51%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  +D  V+  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCCVVINQKKVPDKLLDP 60

Query: 60  DTSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T +  L+ ++  I +   G   DA      A+     Y   Y  D+P ++L +R++++ 
Sbjct: 61  STMS-YLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314w PRE5
          Length = 233

 Score =  109 bits (272), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 110/231 (47%), Gaps = 11/231 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ + D  VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKDYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         YN  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRKLSVEKAGHMLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDNS-GPHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDMKVDDAIDL---ALKTLSKTTDSSALTYDRLEFATIRKGVN----DGE 224
            D + + DA +L    ++ L ++     L  D L  A + K +     DGE
Sbjct: 177 DDYLAITDATELIKSGVEALRQSLKDETLNTDNLSIAVVGKDIPFTIYDGE 227

>Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C
           (SCL1) - Proteasome subunit YC7alpha/Y8 (protease yscE
           subunit 7) [contig 207] FULL
          Length = 246

 Score =  109 bits (272), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 97/182 (53%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I  +D  V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSIAIRGTDCCVIISQKKVPDKLLDP 60

Query: 60  DTSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T +  L++++  + +   G   DA      A+  A  Y   Y  D+P ++L +R++++ 
Sbjct: 61  STMS-YLFQISRHVGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  108 bits (269), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 110/223 (49%), Gaps = 7/223 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKLGSVTVGLRSNKHAVVVALKRNADDL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         YN  + VE +   L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNFLRQQCNYSQLVYNRKLSVERVGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLVVGYDNS-GPHLLEFQPSGNVLELYGTAIGARSQGAKTYLEKTL 176

Query: 181 KDDMKVDDA---IDLALKTLSKTTDSSALTYDRLEFATIRKGV 220
           +  ++V+D    I L ++ L ++     L+   L  A + +G+
Sbjct: 177 EQFLEVEDPNELIKLGVEALRQSLKDETLSTKNLSIAVVGEGM 219

>Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  107 bits (268), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 113/236 (47%), Gaps = 12/236 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K +D + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDMKV----DDAIDLALKTLSKTTDSSALTYDRLEFATIRKG----VNDGEVYQK 228
              +K+    D+ I   ++ +S++    +LT D L  A + +     + DGE   K
Sbjct: 177 DTFIKIDGNPDELIKAGIEAISQSLRDESLTVDNLSIAIVGENMPFTIYDGEAVAK 232

>Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  107 bits (268), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 113/236 (47%), Gaps = 12/236 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTSIGARSQGAKTYLERTL 176

Query: 181 KDDMKV----DDAIDLALKTLSKTTDSSALTYDRLEFATIRKG----VNDGEVYQK 228
              +K+    D+ I   ++ +S++    +LT D L  A + +     + DGE   K
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAVVGEDLPFTIYDGEAVAK 232

>Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {ON}
           YMR314W (PRE5) - alpha-type of subunit of 20S proteasome
           [contig 73] FULL
          Length = 233

 Score =  107 bits (268), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 107/221 (48%), Gaps = 7/221 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  D  +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERTL 176

Query: 181 KDDMKVDDA---IDLALKTLSKTTDSSALTYDRLEFATIRK 218
            + ++++D    I +A++ L +      L+   L  A + K
Sbjct: 177 NEYLEIEDEDELIGVAVEALKQCLKDETLSTKNLSIAIVSK 217

>SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 248

 Score =  107 bits (268), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 102/191 (53%), Gaps = 2/191 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  ++ +V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGTNCVVVVSQKKVPDKLLDS 60

Query: 60  DTSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
           +T +  ++K++  + +   G   DA      A+  A  +   Y  D+P ++L +R++++ 
Sbjct: 61  NTVS-YIFKVSPHVGMVANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRIANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G + G+KA + G       T L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEENGPSVYKCDPAGYFVGYKATATGPKQQELDTSLEKF 179

Query: 180 YKDDMKVDDAI 190
           +K +    D +
Sbjct: 180 FKKNNNGKDHV 190

>TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.110
           YGL011C
          Length = 257

 Score =  108 bits (269), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 93/177 (52%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +  +D  V+  ++KV   LL+ DT + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKACNQTNINSVAVRGNDCTVIINQKKVPDKLLDADTVS- 71

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA       +  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGPIPDARNAALRCKAEAAEFRYKYGYDMPADVLAKRMANLAQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y S+PSG Y G+K  + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFISVDEEKGPSIYKSDPSGYYIGYKVTATGPKQQEIATSLENFFK 188

>ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 253

 Score =  107 bits (267), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 103/202 (50%), Gaps = 10/202 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I   +  V+ +++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTSINSLAIRGKNCSVIISQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++K++  I + + G   DA      A+     +   +  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFKISKTIGMVINGPIPDARNAALRAKAETAEFRYKFGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   Y   D+  G  +Y S+P+G + G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYFVGYKATATGPKQQEITTRLENYIKKTP 190

Query: 178 -MDYKDDMKVDDAIDLALKTLS 198
             DY  +   +  ++  + TL+
Sbjct: 191 SQDYMQEESWEKVVEFGITTLT 212

>NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON}
           Anc_4.110
          Length = 253

 Score =  107 bits (266), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  ++  V+  ++KV   LL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNVNSVAVRGTNCTVVINQKKVPDKLLDPSTVS- 71

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  + +   G   DA      A++ A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRHVGMVANGPIPDARNAAMRAKMEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPRQQEITTSLENYFK 188

>YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}
           SCL1Alpha 1 subunit of the 20S proteasome involved in
           the degradation of ubiquitinated substrates; 20S
           proteasome is the core complex of the 26S proteasome;
           essential for growth; detected in the mitochondria
          Length = 252

 Score =  107 bits (266), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   D  V+ +++KV   LL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON}
           Anc_5.1
          Length = 233

 Score =  106 bits (264), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 107/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +S   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +A+AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SFQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSDMVFNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGY-DKSGPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDMKVDDAIDL---ALKTLSKTTDSSALTYDRLEFATI 216
              ++++DA +L    ++ L ++     L+ D L  A +
Sbjct: 177 DKFVEIEDAEELIKTGVEALKQSLKDETLSTDNLSIAIV 215

>AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR314W (PRE5)
          Length = 306

 Score =  107 bits (268), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 110/221 (49%), Gaps = 7/221 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++  +VL A ++    L    
Sbjct: 74  MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSNKYVVLVALKRNADEL---S 130

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K +D + +++AGL  DA +L N  R         Y  D+ V    + LSD  Q
Sbjct: 131 SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSQLVYARDLSVVKAGQLLSDKAQ 190

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 191 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 249

Query: 181 KDDMKVDDA---IDLALKTLSKTTDSSALTYDRLEFATIRK 218
           ++ ++++DA   I   ++ L  +     L+   L  A + K
Sbjct: 250 EEYLEIEDADALIKHGVEALKHSLKDETLSTKNLSIAIVGK 290

>Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  106 bits (264), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I   +  V+ +++KV   LL+ +T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGKNCTVVISQKKVPDKLLDPNTVS- 70

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  105 bits (263), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 107/220 (48%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N  + +E     L D  Q
Sbjct: 58  SFQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAIERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDMKV----DDAIDLALKTLSKTTDSSALTYDRLEFATI 216
              +K+    D+ I   ++ +S++    +LT D L  A +
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIV 216

>Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  105 bits (262), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+ +++KV   LL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON}
           complement(1850..2551) [702 nt, 234 aa]
          Length = 233

 Score =  105 bits (261), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 109/219 (49%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VLAA ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNKYAVLAALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N  + VE     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCHYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--M 178
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+  M
Sbjct: 118 QNTQSYGGRPYGVGLLLIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLEKVM 176

Query: 179 DYKDDMK-VDDAIDLALKTLSKTTDSSALTYDRLEFATI 216
           D   D++  ++ I   ++ L ++     LT + L  A +
Sbjct: 177 DNFVDLEDPEELIKTCVEALRQSLKDETLTTENLSIAIV 215

>Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON}
           similar to Ashbya gossypii AGL336W
          Length = 233

 Score =  104 bits (259), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 107/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +   +VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSEKYVVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         YN ++ +      LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRNLSLVKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDMKV---DDAIDLALKTLSKTTDSSALTYDRLEFATI 216
           ++ +K+   D+ I   ++ L  +     L+   L  A +
Sbjct: 177 EEYLKIETADELIKHGVEALKHSLKDDTLSTKNLSIAVV 215

>Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  104 bits (260), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+ +++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPATVS- 70

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  103 bits (258), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 98/193 (50%), Gaps = 6/193 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASD-GIVLAAERKVTSTLLEQ 59
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   +V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAVVVALKRNAD----EL 56

Query: 60  DTSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            +  +K+ K +D + V++AGL  DA +L N  R         YN  + +E     LSD  
Sbjct: 57  SSYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLALERAGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q  TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLIGYDNT-GAHLLEFQPSGNTLELYGTAIGARSQGAKTYLERV 175

Query: 180 YKDDMKVDDAIDL 192
             D  +++DA +L
Sbjct: 176 LDDFREIEDADEL 188

>TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  104 bits (259), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 95/179 (53%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   +  V+  ++KV   LLE  T + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGRNSTVVINQKKVPDKLLEASTVS- 71

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  D+P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGAIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
              +RP GV   +   D+  G  +Y ++P+G + G+KA + G       T L+  +K++
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYFVGYKATATGPKQQEISTRLENSFKNN 190

>TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON} 
          Length = 233

 Score =  103 bits (258), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 109/223 (48%), Gaps = 7/223 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ + +  V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKNYAVITALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         +N  + VE     LSD  Q
Sbjct: 58  SYQKKIIRCDEHLGLSLAGLAPDARVLSNYLRQQCNYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLIIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVM 176

Query: 181 KDDMKVDDAIDL---ALKTLSKTTDSSALTYDRLEFATIRKGV 220
              ++++D  +L    ++ L ++     LT D L  A + K +
Sbjct: 177 DKYIEIEDPEELIKTCVEALRQSLKDETLTTDNLSIAIVGKDI 219

>CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011c SCL1
          Length = 254

 Score =  103 bits (258), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 93/177 (52%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+  ++KV   LL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNLNSLAVRGKNCSVIINQKKVPDKLLDPSTVS- 71

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++K++  I +   G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 72  YIFKISKTIGMVANGPIPDARNAAARAKGEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       T L+  YK
Sbjct: 132 RAYMRPLGVILTFISVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTTSLENYYK 188

>NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1
          Length = 233

 Score =  102 bits (255), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 106/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +A+AGL  DA +L N  R         YN  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSSLIYNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGHDNS-GPHLLEFQPSGNTVELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDMKVDDAIDL---ALKTLSKTTDSSALTYDRLEFATI 216
              ++++D  +L    +++L ++     L+ + L  A +
Sbjct: 177 DQFIEIEDPEELIKTGVESLKQSLKDETLSTENLSIAIV 215

>KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1
           YMR314W
          Length = 235

 Score =  102 bits (253), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 115/235 (48%), Gaps = 17/235 (7%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASD-GIVLAAERKVTSTLLEQ 59
           M    YD  T  FSP GRL+Q+EYA+E+I      +G+ + +   V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQLEYAIEAIKQGSVTVGLRSKNYACVVALKRNAD----EL 56

Query: 60  DTSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLK-TYNEDIPVEILVRRLSDI 118
            +  +K+ K +D + +++AGL  DA +L N  R    NY K  +N D+ VE     LSD 
Sbjct: 57  SSYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQC-NYSKLVFNRDLSVEKAGFLLSDK 115

Query: 119 KQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
            Q  TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  ++T L+ 
Sbjct: 116 AQKNTQSYGGRPYGVGLLVVGY-DKTGPHLLEFQPSGNVMELYGTAIGARSQGSKTYLER 174

Query: 179 ---DYK--DDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKG----VNDGE 224
              ++K  +D   +  I + ++ + ++     L  D L    + K     V DGE
Sbjct: 175 VLDEFKELEDEDPESIIKVGVQAIQQSLKDEVLNTDNLSIGIVGKDLPFTVYDGE 229

>KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  102 bits (254), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 92/177 (51%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ I      V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNVNSMAIRGETCSVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFPISKTIGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y S+P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFK 187

>TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5.1
           YMR314W
          Length = 233

 Score =  100 bits (248), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 105/219 (47%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  +  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDSVTFSPTGRLFQVEYALEAIKQGSVTVGLRSHKYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K +  + +++AGL  DA +L N  R         ++  + VE     LSD  Q
Sbjct: 58  SYQKKIIKCDTHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFDRKLSVEKAGSLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLVIGYDNS-GSHLLEFQPSGNVLELYGSSIGARSQGAKTYLERVL 176

Query: 181 KDDMKVDDA---IDLALKTLSKTTDSSALTYDRLEFATI 216
            D +++D+    I + ++ L ++     LT   L  A +
Sbjct: 177 DDFLEIDNVEELIKVGVEALKQSLKDEDLTTQNLSIAFV 215

>SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314W PRE5 20S proteasome alpha-type subunit
          Length = 233

 Score = 98.2 bits (243), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 106/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSKKHAVVVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +   K+ K ++ + +++AGL  DA +L N  R         +N  + +E     L D  Q
Sbjct: 58  SYQNKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLSLEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGHDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDMKVDDAIDL---ALKTLSKTTDSSALTYDRLEFATI 216
           ++ ++++DA +L    ++ L ++     L+   L  A +
Sbjct: 177 EEYLEIEDADELIKKGVEALKQSLKDETLSTKNLSIAIV 215

>KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score = 96.7 bits (239), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 94/179 (52%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   +  V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGKNCAVVINQKKVPDKLLDPATLS- 70

Query: 65  KLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  + +   G   DA      A+  A  +   Y  D+P + L +R++++ Q YTQ
Sbjct: 71  YIFPISRHVGMLANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDALAKRMANLAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
              +RP GV   +  +D+  G  +Y ++P+G + G+KA + G       T L+  +K +
Sbjct: 131 RAYMRPLGVILTFISFDEELGPSIYKTDPAGYFVGYKATATGPKQQEITTSLENYFKKN 189

>TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON}
           Anc_5.1 YMR314W
          Length = 238

 Score = 90.5 bits (223), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 104/224 (46%), Gaps = 12/224 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEY-----ALESISHAGTAIGIMASDGIVLAAERKVTST 55
           M    YD  T  FSP GRL+QV+Y     ALE+I      +G+ +    VL A ++    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLHSKKYAVLVALKRNADE 60

Query: 56  LLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRL 115
           L    +   K+ K ++ + +++AGL  DA +L N  R         +N  + VE     L
Sbjct: 61  L---SSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNLVFNRKLSVEKAGHLL 117

Query: 116 SDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTL 175
            D  Q  TQ  G RP+GV  +  G+ D+ G  L    PSGN       ++GA +  A+T 
Sbjct: 118 CDKAQKNTQSYGGRPYGVGLLIIGH-DKSGAHLLEFQPSGNTLELYGSAIGARSQGAKTY 176

Query: 176 LQMDYKDDMKVDDAIDL---ALKTLSKTTDSSALTYDRLEFATI 216
           L+      ++++D  +L    ++ L ++     L+ + L  A +
Sbjct: 177 LERTLDTFLEIEDPNELIKQGVEALRQSLKDETLSNNNLSIAIV 220

>Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C
           (PRE10) - proteasome component YC1 (protease yscE
           subunit 1) [contig 44] FULL
          Length = 196

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 60/117 (51%), Gaps = 3/117 (2%)

Query: 83  DAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
           D   L+N AR  A ++ KTY   I +  L  RL    Q +T +  +RPFG++ I  G D+
Sbjct: 3   DGRHLVNRAREEAASFKKTYGTPITLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDE 62

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDDMKVDDAIDLALKTL 197
             G  LY   PSG+Y G+K  + G    +A+  L+  +  K D+   +A+  A + +
Sbjct: 63  N-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKILSSKPDISAKEAVKEAARVV 118

>NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON}
           Anc_4.110
          Length = 172

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 45/80 (56%)

Query: 102 YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWK 161
           Y  D+P ++L +R++++ Q YTQ   +RP GV   +   D+  G  +Y S+P+G Y G+K
Sbjct: 28  YGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYK 87

Query: 162 AISVGANTSAAQTLLQMDYK 181
           A + G       T L+  +K
Sbjct: 88  ATATGPKQQEITTNLENYFK 107

>Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 82/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARI 93
           T +G+  +DG+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 31  TIVGVKYNDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
             G+      +S+G+ + AA  +L+  +K D+  D+A+ LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAVKLA 184

>Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 82/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARI 93
           T +G+  ++G+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 31  TIVGVKYNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
             G+      +S+G+ + AA  +L+  +K D+  D+AI LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 81/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARI 93
           T +G+   +G+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 31  TIVGVKYKNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
             G+      +S+G+ + AA  +L+  +K D+  D+AI LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 89/186 (47%), Gaps = 22/186 (11%)

Query: 20  YQVEYALESISH--------AGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           YQ    L S SH          T +G+  + G+V+AA+ + T   +  D +  KL++++ 
Sbjct: 9   YQRNSFLSSKSHKQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KISVAVAGLTADAE----ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGG 127
           +I  A AG  AD E    ++ +   +H+   L T  E      +V  L  +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNIELHS---LSTRRE----PRVVTTLQMLKQHLFRYQG 121

Query: 128 LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVD 187
               G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ D+  D
Sbjct: 122 --HIGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESKWRADISKD 178

Query: 188 DAIDLA 193
           +AI+LA
Sbjct: 179 EAIELA 184

>KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 83/161 (51%), Gaps = 8/161 (4%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARI 93
           T +G+   +G+V+AA+ + T   +  D +  KL++++ +I  A AG  AD E +  T  I
Sbjct: 32  TIVGVKFHNGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAV--TQLI 89

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y +  P   +V  L  +KQ   ++ G    G   I AG D   G  L++  
Sbjct: 90  GSNVELHSLYAKRQPR--VVTALQMLKQHLFKYQG--HIGAYLIVAGTDPT-GAHLFSVQ 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
             G+      +S+G+ + AA  +L+ ++K+D+  ++AI LA
Sbjct: 145 AHGSTDVGFYLSLGSGSLAAMAVLESNWKEDLSKEEAIKLA 185

>YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}
           PUP1Beta 2 subunit of the 20S proteasome; endopeptidase
           with trypsin-like activity that cleaves after basic
           residues; synthesized as a proprotein before being
           proteolytically processed for assembly into 20S
           particle; human homolog is subunit Z
          Length = 261

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 82/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARI 93
           T +G+  ++G+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 31  TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
             G+      +S+G+ + AA  +L+  +K D+  ++AI LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLA 184

>SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 91/183 (49%), Gaps = 16/183 (8%)

Query: 20  YQVEYALESISHA-------GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           YQ    L + SHA       GT I G+  + G+V+AA+ + T   +  D + EKL++++ 
Sbjct: 9   YQRNQFLAAKSHAQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCEKLHRISP 68

Query: 72  KISVAVAGLTADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  I +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TQLIGSNIELHSLYTNREPR--VVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAI 190
            G   I AG D   G  L++ +  G+       S+G+ + AA  +L+ ++K ++  ++AI
Sbjct: 123 VGAYLIVAGVDPT-GAHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWKQNLSREEAI 181

Query: 191 DLA 193
           +LA
Sbjct: 182 ELA 184

>NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON}
           Anc_5.507 YOR157C
          Length = 263

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 84/165 (50%), Gaps = 8/165 (4%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARI 93
           T +G+   DG+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 32  TIVGLKYRDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 89

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 90  GSNIELHSLYTSRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTL 197
             G+      +S+G+ + AA  +L+  ++ ++  ++AI+LA + +
Sbjct: 145 AHGSTDVGYYLSLGSGSLAAMAVLESQWRPELSKEEAIELASQAI 189

>TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 90/183 (49%), Gaps = 16/183 (8%)

Query: 20  YQVEYALESISHA-------GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           YQ    L S SHA       GT I G+  ++G+V+AA+ + T   +  D +  KL++++ 
Sbjct: 9   YQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KISVAVAGLTADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  I +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TQLISSNLELHSLYASREPR--VVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAI 190
            G   I AG D   G  L++ +  G+       S+G+ + AA  +L+  +K D+  ++AI
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKQDLTKEEAI 181

Query: 191 DLA 193
           +LA
Sbjct: 182 NLA 184

>KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590)
           [648 bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 94/212 (44%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL K++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E    +   I      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGEPTTKVAASIFKTLCYENKDHLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSA-AQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALT 207
           Y S P G     ++ S+  + SA        +YK+DM  ++ I+    +LS+     A+ 
Sbjct: 130 Y-SIPLGGSVHKQSYSIAGSGSAFIYGYCDKNYKEDMTKEETIEFVKHSLSQ-----AIK 183

Query: 208 YDRLEFATIRKGVNDGE-VYQKIFKPQEIKDL 238
           +D      IR  V   E V + I  P E ++L
Sbjct: 184 WDGSSGGVIRMVVLTAEGVERLIVYPDEYENL 215

>TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 83/172 (48%), Gaps = 9/172 (5%)

Query: 24  YALESISHAGTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTA 82
           YA    +  GT I G+    G+V+AA+ + T   +  D +  KL+++  +I  A AG  A
Sbjct: 20  YAQPKATSTGTTIVGVKFKGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAA 79

Query: 83  DAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYD 141
           D E +  T  I +   L + Y E  P   +V  L  +KQ   ++ G    G   I AG D
Sbjct: 80  DTEAV--TQLIGSNIELHSLYTERAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVD 133

Query: 142 DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
              G  L++ +  G+       ++G+ + AA  +L+  +K D+  +DAI LA
Sbjct: 134 PT-GAHLFSIHAHGSTDVGYYHTLGSGSLAAMAVLESQWKQDLSKEDAIKLA 184

>CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P25043 Saccharomyces
           cerevisiae YOR157c PUP1
          Length = 261

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 80/161 (49%), Gaps = 8/161 (4%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARI 93
           T +G+  + G+V+AA+ + T   +  D +  KL++++ +I  A AG  AD E +  T  I
Sbjct: 31  TIVGVKFAGGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTNRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
             G+       S+G+ + AA  +L+  +K DM  ++AI LA
Sbjct: 144 AHGSTDVGYYQSLGSGSLAAMAVLESHWKPDMTKEEAIQLA 184

>ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 79/164 (48%), Gaps = 14/164 (8%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAE----ILIN 89
           T +G+    G+V+AA+ + T   +  D +  KL+++  +I  A AG  AD E    ++ +
Sbjct: 31  TIVGVKYDKGVVIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 90  TARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
              +H+Q     Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L+
Sbjct: 91  NLELHSQ-----YANREPR--VVSALQMLKQHLFRYQG--HIGAYLIVAGVDPT-GAHLF 140

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
           +    G+      +S+G+ + AA   L+ ++K ++  D+A+ LA
Sbjct: 141 SVQAHGSTDVGHYLSLGSGSLAAMATLESNWKQNLTKDEAVKLA 184

>AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL041W (PRE7)
          Length = 243

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 71/158 (44%), Gaps = 6/158 (3%)

Query: 32  AGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           AGT +GI   D  VLA + + T+          K++   D I ++  G  AD + L+   
Sbjct: 31  AGTILGIAGEDFAVLAGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVKRF 90

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           +   + Y   +N+ + ++   R +  +  G      + P+ V  I AG D+     +Y+ 
Sbjct: 91  KNSMKWYRFDHNKKMTIKSAARSIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYSY 146

Query: 152 NPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDMKVD 187
           +P G+Y   +  + GA  S     L  Q+++K+  + D
Sbjct: 147 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 184

>Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON}
           (145742..146389) [648 nt, 216 aa]
          Length = 215

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 91/212 (42%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E   ++   I      + K   T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTY 208
           Y+    G+         G+ ++        ++K+DM  ++ I+    +LS+     A+ +
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSAFIYGYCDKNFKEDMTKEETIEFMKHSLSQ-----AIKW 184

Query: 209 DRLEFATIRKGV--NDGEVYQKIFKPQEIKDL 238
           D      IR  V   DG   + IF P E + L
Sbjct: 185 DGSSGGVIRMVVLTKDG-AERLIFYPDEYEKL 215

>Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON}
           (258951..259598) [648 nt, 216 aa]
          Length = 215

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 91/212 (42%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E   ++   I      + K   T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTY 208
           Y+    G+         G+ ++        ++K+DM  ++ I+    +LS+     A+ +
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSTFIYGYCDKNFKEDMTKEETIEFMKHSLSQ-----AIKW 184

Query: 209 DRLEFATIRKGV--NDGEVYQKIFKPQEIKDL 238
           D      IR  V   DG   + IF P E + L
Sbjct: 185 DGSSGGVIRMVVLTKDG-AERLIFYPDEYEKL 215

>Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to
           Ashbya gossypii AAR119W
          Length = 258

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 83/164 (50%), Gaps = 14/164 (8%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAE----ILIN 89
           T +G+   +G+V+AA+ + T   +  + + EKL+K++ +I  A AG  AD +    ++ +
Sbjct: 31  TIVGVKFENGVVIAADTRSTQGPIVANKNCEKLHKISSRIWCAGAGTAADTDAVTGLIGS 90

Query: 90  TARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
              +H+   L T  E      +V  L  +KQ   ++ G    G   I AG D   G  L+
Sbjct: 91  NLELHS---LFTGRE----PRVVSALQKLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLF 140

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
           + +  G+       S+G+ + AA  +L+ ++K+ +  ++AI LA
Sbjct: 141 SVHAHGSTDVGYYQSLGSGSLAAMAVLEANWKEHLTKEEAIKLA 184

>KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {ON}
           highly similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 262

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 80/161 (49%), Gaps = 8/161 (4%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARI 93
           T +G+  + G+++AA+ + T   +  D + EKL+++  +I  A AG  AD E +  T  I
Sbjct: 32  TIVGVKFNGGVIIAADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAV--TQLI 89

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 90  SSNIELHSLYTGREPR--VVSSLQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
             G+       S+G+ + AA  +L+ ++  D+  ++AI LA
Sbjct: 145 AHGSTDVGYYQSLGSGSLAAMAVLEANWNQDLSKEEAIKLA 185

>Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 91/211 (43%), Gaps = 19/211 (9%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + +    I      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAAAIFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTY 208
           YT    G+         G+ ++        +++++M  ++ +D    +LS+     A+ +
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ-----AIKW 184

Query: 209 DRLEFATIRKGV-NDGEVYQKIFKPQEIKDL 238
           D      IR  V  +  V + IF P E + L
Sbjct: 185 DGSSGGVIRMVVLTEAGVERLIFYPDEYERL 215

>TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON}
           Anc_5.507 YOR157C
          Length = 259

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 82/168 (48%), Gaps = 22/168 (13%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAE----ILIN 89
           T +G+  ++G+++AA+ + T   +  D +  KL+++  +I  A AG  AD E    ++ +
Sbjct: 31  TIVGVKFNNGVIIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLVGS 90

Query: 90  TARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDR----YG 145
              +H+   L T+ E      +V  L  +KQ   ++ G    G   I AG D      + 
Sbjct: 91  NLELHS---LYTHRE----PRVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPTGPHLFA 141

Query: 146 YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
            Q + S   G Y      S+G+ + AA  +L+ ++K D+  ++A+ LA
Sbjct: 142 VQAHGSTDVGFYH-----SLGSGSLAAMAVLETNWKQDLTKEEAMKLA 184

>Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 92/212 (43%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + +    +      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGPPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTY 208
           YT    G+         G+ ++        +++++M  ++ +D    +LS+     A+ +
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ-----AIKW 184

Query: 209 DRLEFATIRKGV--NDGEVYQKIFKPQEIKDL 238
           D      IR  V   DG V + IF P E + L
Sbjct: 185 DGSSGGVIRMVVLTADG-VERLIFYPDEYERL 215

>TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 bp,
           219 aa] {ON} Anc_5.216 YJL001W
          Length = 219

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 89/208 (42%), Gaps = 18/208 (8%)

Query: 35  AIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARIH 94
           ++ +   DG++L A+ + T+     +  T+KL ++++KI    +G  AD + + +  + H
Sbjct: 26  SMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHEKIWCCRSGSAADTQAIADIVQYH 85

Query: 95  AQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
              Y   Y E        +      + K   T            I AGYD++   ++Y+ 
Sbjct: 86  LDLYTAQYGEPSTKTAAAVFKELCYENKDNLT---------AGIIVAGYDEKNKGEVYSI 136

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTYDRL 211
              G+    K    G+ ++        ++KDDM  D+ ++    +LS+     A+ +D  
Sbjct: 137 PLGGSMHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVNFMKNSLSQ-----AIKWDGS 191

Query: 212 EFATIRKGVNDGEVYQK-IFKPQEIKDL 238
               IR  V   E  ++ IF P++ + L
Sbjct: 192 SGGVIRMVVLTKEGAERLIFYPEDYEKL 219

>YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {ON}
            PRE3Beta 1 subunit of the 20S proteasome, responsible
           for cleavage after acidic residues in peptides
          Length = 215

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 90/211 (42%), Gaps = 19/211 (9%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + +    +      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTY 208
           YT    G+         G+ ++        +++++M  ++ +D    +LS+     A+ +
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ-----AIKW 184

Query: 209 DRLEFATIRKGV-NDGEVYQKIFKPQEIKDL 238
           D      IR  V     V + IF P E + L
Sbjct: 185 DGSSGGVIRMVVLTAAGVERLIFYPDEYEQL 215

>Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON}
           complement(238..1023) [786 nt, 262 aa]
          Length = 261

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 80/161 (49%), Gaps = 8/161 (4%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARI 93
           T +G+    G+V+AA+ + T   +  D +  KL+++  +I  A AG  AD E +  T  I
Sbjct: 31  TIVGVKFDGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y+   P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYSNREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
             G+       S+G+ + AA  +L+ ++K D+  ++AI LA
Sbjct: 144 AHGSTDVGYYHSLGSGSLAAMAVLESNWKQDLTKEEAIKLA 184

>NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 91/229 (39%), Gaps = 31/229 (13%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           +S E R   +E+     S + GT +GI   D  VLA + + T+          K++   D
Sbjct: 8   YSSEVRNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KISVAVAGLTADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHG 126
            I ++  G  AD E L+   +    N LK Y+ D     + +    R +  +  G     
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLAMSSAARNIQHLLYGKR--- 120

Query: 127 GLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD- 183
              P+ V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  
Sbjct: 121 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY 179

Query: 184 --------------MKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRK 218
                         + +++AI L     +  T+      D LE   + K
Sbjct: 180 EPGTDGKVKRPLKYLTIEEAIKLVRDAFTSATERHIHVGDGLEILIVTK 228

>Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL001W
           (PRE3) - Subunit of 20S proteasome [contig 94] FULL
          Length = 193

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 91/204 (44%), Gaps = 12/204 (5%)

Query: 36  IGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTARIHA 95
           + +   DG++L A+ + T+     +  T+KL +++DK+    +G  AD + + +      
Sbjct: 1   MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKVWCCRSGSAADTQAVADI----V 56

Query: 96  QNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSG 155
           Q+YL+ Y             S  K    ++      G+  I AG+DD+   ++Y+    G
Sbjct: 57  QHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLTAGI--IVAGFDDKNKGEVYSIPLGG 114

Query: 156 NYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFAT 215
           +    K    G+ ++        ++K+DM  D+ I     +LS+     A+ +D      
Sbjct: 115 SVHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETISFMKNSLSQ-----AIKWDGSSGGV 169

Query: 216 IRKGVNDGEVYQK-IFKPQEIKDL 238
           IR  V   E  ++ IF P+E ++L
Sbjct: 170 IRMVVLTKEGAERLIFYPEEYENL 193

>KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 87/225 (38%), Gaps = 30/225 (13%)

Query: 20  YQVEYALESISH--------AGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           Y  E A + I H         GT +GI   D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAQQPIEHRFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KISVAVAGLTADAEILINTARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+  + ++   R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSIKWYHFDHNDKKLSIKSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD----- 183
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+      
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGS 183

Query: 184 ----------MKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRK 218
                     + +D+ I L     +  T+      D LE   + K
Sbjct: 184 DGKVKRPLKYLNIDEVISLVRDAFTSATERHIHVGDGLEILIVTK 228

>NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 95/238 (39%), Gaps = 31/238 (13%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           +S E     +E+A    + + GT +GI   D  +LA + + T+          K++   D
Sbjct: 8   YSSEVNSTPIEHAFNPYTDNGGTILGIAGEDFAILAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KISVAVAGLTADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHG 126
            I ++  G  AD E L+   +    N LK Y+ D     + ++   R +  +  G     
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR--- 120

Query: 127 GLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD- 183
              P+ V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  
Sbjct: 121 -FFPYYVHTIIAGLDENGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQF 179

Query: 184 --------------MKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQ 227
                         + +D+ I L   + +  T+      D LE   + K     E Y+
Sbjct: 180 EPGTDGKVKKPLKYLSIDEVIKLVRDSFTSATERHIHVGDGLEILIVTKDGVRKEFYE 237

>Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {ON}
           YOR157C (PUP1) - putative proteasome subunit [contig
           190] FULL
          Length = 263

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 84/171 (49%), Gaps = 14/171 (8%)

Query: 27  ESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAE- 85
           ++ S   T +G+  + G+V+AA+ + T   +  + +  KL++++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYNGGVVIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
              ++ +   +H+      Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELHS-----LYASRAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
             G  L++ +  G+       S+G+ + AA  +L+  +K+D+  ++A+ LA
Sbjct: 135 T-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKEDINREEAMQLA 184

>TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 92/213 (43%), Gaps = 22/213 (10%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL ++ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           +   + Y   + E    +   I      D K   +            I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALT 207
           +Y+    G+    K    G+ ++        ++KDDM  D+ ++    +LS+     A+ 
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSAFIYGYCDKNFKDDMTKDETVNFMKHSLSQ-----AIK 184

Query: 208 YDRLEFATIRKGV--NDGEVYQKIFKPQEIKDL 238
           +D      IR  V   DG V + IF P E ++L
Sbjct: 185 WDGSSGGVIRMVVLTKDG-VERLIFYPDEYENL 216

>Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 aa]
           {ON} YJL001W (REAL)
          Length = 216

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 90/211 (42%), Gaps = 19/211 (9%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + +    +      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTY 208
           YT    G+         G+ ++        +++D+M  ++ ++    +LS+     A+ +
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRDNMSKEETVNFIKHSLSQ-----AIKW 184

Query: 209 DRLEFATIRKGV-NDGEVYQKIFKPQEIKDL 238
           D      IR  V     V + +F P E + L
Sbjct: 185 DGSSGGVIRMVVLTAAGVERLVFYPDEYEQL 215

>NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507
          Length = 264

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 93/188 (49%), Gaps = 17/188 (9%)

Query: 20  YQVEYALESISHA--------GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLN 70
           YQ   AL + SH+        GT I G+  ++G+++AA+ + T   +  + +  KL++++
Sbjct: 9   YQRNAALAAKSHSQQPKATSTGTTIVGVKYANGVIIAADTRSTQGPIVANKNCAKLHRIS 68

Query: 71  DKISVAVAGLTADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLR 129
            +I  A AG  AD E +  T  I +   L + Y    P   +V  L  +KQ   ++ G  
Sbjct: 69  PRIWCAGAGTAADTEAV--TQLIGSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG-- 122

Query: 130 PFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDA 189
             G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ +M  + A
Sbjct: 123 HIGAYLIVAGTDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWEPEMSKEAA 181

Query: 190 IDLALKTL 197
           ++LA + +
Sbjct: 182 VELASQAI 189

>KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 240

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 70/159 (44%), Gaps = 6/159 (3%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K+++  D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKR 86

Query: 91  ARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYT 150
            +     Y   +N+ + ++   R +  +  G      + P+ V  I AG D+     +Y+
Sbjct: 87  FKNSQMWYHFNHNKKLTIKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYS 142

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDMKVD 187
            +P G+Y   +  + G+  S     L  Q++ K+  + D
Sbjct: 143 FDPVGSYEREQCRAGGSAASLIMPFLDNQVNLKNQYEPD 181

>TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 92/213 (43%), Gaps = 22/213 (10%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL ++ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           +   + Y   + E    +   I      D K   +            I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALT 207
           +Y+    G+    K    G+ ++        +YK++M  D+ +D    +LS+     A+ 
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSTFIYGYCDKNYKENMTKDETVDFMKHSLSQ-----AIK 184

Query: 208 YDRLEFATIRKGV--NDGEVYQKIFKPQEIKDL 238
           +D      IR  V   DG V + IF P E ++L
Sbjct: 185 WDGSSGGVIRMVVVTKDG-VERLIFYPDEYENL 216

>KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON}
           Anc_7.480 YBL041W
          Length = 248

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 91/225 (40%), Gaps = 29/225 (12%)

Query: 15  PEGRLYQVEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKI 73
           P      +E+     S + GT +GI   D  VLA + + T+       S  K++ + D I
Sbjct: 19  PSAMSQPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRSESKVFDVGDGI 78

Query: 74  SVAVAGLTADAEILINTARIHAQNYLKTY--NED---IPVEILVRRLSDIKQGYTQHGGL 128
            ++  G  AD+  L+   R    N LK Y  NE+   + +    R +  +  G       
Sbjct: 79  VISANGFAADSTALVKRFR----NSLKWYHFNENEKRLSLSAAARNIQHLLYGKR----F 130

Query: 129 RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD--- 183
            P+ V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+    
Sbjct: 131 FPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVP 190

Query: 184 ----------MKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRK 218
                     + V++ + L   + +  T+      D LE   + K
Sbjct: 191 GTGEKRPITYLSVEEVVKLVRDSFTSATERHIHVGDGLEILIVTK 235

>ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 89/211 (42%), Gaps = 19/211 (9%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T      +  T+KL +++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVSFKDGVILGADSRTTMGPYVANRVTDKLTRVHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNED---IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + +   Y   Y E        I  +   + K   T            I AGYD++   ++
Sbjct: 79  QYYLDLYTAQYGEPSTRTAAAIFQQLCYENKDALT---------AGIIVAGYDEKNQGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTY 208
           Y+    G+    K    G+ ++        +YKD M  D+ +D    +LS+     A+ +
Sbjct: 130 YSIPIGGSLHKQKYAIAGSGSTFIYGYCDKNYKDGMTKDETVDFIKHSLSQ-----AIKW 184

Query: 209 DRLEFATIRKGV-NDGEVYQKIFKPQEIKDL 238
           D      IR  V     V + I  P+E ++L
Sbjct: 185 DGSSGGVIRMVVLTKNGVERLIVYPEEFENL 215

>Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp,
           215 aa] {ON} similar to Ashbya gossypii AAL172C 1-intron
          Length = 215

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 90/208 (43%), Gaps = 13/208 (6%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTYKDGVILGADSRTTTGTYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + H   Y   Y E   V       S I   Y     L       I AGYDD+   ++YT 
Sbjct: 79  QHHLDLYAAQYGEP-SVNTAASLFSTI--CYENKDFLT---AGIIVAGYDDKNKGEVYTI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTYDRL 211
              G+         G+ ++        ++K++M  ++ I     +LS+     A+ +D  
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKNFKENMSKEETIRFMKHSLSQ-----AIKWDGS 187

Query: 212 EFATIRKGVNDGE-VYQKIFKPQEIKDL 238
               IR  V   E V + IF P++ + L
Sbjct: 188 SGGVIRMVVLTKEGVERLIFYPEDYESL 215

>KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 263

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 84/171 (49%), Gaps = 14/171 (8%)

Query: 27  ESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAE- 85
           ++ S   T +G+    G+++AA+ + T   +  + +  KL++++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYDGGVLIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
              ++ +   +H+      Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELHSM-----YASREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGADP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLA 193
             G  L++ +  G+       S+G+ + AA  +L+ +++ D+K ++A+ LA
Sbjct: 135 T-GTHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWRPDLKKEEAMQLA 184

>KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 242

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 78/179 (43%), Gaps = 8/179 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           +S E +   +E+     S + GT +GI   D  VLA + + T+          K++   D
Sbjct: 9   YSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 68

Query: 72  KISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGG-LRP 130
            I ++  G  AD   L+       QN LK Y+ D   + L  R +     +  +G    P
Sbjct: 69  NILISANGFAADGNALVKR----FQNSLKWYHFDHNDKKLSMRSAARNIQHLLYGKRFFP 124

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDMKVD 187
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  + D
Sbjct: 125 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 183

>SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137)
           [648 bp, 215 aa] {ON} similar to uniprot|P38624
           Saccharomyces cerevisiae YJL001W PRE3 20S proteasome
           beta-type subunit, responsible for cleavage after acidic
           residues in peptides
          Length = 215

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 91/212 (42%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E        +      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYDSQYGEPSTKTAASVFKTLCYENKDNLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTY 208
           Y+    G+         G+ ++        ++K+ M  ++ ID    +LS+     A+ +
Sbjct: 130 YSIPLGGSIHKQNYAIAGSGSTFIYGYCDKNFKEGMTKEETIDFIKHSLSQ-----AIKW 184

Query: 209 DRLEFATIRKGV--NDGEVYQKIFKPQEIKDL 238
           D      IR  V   DG V + +F P E ++L
Sbjct: 185 DGSSGGVIRMVVLTKDG-VERLVFYPDEYENL 215

>SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 261

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 77/183 (42%), Gaps = 16/183 (8%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           +S E +   +E+     S + GT +GI   D  VLA + + T+          K++   D
Sbjct: 28  YSNETKNVPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 87

Query: 72  KISVAVAGLTADAEILINTARIHAQNYLKTYN-----EDIPVEILVRRLSDIKQGYTQHG 126
            I ++  G  AD E L+       QN LK Y+       + +    R +  +  G     
Sbjct: 88  NILISANGFAADGEALVK----RFQNSLKWYHFNHNDRKLSLSSAARNIQHLLYGKR--- 140

Query: 127 GLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDM 184
              P+ V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  
Sbjct: 141 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY 199

Query: 185 KVD 187
           + D
Sbjct: 200 EPD 202

>AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 aa]
           {ON} syntenic homolog of Saccharomyces cerevisiae
           YJL001W (PRE3); 1-intron
          Length = 215

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 89/208 (42%), Gaps = 13/208 (6%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++D+I    +G  AD + + +  
Sbjct: 19  GTSIMAVKFRDGVILGADSRTTTGTYIANRVTDKLTRVHDRIWCCRSGSAADTQAVADMV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + + + Y   Y E           S I      H          I AGYDD+   ++Y+ 
Sbjct: 79  QHYLELYTMQYGEP-SASTAASLFSTICYENKDH-----LTAGIIVAGYDDKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTYDRL 211
              G+         G+ ++         +++DM  ++ ID    +LS+     A+ +D  
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKHFREDMSKEETIDFMKHSLSQ-----AIKWDGS 187

Query: 212 EFATIRKGV-NDGEVYQKIFKPQEIKDL 238
               IR  V  +    + IF P++ ++L
Sbjct: 188 SGGVIRMVVLTEAGAERLIFYPEDYENL 215

>TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 91/210 (43%), Gaps = 16/210 (7%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T      +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTMGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPF-GVSFIYAGYDDRYGYQLYT 150
           + H + Y   Y   IP     R  + + Q        + F     I AG+DD+       
Sbjct: 79  QYHLEVYTSQYG--IPS---TRTAASVFQSLCYEN--KDFLSAGIIVAGFDDKSEKGEVY 131

Query: 151 SNPSGNYTGWKAISVGANTSA-AQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTYD 209
           S P G     +  ++  + SA        +YK DM  D+ ++    +LS+     A+ +D
Sbjct: 132 SIPLGGSIHKQPYAIAGSGSAFIYGYCDKNYKPDMTKDETVEFMKHSLSQ-----AIKWD 186

Query: 210 RLEFATIRKGV-NDGEVYQKIFKPQEIKDL 238
                 IR  V     V + IF P++ ++L
Sbjct: 187 GSSGGVIRLVVLTKSGVERLIFYPEDYENL 216

>NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 89/212 (41%), Gaps = 20/212 (9%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL K++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNY---LKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           + H   Y     T +      +      + K   T            I AG+DD     +
Sbjct: 79  QYHLDIYSTQFGTPSTKTAASVFKTLCYENKDNLT---------AGIIVAGFDDATNKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALT 207
           +Y+    G+    K    G+ ++        ++KDDM  D+ +     +LS+     A+ 
Sbjct: 130 VYSVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVHFIKHSLSQ-----AIK 184

Query: 208 YDRLEFATIRKGVNDGE-VYQKIFKPQEIKDL 238
           +D      IR  V   E V + IF P E ++L
Sbjct: 185 WDGSSGGVIRMVVLTSEGVERLIFYPDEYENL 216

>Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 90/212 (42%), Gaps = 19/212 (8%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+DA+ L  +++       
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRD 243

Query: 205 ALT------YDRLEFATIRKGVND-GEVYQKI 229
           A +      Y   E   I  G +D GEV+ +I
Sbjct: 244 AFSGGSINLYHVTEDGWIYHGNHDIGEVFWEI 275

>Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON}
           similar to Ashbya gossypii AGL324W
          Length = 242

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 85/209 (40%), Gaps = 30/209 (14%)

Query: 32  AGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
            GT +GI   D  V+A + + T+       +  K++   D I ++  G  AD + L+   
Sbjct: 29  GGTILGIAGEDFAVIAGDTRHTTGYSINSRNEPKVFDCGDNILISANGFAADGDALVKKF 88

Query: 92  RIHAQNYLKTY-----NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY 146
           +    N LK Y     N+ + ++   R +  +  G      + P+ V  I AG D+    
Sbjct: 89  K----NNLKWYHFDHNNKKMTLKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEDGKG 140

Query: 147 QLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------MKVDDA 189
            +Y+ +P G+Y   +  + GA  S     L  Q+++K+                + +D+ 
Sbjct: 141 AVYSFDPVGSYEREQCRAGGAAASIIMPFLDNQVNFKNQYEPDSKGTKPKSIRFLSLDEV 200

Query: 190 IDLALKTLSKTTDSSALTYDRLEFATIRK 218
           I+L     +  T+      D L+   I K
Sbjct: 201 IELVRDAFTSATERHIHVGDSLQIMIITK 229

>CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041w PRE7
          Length = 242

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 73/173 (42%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKR 87

Query: 91  ARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG DD     +Y
Sbjct: 88  FKNSIKWYHFDHNDKKLSISSAARNIQHLLYGKR----FFPYYVHTIIAGLDDEGKGAVY 143

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDM--KVDDAIDLALKTLS 198
           + +P G+Y   +  + GA  S     L  Q+++K+      D  +   LK LS
Sbjct: 144 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPGTDGKVKRELKYLS 196

>Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON}
           (211095..211823) [729 nt, 243 aa]
          Length = 242

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 79/187 (42%), Gaps = 18/187 (9%)

Query: 22  VEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGL 80
           +E+     S + GT +GI   D  VLA + + T+          K++   D I ++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIVISANGF 77

Query: 81  TADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHGGLRPFGVSF 135
            AD E L+   +    N +K Y+ D     + +    R +  +  G        P+ V  
Sbjct: 78  AADGEALVKRFK----NSIKWYHFDNNDKTLSLSSAARNIQHLLYGKR----FFPYYVHT 129

Query: 136 IYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDMKVDD--AID 191
           I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  + D    + 
Sbjct: 130 IIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSDGTVK 189

Query: 192 LALKTLS 198
             LK LS
Sbjct: 190 RPLKFLS 196

>Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 90/212 (42%), Gaps = 19/212 (8%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+DA+ L  +++       
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRD 243

Query: 205 ALT------YDRLEFATIRKGVND-GEVYQKI 229
           A +      Y   E   I  G +D GE++ +I
Sbjct: 244 AFSGGSVNLYHVTEDGWIYHGNHDIGELFWEI 275

>Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W
           (PRE7) - proteasome subunit [contig 159] FULL
          Length = 242

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 74/174 (42%), Gaps = 16/174 (9%)

Query: 22  VEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGL 80
           +E+     S + GT +GI   D  VLA + + T+          K++   D I ++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGF 77

Query: 81  TADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHGGLRPFGVSF 135
            AD   L+       QN LK Y+ D     + ++   R +  +  G        P+ V  
Sbjct: 78  AADGTALVK----RFQNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR----FFPYYVHT 129

Query: 136 IYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDMKVD 187
           I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  + D
Sbjct: 130 IIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 183

>TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 72/177 (40%), Gaps = 15/177 (8%)

Query: 20  YQVEYALESISH--------AGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           Y  E A   I H         GT +GI   D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAHTPIQHQFNPYTDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRHESKVFDCGD 67

Query: 72  KISVAVAGLTADAEILINTARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+  + +    R +  +  G        P
Sbjct: 68  NIVMSANGFAADGEALVKRFKNSVKWYHFDHNDKKLSLSSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDMK 185
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  +
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQFE 180

>AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR157C (PUP1)
          Length = 259

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 80/174 (45%), Gaps = 16/174 (9%)

Query: 20  YQVEYALESISH--------AGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           YQ    L S SH          T +G+    G+V+AA+ + T   +  + + EKL+++  
Sbjct: 9   YQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAADTRSTQGPIVANKNCEKLHRIAP 68

Query: 72  KISVAVAGLTADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  I +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TWLIGSNLELHSLYTGREPR--VVSALQKLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDM 184
            G   I AG D   G  L++ +  G+    +  S+G+ + AA  +L+  +++ M
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSVHAHGSTDVGQYQSLGSGSLAAMAVLEAQWREGM 175

>TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 82/206 (39%), Gaps = 22/206 (10%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRFEPKVFDCGDNIVISANGFAADGEALVQR 86

Query: 91  ARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGG-LRPFGVSFIYAGYDDRYGYQLY 149
            +    N +K Y+ D   + L  + +     +  +G    P+ V  I AG D+     +Y
Sbjct: 87  FK----NSIKWYHFDHNDKKLTMKSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------MKVDDAIDL 192
           + +P G+Y   +  + GA  S     L  Q+++K+                + +D+ I L
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPESNGKVKRPLKYLTIDECIKL 202

Query: 193 ALKTLSKTTDSSALTYDRLEFATIRK 218
                +  T+      D LE   + K
Sbjct: 203 VRDAFTSATERHIQVGDGLEILIVTK 228

>YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5
           subunit of the 20S proteasome, responsible for the
           chymotryptic activity of the proteasome
          Length = 287

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 90/212 (42%), Gaps = 19/212 (8%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+DA+ L  +++       
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRD 243

Query: 205 ALT------YDRLEFATIRKGVND-GEVYQKI 229
           A +      Y   E   I  G +D GE++ K+
Sbjct: 244 AYSGGSVNLYHVTEDGWIYHGNHDVGELFWKV 275

>KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [651
           bp, 216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 90/209 (43%), Gaps = 14/209 (6%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYT 150
           + H + Y   Y     ++        I   Y     L       I AG+DD+    ++Y+
Sbjct: 79  QYHLELYESQYGAP-SIKTAASVFKSI--CYENKDNLSA---GIIVAGFDDKNEKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTYDR 210
               G+    K    G+ ++         +K+DM  D+ ++    +LS+     A+ +D 
Sbjct: 133 IPLGGSIHKQKYAIAGSGSTFIYGYCDKKFKEDMTKDETVNFIKHSLSQ-----AIKWDG 187

Query: 211 LEFATIRKGVNDGE-VYQKIFKPQEIKDL 238
                IR  +   E V + IF P E + L
Sbjct: 188 SSGGVIRMVILTKEGVERLIFYPDEYEKL 216

>Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 74/173 (42%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   DKI ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDKIVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDMK--VDDAIDLALKTLS 198
           + +P G+Y   +  + GA  S     L  Q+++K+  +   D  +   LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTDGKVKKPLKYLS 195

>TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 88/229 (38%), Gaps = 31/229 (13%)

Query: 22  VEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGL 80
           +E+     S + GT +GI   D  VLA + + T+          K++   D I ++  G 
Sbjct: 17  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDDIIISANGF 76

Query: 81  TADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHGGLRPFGVSF 135
            AD E L+   +    N +K Y+ D     + +    R +  +  G        P+ V  
Sbjct: 77  AADGEALVKRFK----NSIKWYHFDNNDKKLALSSAARNIQHLLYGKR----FFPYYVHT 128

Query: 136 IYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------- 183
           I AG D+     +Y+ +P G+Y      + GA  S     L  Q+++K+           
Sbjct: 129 IIAGLDEEGKGAVYSFDPVGSYEREFCRAGGAAASLIMPFLDNQVNFKNQYTPDSNGKVK 188

Query: 184 -----MKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQ 227
                + +D+ I L     +  T+      D LE   + K     E Y+
Sbjct: 189 RPFKHLSIDEVIKLVRDAFTSATERHIHVGDGLEILIVTKEGVRKEFYE 237

>KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 94/209 (44%), Gaps = 15/209 (7%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL ++++K+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFRDGVILGADSRTTTGAYIANRVTDKLTRVHEKVWCCRSGSAADTQAVADI- 77

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
               Q+YL+ Y             S  K    ++      G+  I AGYD++   ++Y+ 
Sbjct: 78  ---VQHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLTAGI--IVAGYDEKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTYDRL 211
              G+    K    G+ ++        +YK++M  D+ +     +LS+     A+ +D  
Sbjct: 133 PLGGSVHKQKYAIAGSGSTFIYGYCDKNYKENMSKDETVSFMKNSLSQ-----AIKWDGS 187

Query: 212 EFATIRKGV--NDGEVYQKIFKPQEIKDL 238
               IR  V   DG   + IF P++ ++L
Sbjct: 188 SGGVIRMVVLTKDG-AERLIFYPEDYENL 215

>KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 77/181 (42%), Gaps = 12/181 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  +++   T   
Sbjct: 184 GPTIYYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSILAATHRD 243

Query: 205 A 205
           A
Sbjct: 244 A 244

>KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 bp,
           216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 92/209 (44%), Gaps = 14/209 (6%)

Query: 33  GTAIGIMASDG-IVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +  DG ++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFDGGVILGADSRTTTGAYIANRVTDKLTRIDDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYT 150
           + H + Y   Y     +E        +   Y     L       I AGYDD+    ++Y+
Sbjct: 79  QYHLELYTSQYGTP-SIETAAAVFKTLT--YENKDALSA---GIIVAGYDDKKKKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTYDR 210
               G+    K    G+ ++        +Y+++M  ++ ++    +LS+     A+ +D 
Sbjct: 133 IPLGGSVHKQKYAIAGSGSAFIYGYCDKNYRENMNKEETVEFVKHSLSQ-----AIKWDG 187

Query: 211 LEFATIRKGV-NDGEVYQKIFKPQEIKDL 238
                IR  +  +  V + IF P E ++L
Sbjct: 188 SSGGVIRLVILTESGVERLIFYPDEYENL 216

>NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+DA+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDTNYKWDLTVEDALYLGKRSI 236

>ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa]
           {ON} highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 244

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 79/206 (38%), Gaps = 22/206 (10%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I +   G  AD E L+  
Sbjct: 30  NGGTVLGIAGEDFAVLAGDTRHTTDYSINSRYESKVFDCGDNIVITANGYAADGEALVKR 89

Query: 91  ARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 90  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVQTIIAGLDEEGKGAVY 145

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------MKVDDAIDL 192
           + +P G+Y   +  + GA  S     L  Q+++ +                + VD+ I L
Sbjct: 146 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFHNQYVPESNGRVKRPLKFLSVDEVIRL 205

Query: 193 ALKTLSKTTDSSALTYDRLEFATIRK 218
                +  T+      D LE   + K
Sbjct: 206 VRDAFTSATERHIQVGDGLEILIVTK 231

>Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 90/212 (42%), Gaps = 19/212 (8%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ ++DA+ L  +++       
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSIEDALYLGKRSILAAAHRD 243

Query: 205 ALT------YDRLEFATIRKGVND-GEVYQKI 229
           A +      Y   E   I  G +D GE++ +I
Sbjct: 244 AYSGGSVNLYHVTEDGWIYHGNHDVGELFWEI 275

>TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.417
           YPR103W
          Length = 286

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAE--- 85
           I+H  T +      GI++A + + T+       +  K+ ++N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVNKVIRINPFLLGTMAGGAADCQYWE 130

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 131 TWLGSQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ VD+A+ L  +++
Sbjct: 183 GPTVYYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSI 235

>TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 92/218 (42%), Gaps = 18/218 (8%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAE--- 85
           I+H  T +      GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGAQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK ++ V++A++L  +++   T   
Sbjct: 184 GPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDANYKWELGVEEALELGKRSILAATHRD 243

Query: 205 ALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLVKT 242
           A +   +    + +   DG VY       +I +L  +T
Sbjct: 244 AYSGGSVNLYHVTE---DGWVYH---GNHDINELFWET 275

>AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR103W
           (PRE2)
          Length = 285

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAE--- 85
           I+H  T +      GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 130 TWLGAQCRLHE---LKE-KERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKE 181

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTL 197
           G  +Y  +  G         VG+  + A  +L  +Y+ D+ V+DA+ L  +++
Sbjct: 182 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLSVEDALYLGKRSI 234

>KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 72/177 (40%), Gaps = 4/177 (2%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + Y     + I V    + L+++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLYELKEKQRITVAAASKILANLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSA 205
           Y  +  G         VG+  + A  +L  +YK D+ V+DA+ L  + +   T   A
Sbjct: 188 YYVDSDGTRLKGDVFCVGSGQTFAYGVLDTNYKWDLSVEDALYLGKRAILAATHRDA 244

>CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P38624 Saccharomyces
           cerevisiae YJL001w PRE3
          Length = 215

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 93/209 (44%), Gaps = 15/209 (7%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDNIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + +   Y   + E  P       +   K    Q+      G+  I AGYD++   ++Y+ 
Sbjct: 79  QYYLDMYEGQFGE--PDTYTAANM--FKTLCYQNKDALTAGI--IVAGYDEKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTYDRL 211
              G+         G+ ++        +++++M  D+ ID    +LS+     A+ +D  
Sbjct: 133 PLGGSIHKQPYAIAGSGSTFIYGYCDKNFRENMSKDETIDFIKHSLSQ-----AIKWDGS 187

Query: 212 EFATIRKGV--NDGEVYQKIFKPQEIKDL 238
               IR  V   DG   + IF P+E ++L
Sbjct: 188 SGGVIRMVVLTKDGP-ERLIFYPEEYENL 215

>ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 92/217 (42%), Gaps = 20/217 (9%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAE--- 85
           I+H  T +      GI++A + + ++       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRASAGSWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + L ++   Y  +G      +  +  GY  + 
Sbjct: 132 TWLGAQCRLHE---LKE-KERISVAAASKILCNLVYEYKGYG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  +++   T   
Sbjct: 184 GPTVYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSIIAATHRD 243

Query: 205 ALT------YDRLEFATIRKGVND-GEVYQKIFKPQE 234
           A +      Y   E   +  G +D GE + +I K QE
Sbjct: 244 AYSGGSVNLYHVTENGWVFHGNHDVGETFWQI-KEQE 279

>NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {ON}
           Anc_3.417
          Length = 287

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK  N  I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKEKNR-ISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSI 236

>YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6
           subunit of the 20S proteasome
          Length = 241

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 84/215 (39%), Gaps = 22/215 (10%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------MKVDDAIDL 192
           + +P G+Y   +  + GA  S     L  Q+++K+                + V++ I L
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKL 202

Query: 193 ALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQ 227
              + +  T+      D LE   + K     E Y+
Sbjct: 203 VRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYE 237

>TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON}
           Anc_3.417 YPR103W
          Length = 287

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 78/181 (43%), Gaps = 12/181 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  +++   T   
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSILAATHRD 243

Query: 205 A 205
           A
Sbjct: 244 A 244

>Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/215 (20%), Positives = 84/215 (39%), Gaps = 22/215 (10%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D + ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNLVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------MKVDDAIDL 192
           + +P G+Y   +  + GA  S     L  Q+++K+                + V++ I L
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTDGKVKKPLKYLSVEEVIKL 202

Query: 193 ALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQ 227
              + +  T+      D LE   + K     E Y+
Sbjct: 203 VRDSFTSATERHIQVGDGLEILIVTKDGVKKEFYE 237

>Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 84/215 (39%), Gaps = 22/215 (10%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------MKVDDAIDL 192
           + +P G+Y   +  + GA  S     L  Q+++K+                + V++ I L
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKL 202

Query: 193 ALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQ 227
              + +  T+      D LE   + K     E Y+
Sbjct: 203 VRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYE 237

>CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103w PRE2
          Length = 286

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 84/203 (41%), Gaps = 15/203 (7%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIVVAVDSRATAGQWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 130

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   E I V    + L ++   Y   G      +  +  GY  + 
Sbjct: 131 TWLGSQCRLHE---LKE-KERISVAAASKILGNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  +++       
Sbjct: 183 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSILAAAHRD 242

Query: 205 ALTYDRLEFATIRKGVNDGEVYQ 227
           A +   +    + +   DG VY 
Sbjct: 243 AYSGGSINLYHVTE---DGWVYH 262

>NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 92/210 (43%), Gaps = 16/210 (7%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRIHDKVWCCRSGSAADTQAVADI- 77

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD--RYGYQLY 149
               Q YL  Y             S  K    ++      G+  I AG+DD  + G ++Y
Sbjct: 78  ---VQYYLDLYTTQYGTPSTKTAASVFKTLCYENKDNLTAGI--IVAGFDDDTKKG-EVY 131

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTLSKTTDSSALTYD 209
           +    G+    K    G+ ++        ++K+DM  D+ I     +LS+     A+ +D
Sbjct: 132 SVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETIHFIKHSLSQ-----AIKWD 186

Query: 210 RLEFATIRKGV-NDGEVYQKIFKPQEIKDL 238
                 IR  +  +  V + IF P E ++L
Sbjct: 187 GSSGGVIRMVILTESGVERLIFYPDEYENL 216

>Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON}
           YPR103W (PRE2) - proteasome subunit [contig 47] FULL
          Length = 287

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           ++H  T +      GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  LAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYKWDLTVEEALYLGKRSI 236

>Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa]
           {ON} complement(382038..382904) [867 nt, 289 aa]
          Length = 288

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK  +  I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKEKSR-ISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ VD+A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSI 236

>SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 74/173 (42%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   + I V    + L ++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KQRISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ ++DA+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYKWDLTIEDALYLGKRSI 236

>Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AEL326C
          Length = 285

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 74/173 (42%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAE--- 85
           I+H  T +      GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + L ++   Y   G      +  +  GY  + 
Sbjct: 130 TWLGAQCRLHE---LKE-KERISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKE 181

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  +++
Sbjct: 182 GPTIYYVDSDGMRLKGDLFCVGSGQTFAYGVLDTNYKWDLTVEEALYLGKRSI 234

>KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 285

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 69  IAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 128

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 129 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKE 180

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTL 197
           G  +Y  +  G         VG+  + A  +L  +Y+ D+ V++A+ +  +++
Sbjct: 181 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYRWDLSVEEALYIGKRSI 233

>KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 76/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAE--- 85
           I+H  T +      GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   + I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKE-KDRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDLALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  +++
Sbjct: 184 GPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSI 236

>Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W
           (REAL)
          Length = 349

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 4   RRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIV 45
           RR++   T+  P+G LY V++A    +H G  +  + +DGI+
Sbjct: 96  RRWNKLCTLNDPKGSLYSVKFA---PAHLGLKLACLGNDGIL 134

>Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C -
           Hypothetical ORF [contig 247] FULL
          Length = 1617

 Score = 31.6 bits (70), Expect = 2.7,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKL 66
           DS   I     RLY+ E A+  I+H     GI + D + L AER      +  + +  KL
Sbjct: 158 DSLPAILRARSRLYERETAILGINHKNKETGI-SWDKLYLRAER------VAHELTKHKL 210

Query: 67  YKLNDKI 73
           YK+ DK+
Sbjct: 211 YKM-DKV 216

>KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly
           similar to uniprot|P30657 Saccharomyces cerevisiae
           YFR050C PRE4 20S proteasome beta-type subunit
          Length = 265

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 76/179 (42%), Gaps = 10/179 (5%)

Query: 20  YQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAG 79
           Y   +  + I    + I +   DG+++AA+R  +   L + +  E+L+ +     V ++G
Sbjct: 29  YPSMHTQQPIVTGTSVISMKYKDGVIIAADRLGSYGSLLRFSDVERLFPVGRNTVVGISG 88

Query: 80  LTADAEILINT--ARIHAQNYLKTYNED---IPVEILVRRLSDIKQGYTQHGGLRPFGVS 134
             +D + L N         NY   Y ED   +    +   L+++   Y +   + P   +
Sbjct: 89  DISDMQHLENLLDEMQTENNYDNEYAEDEEALKPSYVFEYLANVM--YNRRSKMNPLWNA 146

Query: 135 FIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDDMKVDDAID 191
            I AG +D   +  Y +     Y+   +++ G     A  LL+  +D + D+K   A D
Sbjct: 147 LIVAGLEDGKPFLKYVNLLGVTYSA-PSLATGFGAHLALPLLRKIVDSESDVKKTSAED 204

>TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa]
           {ON} Anc_2.618 YKL073W
          Length = 888

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 10/56 (17%)

Query: 111 LVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-----QLYTSNPSGNYTGWK 161
           L++ L D K+    HGGL     +F  AGY+ +  +       Y SNP    +GW+
Sbjct: 697 LIKELEDAKE--VTHGGLASINETFNQAGYNSQQEFAKINLPHYISNP---LSGWQ 747

>TPHA0A00730 Chr1 (131951..134104) [2154 bp, 717 aa] {ON} Anc_3.106
           YOL091W
          Length = 717

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 48/104 (46%), Gaps = 18/104 (17%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YDS TT+    G+L Q+EY  +SIS+    I            + +  + +LE +TS EK
Sbjct: 474 YDSITTVLDDYGKL-QIEY--DSISNKSQDI------------QNECKNLILELETSQEK 518

Query: 66  LYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVE 109
           +  L  K+S +       AE     +  HA   L+  NE + ++
Sbjct: 519 VLSLESKLSESTK---LQAETFRRHSHSHALPLLRRTNEKLQID 559

>TDEL0D02350 Chr4 (456952..458988) [2037 bp, 678 aa] {ON} Anc_1.364
           YOL023W
          Length = 678

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 67/163 (41%), Gaps = 25/163 (15%)

Query: 26  LESISHAGTA-----IGIMASDGIVLAAER-----KVTSTLLEQDTSTEKL------YKL 69
           +E+I HA  +     + I   D I  A ER     KVT+ L+ QD + EK+        +
Sbjct: 238 IEAIKHAKNSGNELIVAITKIDRISQAKERERAMEKVTNDLITQDIAVEKIGGDVQVIPI 297

Query: 70  NDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSD------IKQGYT 123
           + K    +  L     IL +   I A+N  KT  E   +E  V++         +K+G  
Sbjct: 298 SAKTGENMDLLEESIVILSDVMDIKAENSPKTVAEGWILESQVKKTVGNVATVLVKKGTV 357

Query: 124 QHGGLRPFGVSFIYA-GYDDRYGYQLYTSNPSG--NYTGWKAI 163
           Q G +   G ++       +  G Q+  + PS      GWK +
Sbjct: 358 QKGKILVCGNTYCKVRSIHNEGGQQVPKALPSDAVEVLGWKEL 400

>YER012W Chr5 (177835..178431) [597 bp, 198 aa] {ON}  PRE1Beta 4
           subunit of the 20S proteasome; localizes to the nucleus
           throughout the cell cycle
          Length = 198

 Score = 29.3 bits (64), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 71/161 (44%), Gaps = 9/161 (5%)

Query: 36  IGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTAR-IH 94
           +GI   D ++LA+ + VT  +     S +K  +L+    ++ AG   D    +  A  I 
Sbjct: 5   LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDT---VQFAEYIQ 61

Query: 95  AQNYLKTYNEDIPVEILVRRLSD-IKQGYTQH-GGLRPFGVSFIYAGYDDRYGY-QLYTS 151
           A   L +  ED   E+  + +S  ++Q   +     RP+ V+ +  GYD +    +LY  
Sbjct: 62  ANIQLYSIRED--YELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQI 119

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDL 192
           +  G        + G +     +LL   Y+ DM  ++ +DL
Sbjct: 120 DYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDL 160

>Skud_5.116 Chr5 (174986..175582) [597 bp, 198 aa] {ON} YER012W
           (REAL)
          Length = 198

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 69/161 (42%), Gaps = 9/161 (5%)

Query: 36  IGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKISVAVAGLTADAEILINTAR-IH 94
           +GI   D ++LA+ + VT  +     S +K  +L+    ++ AG   D    +  A  I 
Sbjct: 5   LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDT---VQFAEYIQ 61

Query: 95  AQNYLKTYNEDIPVEILVRRLSDI--KQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYTS 151
           A   L +  ED   E+  + +S    K+        RP+ V+ +  GYD R    +LY  
Sbjct: 62  ANIQLYSIRED--YELSPQAVSSFVRKELAKSIRSRRPYQVNVLIGGYDKRRNKPELYQI 119

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIDL 192
           +  G        + G +     +LL   Y+ DM  ++ ++L
Sbjct: 120 DYLGTKVELPYGAHGYSGFYTFSLLDRHYRPDMTTEEGLNL 160

>KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly
           similar to uniprot|P38236 YBR057C Saccharomyces
           cerevisiae MUM2 Cytoplasmic protein essential for
           meiotic DNA replication and sporulation
          Length = 316

 Score = 29.3 bits (64), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 15/127 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERK----VTSTLLEQDTS 62
           DSR +  S +GR  ++  +LESI H  +++ I A D  +    R+    VT+  L    S
Sbjct: 188 DSRVSSASQKGRTVEMPVSLESIFHKMSSV-IAAKDKELEETSRRLESIVTAIALNPSNS 246

Query: 63  TEKLYK-----LNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSD 117
             KL +     L  K+ V +  LT + +   + A++    Y ++  + I +E++ R   +
Sbjct: 247 VTKLGRYDEEALAHKMVVRLETLTKENQ---DMAKMLG--YGRSKEQHIELELIKRENQE 301

Query: 118 IKQGYTQ 124
           +K+  +Q
Sbjct: 302 LKRKLSQ 308

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa]
           {ON} some similarities with uniprot|Q02455 Saccharomyces
           cerevisiae YKR095W MLP1 Myosin-like protein associated
           with the nuclear envelope, connects the nuclear pore
           complex with the nuclear interior; involved in the Tel1p
           pathway that controls telomere length; involved in the
           retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 65  KLYKLNDKISV---AVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRL 115
           +L   N K++V    VA L  + E+L ++ R   +NYLK   E   + I+V +L
Sbjct: 750 ELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVSQL 803

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,714,344
Number of extensions: 1004444
Number of successful extensions: 3692
Number of sequences better than 10.0: 261
Number of HSP's gapped: 3541
Number of HSP's successfully gapped: 261
Length of query: 258
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 151
Effective length of database: 41,212,137
Effective search space: 6223032687
Effective search space used: 6223032687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)