Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2303.497ON1124112458240.0
YGR134W (CAF130)3.497ON1122112647120.0
Suva_7.4223.497ON1127113244520.0
Skud_7.4453.497ON1123112544400.0
ZYRO0D09790g3.497ON1180119523920.0
TDEL0D056503.497ON1077112323150.0
NCAS0E007703.497ON1150116823110.0
KAFR0C020003.497ON1066109722540.0
SAKL0F02596g3.497ON1132116820920.0
TBLA0C045103.497ON1307127320040.0
Kpol_480.123.497ON1114112919530.0
KLTH0G02442g3.497ON1113111918960.0
AFR316W3.497ON1191119919010.0
KNAG0B007703.497ON1038111118750.0
Kwal_47.188863.497ON1105110818610.0
Ecym_12323.497ON120493218270.0
NDAI0G009003.497ON127989617910.0
CAGL0I10428g3.497ON1163114317200.0
TPHA0A056803.497ON1074116115440.0
KLLA0E03961g3.497ON113211419991e-116
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.230
         (1124 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...  2248   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...  1819   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...  1719   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...  1714   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   926   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   896   0.0  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   894   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   872   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...   810   0.0  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   776   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   756   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   734   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   736   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   726   0.0  
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   721   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   708   0.0  
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   694   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   667   0.0  
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   599   0.0  
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   389   e-116

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score = 2248 bits (5824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1100/1124 (97%), Positives = 1100/1124 (97%)

Query: 1    MTKKKTTVNHVQKPVLAGGDPSGGSVCCERFVPLQELLKDKNYVPSVENLEKVLCDETML 60
            MTKKKTTVNHVQKPVLAGGDPSGGSVCCERFVPLQELLKDKNYVPSVENLEKVLCDETML
Sbjct: 1    MTKKKTTVNHVQKPVLAGGDPSGGSVCCERFVPLQELLKDKNYVPSVENLEKVLCDETML 60

Query: 61   NDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKKRKLWAQSFENNNSNYASIVFSW 120
            NDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKKRKLWAQSFENNNSNYASIVFSW
Sbjct: 61   NDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKKRKLWAQSFENNNSNYASIVFSW 120

Query: 121  KDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKD 180
            KDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKD
Sbjct: 121  KDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKD 180

Query: 181  YLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAENSAHLKFDD 240
            YLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAENSAHLKFDD
Sbjct: 181  YLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAENSAHLKFDD 240

Query: 241  NIACLMGSENNTENGLGDSRVNNNNYHKQPKDVVMSRTINDQEQIYSFELNHDGTLEIPN 300
            NIACLMGSENNTENGLGDSRVNNNNYHKQPKDVVMSRTINDQEQIYSFELNHDGTLEIPN
Sbjct: 241  NIACLMGSENNTENGLGDSRVNNNNYHKQPKDVVMSRTINDQEQIYSFELNHDGTLEIPN 300

Query: 301  VMKHSLLRHELLFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLF 360
            VMKHSLLRHELLFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLF
Sbjct: 301  VMKHSLLRHELLFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLF 360

Query: 361  LGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHWR 420
            LGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHWR
Sbjct: 361  LGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHWR 420

Query: 421  TQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVIL 480
            TQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVIL
Sbjct: 421  TQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVIL 480

Query: 481  LALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMS 540
            LALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMS
Sbjct: 481  LALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMS 540

Query: 541  PYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADY 600
            PYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADY
Sbjct: 541  PYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADY 600

Query: 601  XXXXXXXXXXXXXXGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVFESTC 660
                          GIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVFESTC
Sbjct: 601  DESFSESDDEGLEEGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVFESTC 660

Query: 661  NRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNMY 720
            NRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNMY
Sbjct: 661  NRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNMY 720

Query: 721  YSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNL 780
            YSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNL
Sbjct: 721  YSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNL 780

Query: 781  TGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEML 840
            TGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEML
Sbjct: 781  TGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEML 840

Query: 841  MCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQ 900
            MCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQ
Sbjct: 841  MCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQ 900

Query: 901  KNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLXXXXXXXXXXDGEKISLYSLGL 960
            KNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFL          DGEKISLYSLGL
Sbjct: 901  KNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLSSNNSEEENEDGEKISLYSLGL 960

Query: 961  VRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLAMEEDND 1020
            VRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLAMEEDND
Sbjct: 961  VRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLAMEEDND 1020

Query: 1021 TGTMQHEGRRSLDIEKKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSFD 1080
            TGTMQHEGRRSLDIEKKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSFD
Sbjct: 1021 TGTMQHEGRRSLDIEKKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSFD 1080

Query: 1081 TQVNPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDVGDSE 1124
            TQVNPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDVGDSE
Sbjct: 1081 TQVNPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDVGDSE 1124

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score = 1819 bits (4712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 901/1126 (80%), Positives = 980/1126 (87%), Gaps = 6/1126 (0%)

Query: 1    MTKKKTTVNHVQKPVLAGGDPSGGSVCCERFVPLQELLKDKNYVPSVENLEKVLCDETML 60
            MTKKK   N+ ++  LA  D SG SV  + F+PLQELLKDKNYVPSVENLEK+L +ETM 
Sbjct: 1    MTKKKAATNYAERQNLASEDSSGDSVHFKDFIPLQELLKDKNYVPSVENLEKILYNETMF 60

Query: 61   NDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKKRKLWAQSFENNNSNYASIVFSW 120
            NDQK+  +LL EAL ITLFTT SGKS L+ IQT + K+RK WAQSFENN+S+YASIV SW
Sbjct: 61   NDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLKERKSWAQSFENNSSSYASIVLSW 120

Query: 121  KDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKD 180
            KDNDILLLKF+RFLLANKT PL+I+RYNLPE+KLPLSFLIVSKI IPSILLNE YNLLKD
Sbjct: 121  KDNDILLLKFLRFLLANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKD 180

Query: 181  YLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAENSAHLKFDD 240
            YLYSITGRIE L+ CS  F++PALVV++ LKDY+RMIEC N Y WY FNAEN  +L F D
Sbjct: 181  YLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENRVNLTFSD 240

Query: 241  NIACLM-GSENNTENGLGDSRVNNNNYHKQPKDVVMSRTINDQEQIYSFELNHDGTLEIP 299
            NI+ LM   E N  +GL DSR +   + KQP++ +M RTINDQEQIYSFELN DGTLEIP
Sbjct: 241  NISLLMENDEGNAGSGLDDSRFD---HQKQPREAIMGRTINDQEQIYSFELNQDGTLEIP 297

Query: 300  NVMKHSLLRHELLFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKL 359
            NVM+HSLLRHELLFKILNLT V TPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLF+L
Sbjct: 298  NVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQL 357

Query: 360  FLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHW 419
            FLGLM  +IK+SQ HNDHYDWKFY CFNMQKIIDATM RLNCFDF+ILNSVNNTD++VHW
Sbjct: 358  FLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHW 417

Query: 420  RTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVI 479
            +TQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEK+PIQLNPFLFSLISLWKNLSCVI
Sbjct: 418  KTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVI 477

Query: 480  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFM 539
            LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIAT+LNGLVK N+HDFKHESLNTFM
Sbjct: 478  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFM 537

Query: 540  SPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECAD 599
            SPYGRKL HGALYADLRSH+ASLLA G SIEDVTDLFADLQSGDRFDEDIRYMFDYEC D
Sbjct: 538  SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED 597

Query: 600  YXXXXXXXXXXXXXXGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVFEST 659
            Y               +VN  EKI +S  NNVF +RRCNCIFNDDKLVAEDG NE F ST
Sbjct: 598  YDESFSESDHGGLDESVVNPTEKI-ASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGST 656

Query: 660  CNRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNM 719
             + N E  + NN + V N    TS+HV TS NP SVR+RSTFEFDYSGEDWRDVPRDFNM
Sbjct: 657  NSENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNM 716

Query: 720  YYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTN 779
            YYSPSY FIH+PKLDVIF+LTLRGATEKLN+EESILLVRSVASCV+NEQDQM+LADL++N
Sbjct: 717  YYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESN 776

Query: 780  LTG-ISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDE 838
             +  I+   EGE +T +SK DNE+LRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDE
Sbjct: 777  FSASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDE 836

Query: 839  MLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKK 898
            MLMCTGYRRILIWF THLELKHSLIYYVFELIMGLRGK FSG+ASDQDKKDDMIYEILKK
Sbjct: 837  MLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKK 896

Query: 899  KQKNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLXXXXXXXXXXDGEKISLYSL 958
            KQKN+DAS LPFSRQGPI+LSDIETKMLLQEFFMNAAIFL          DGEKISLYSL
Sbjct: 897  KQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNNEEENEDGEKISLYSL 956

Query: 959  GLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLAMEED 1018
            GLVRLICYMVQTLI NDKFFFTKSECTFELQTLLMTWIGILPEAKDLFF+IKTRLAMEE+
Sbjct: 957  GLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEE 1016

Query: 1019 NDTGTMQHEGRRSLDIEKKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYS 1078
            +   TMQHEGR++ DIEKKLN KPAS+LNLKLL+LFPS  A+  ++S INTLR+FI DYS
Sbjct: 1017 DSADTMQHEGRKNSDIEKKLNAKPASELNLKLLNLFPSKPANKDDSSPINTLRSFIADYS 1076

Query: 1079 FDTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDVGDSE 1124
            FDTQVNPPGR+VVFYDGKILPL KADKPIPLHEYITLAELDVGDSE
Sbjct: 1077 FDTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYITLAELDVGDSE 1122

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score = 1719 bits (4452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 843/1132 (74%), Positives = 962/1132 (84%), Gaps = 13/1132 (1%)

Query: 1    MTKKKTTVNHVQKPVLAGG--DPSGGSVCCERFVPLQELLKDKNYVPSVENLEKVLCDET 58
            M KKK   N  +  +LA G  D  G      +F+ LQELLKD++Y PSVENLEK+L DET
Sbjct: 1    MNKKKGATNDAENQILASGVNDSLGNVHRYAQFISLQELLKDRHYTPSVENLEKLLYDET 60

Query: 59   MLNDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKKRKLWAQSFENNNSNYASIVF 118
            +LNDQ++RF LLFEAL++TLFTT SGKSILQ+++  TSK+RK W +SFEN++SNYASI+ 
Sbjct: 61   ILNDQEIRFPLLFEALSVTLFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR 120

Query: 119  SWKDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLL 178
            SWK++D+LLLKF+RF+LANKT PL+IDRYNLP++KLPLSFLIVSK+N+PSI+LNEGYN+L
Sbjct: 121  SWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNML 180

Query: 179  KDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAENSAHLKF 238
            KDYLY+I+GR+E L+ C+  F+Q A + K TL+ YDRMIE  N Y WY F+AE +A  K 
Sbjct: 181  KDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKL 240

Query: 239  DDNIACLMGSENNTENGLG--DSRVNNNNYHKQPKDVVMSRTINDQEQIYSFELNHDGTL 296
            + NI  LM S  +  +G+   D    ++N+ KQPKD ++ RT+NDQEQIYSFELN DGTL
Sbjct: 241  NHNINLLMDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTL 300

Query: 297  EIPNVMKHSLLRHELLFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFL 356
            +IPNVM+HSLLRHELLFKILNLTPV TPLLE QFSTLCGLVDPL QPTPNDKHIISIDFL
Sbjct: 301  QIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFL 360

Query: 357  FKLFLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSS 416
            ++LFLGLMYP+IK+SQ HN+HYDWKFY CFNMQKIIDATM RLNCF F  LNS+NNTD +
Sbjct: 361  YQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDT 420

Query: 417  VHWRTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLS 476
            VHWRTQLH WLPHGLNTQDLELLYMIDILAVYTIYKLYE++PIQLNPFLFSL+SLWKNLS
Sbjct: 421  VHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLS 480

Query: 477  CVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLN 536
            CVILLALEIDRIEEE GTYETPLMVRATIRGAAALRSVIA +LNGLVK+N+HDFKHESLN
Sbjct: 481  CVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLN 540

Query: 537  TFMSPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYE 596
            TFMSPYGRKL HGALYADLRSH+ASLLA G SIEDVTDLFADLQSGDRFDEDIRYMFDYE
Sbjct: 541  TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE 600

Query: 597  CADYXXXXXXXXXXXXXXGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVF 656
            C DY              G VN+ EK K+S  N  F QRRCNCIFNDDKLVAEDG N   
Sbjct: 601  CEDYNESFSDCGDEELGEG-VNSGEKTKTSIHNG-FYQRRCNCIFNDDKLVAEDGAN--- 655

Query: 657  ESTCNRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRD 716
             ST N + +  +R++ +  SNTAIT +NH ++SINP+SVR+RSTFEFDYSGEDWRDVP+D
Sbjct: 656  ASTNNDSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKD 715

Query: 717  FNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADL 776
            FN+YYSPSY FI +PKLD+IFNLTLRGATEKL+REES+LLVRSVASCVKNEQDQM+LADL
Sbjct: 716  FNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADL 775

Query: 777  KTNLTGISKHAEGENSTSIS-KTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRL 835
             +N T I ++ EG ++   S KT++EELRRTTPDDIYEIWSEESAFERML VNHDVAWRL
Sbjct: 776  GSNFTSIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRL 835

Query: 836  MDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEI 895
            MDEMLMCTGYRRILIWF THLELKHSLIYYVFELIMGLRG  FSG+ASDQD+KDDMIYEI
Sbjct: 836  MDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEI 895

Query: 896  LKKKQKNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLXXXXXXXXXXDGEKISL 955
            LKKKQKN++ S LPFSRQGPI+LSDIETKMLLQEFFMNAAIFL          D +K+SL
Sbjct: 896  LKKKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEGEDADKVSL 955

Query: 956  YSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLAM 1015
            YSLGLV+LICYMVQTLI NDKFFFTKSECTFELQTLLMTWIGILPEAKDLFF+IK+RLAM
Sbjct: 956  YSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKSRLAM 1015

Query: 1016 EEDNDT-GTMQHEGRRSLDIE--KKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRN 1072
            EED  T  T+QH+ +  LD++  KK NTK  SKLN+K+LSLFPSN  +N +NSAI+TLR+
Sbjct: 1016 EEDGITDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLRS 1075

Query: 1073 FITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDVGDSE 1124
            FITDYSFDTQV  PGR+VVF+D KILPL KADKPIPLHEYITLAELD+GDSE
Sbjct: 1076 FITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAELDMGDSE 1127

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score = 1714 bits (4440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 839/1125 (74%), Positives = 966/1125 (85%), Gaps = 3/1125 (0%)

Query: 1    MTKKKTTVNHVQKPVLAGGDPSGGSVCCERFVPLQELLKDKNYVPSVENLEKVLCDETML 60
            MTKKK   N V++ +L G + S  ++  E+FVPLQ LLKDKNYVPS+ENLEK+L +E++L
Sbjct: 1    MTKKKIATNDVERQLLLGDNSSNDALRYEQFVPLQVLLKDKNYVPSLENLEKLLYNESIL 60

Query: 61   NDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKKRKLWAQSFENNNSNYASIVFSW 120
            +DQK+R S+LFEAL+I LFTT SGKSILQ++Q  T K++KLWAQS  +++SNYAS+V  W
Sbjct: 61   DDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQSLRDDDSNYASVVQGW 120

Query: 121  KDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKD 180
            KDND+L LKF+RFLLANKT  L+ID+YNLPE+KLPLSFLIVSKIN PSI+LNEG+N+LKD
Sbjct: 121  KDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKD 180

Query: 181  YLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAENSAHLKFDD 240
            YLYS++GRI+ L+  +   ++ ALVVK+ LKDYDR++E  N Y WY FN EN  + +F D
Sbjct: 181  YLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFEFSD 240

Query: 241  NIACLMGS-ENNTENGLGDSRVNNNNYHKQPKDVVMSRTINDQEQIYSFELNHDGTLEIP 299
            N   LM S E++ + G+ D R  ++N  K  K+ ++ RTINDQEQIYSFEL+ DGTL+IP
Sbjct: 241  NFDLLMNSPEDHADGGVIDDRCKSDNPQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIP 300

Query: 300  NVMKHSLLRHELLFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKL 359
            N+M+HSL+RHELLFKILNL  V TPLLELQF  LCGLVDPLMQP+PND+ +ISIDFLF+L
Sbjct: 301  NIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQL 360

Query: 360  FLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHW 419
            FLGLMYP+IKSSQ HNDHYDWKFYTCFNMQKIIDATM RLNC DF  LNSVNNTDS +HW
Sbjct: 361  FLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHW 420

Query: 420  RTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVI 479
            RTQLH+WLPHGLNTQDLELLYMIDILA+YTIYKLYEK+PIQLNPFLFSL+SLWKNLSCVI
Sbjct: 421  RTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVI 480

Query: 480  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFM 539
            LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIA++LNGLVK+N+HDFKHESLNTFM
Sbjct: 481  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFM 540

Query: 540  SPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECAD 599
            SPYGRKL HGALYADLRSH+ASLLA G SIEDVTDLFADLQSGDRFDEDIRYMFDYEC D
Sbjct: 541  SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED 600

Query: 600  YXXXXXXXXXXXXXXGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVFEST 659
            Y                 N+R KIKSS+ N  F QRRCNCIFNDDKLVAEDG NE FE +
Sbjct: 601  YNEPFSESDDEQLNED-ANSRGKIKSSSSNG-FYQRRCNCIFNDDKLVAEDGTNEAFEIS 658

Query: 660  CNRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNM 719
             N N E  + NN++V+ +TA T SN  ++SINP SVR+RSTFEFDYSGEDWRDVP+DFNM
Sbjct: 659  GNSNMENEMPNNVNVIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNM 718

Query: 720  YYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTN 779
            YYSPSY FI +PKLDVIFNLTLRGATEKLNR++SI+LV SVASCVKNEQDQM+L+DL +N
Sbjct: 719  YYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSN 778

Query: 780  LTGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEM 839
               I ++ E ++S +I+KT+NEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEM
Sbjct: 779  FAEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEM 838

Query: 840  LMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKK 899
            LMCTGYRRILIWF THLELKHSLIYYVFEL+MGLRGK FSG+ASDQD+KDDMIYEILKKK
Sbjct: 839  LMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKK 898

Query: 900  QKNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLXXXXXXXXXXDGEKISLYSLG 959
            +KN+D S LPFSRQGPI+LSDIETKMLLQEFFMNAAIFL          DGEKISLYSLG
Sbjct: 899  RKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNDEEENEDGEKISLYSLG 958

Query: 960  LVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLAMEEDN 1019
            LV+LICYMVQTLI NDKF FTKSECTFELQTLLMTWIG+LPEAKDLFF+IKTRLAMEED+
Sbjct: 959  LVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRLAMEEDS 1018

Query: 1020 DTGTMQHEGRRSLDIEKKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSF 1079
            D    Q++  + L++E++ +TK  S+LN+KLL+LFPSN A N +NSAI+TLR+FITDY F
Sbjct: 1019 DKDGQQNDDNKDLEVERRPHTKSNSELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPF 1078

Query: 1080 DTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDVGDSE 1124
            DTQ+ PPGRKVVFYDGKILPL+KADKPIPLHEYITLAE+DVG+SE
Sbjct: 1079 DTQITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEIDVGESE 1123

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1195 (43%), Positives = 722/1195 (60%), Gaps = 114/1195 (9%)

Query: 3    KKKTTVNHVQKPVLAGGDPSGGSVCCERFVPLQELLKDKN-------------------Y 43
            K KT  ++V +    G   +G ++  E ++PL  L KD++                   Y
Sbjct: 6    KSKTNSSNVTESAFNG---NGNNINKEEYIPLGAL-KDEDMLDLKMISLEELLAERELDY 61

Query: 44   VPSVENLEKVLCDETMLNDQKVRFSLLFEALAITLFTTNSGKSILQ---------SIQTF 94
                E L+++L D     D ++++SLL E + + L TT +G S+L          SI   
Sbjct: 62   DARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPKC 121

Query: 95   TSKKRKLWAQSFENNNSNYASIVFSWKDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKL 154
             S +RK W    E     ++ ++  W+ +D + LKF+ FLL N+ + L  +  N  E K+
Sbjct: 122  ISNQRK-WLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKV 180

Query: 155  PLSFLIVSKINIPSILLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYD 214
            PLSFLI SK     ++L+  YNLL DY  ++    E+ L  +  +    + +KRT+ +Y+
Sbjct: 181  PLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGN-GVHLKRTVINYN 239

Query: 215  RMIECENCYCWYYFNAENSAH------LKF------DDNIACLMGSENNTE--------- 253
            R+ +    + WY      S H      + F      D  I  +   E+N +         
Sbjct: 240  RVYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESNDQEERIQIIDQ 299

Query: 254  -----NGLGDSRVNNNNYHKQPKDVV------MSRTINDQEQIYSFELNHDGTLEIPNVM 302
                   +  + +N+  Y  + +  +          +N  EQ++SF+LN DG+LE+PN+M
Sbjct: 300  IRSAIQDISSASLNSGFYGDEDRSALEEYSDNYHHQVNQNEQVFSFDLNQDGSLELPNLM 359

Query: 303  KHSLLRHELLFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLG 362
             H+ +RHE+L K+L L   S+PLL+LQF  + GLVDPL QP PNDKH+IS+D L+++FLG
Sbjct: 360  SHAAVRHEILMKVLKLNNSSSPLLQLQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLG 419

Query: 363  LMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHWRTQ 422
             + P I+ +    +  DW+F+ CFNMQKIIDA++ RLN  DF  LNS+NN+D +V WR+Q
Sbjct: 420  FLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQ 479

Query: 423  LHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLA 482
            L +WLPHG NTQDLEL+ M+DI+AVYTIYKLYE LPIQLNPFL SLISLWKNL+CVILL 
Sbjct: 480  LDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLG 539

Query: 483  LEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPY 542
            LEIDRIEEE  T++TPLMVRATIRGAAALR+++AT+LNG V+  +HD KHESLNTFMSP+
Sbjct: 540  LEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPH 599

Query: 543  GRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYXX 602
            GRKL  GALYA+LRSH+A+LLA G+ +EDVT LF+DLQ GDRFDED+RYMF+YE  DY  
Sbjct: 600  GRKLCQGALYAELRSHAAALLALGSELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYND 659

Query: 603  XXXXXXXXXXXXGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVFESTCNR 662
                           +  +  K+         RRCNCIF+DD+++         +     
Sbjct: 660  LSSREEDYSGFDKYDDYTDSSKTHARKGF--GRRCNCIFDDDEMLE------DEDYENEY 711

Query: 663  NGERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYS 722
             G +  +    ++     TTS  +ST+  P ++R+  +FEFDYSG+DWRD+PR  N+YYS
Sbjct: 712  EGHKAPKQ---ILPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYS 768

Query: 723  PSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNLTG 782
            P+Y F+ D   + I +LT +   + L++ ES+LL+ SVA+CVKNEQD++VL     N+T 
Sbjct: 769  PNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLG----NITE 824

Query: 783  ISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMC 842
            +        S  I K     L+  +PDDIYE+W ++S FE+M+  NH+VAWRLMDEMLMC
Sbjct: 825  LHHQNGSRGSQVIDK-----LKDISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMC 879

Query: 843  TGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQKN 902
            +G+RR+LIWF TH+EL HSLI+Y+FEL+MGLR K+F  + ++ D  D+ I E+   K+  
Sbjct: 880  SGFRRVLIWFITHMELNHSLIHYIFELVMGLR-KSFD-ENNENDNGDESISEM--TKEAP 935

Query: 903  DDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLXXXXX----------XXXXXDGE- 951
            +  +SLPFSRQG I LS IETKMLLQEFF NAAIFL                    DGE 
Sbjct: 936  EVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEWIGEEPMEDEATINDGEN 995

Query: 952  -KISLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIK 1010
              +SLY++GL++LIC MV+  I   KF F +SEC FELQTLLM WI I+PEAKDLFFE+K
Sbjct: 996  GNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFELK 1055

Query: 1011 TRLAMEEDNDTGTMQHEGRRSLDIEKKL-----------NTKPASKLNLKLLSLFPSNSA 1059
              L  E  +D    +       D  KKL           N    S+ N KL+SL      
Sbjct: 1056 A-LVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVDSEYNRKLISLLSPVMH 1114

Query: 1060 DNGENSAINTLRNFITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYIT 1114
               EN+A+  LRNFI  YSFDT V   GRKVV+   +ILPL +++ P+ L +Y+ 
Sbjct: 1115 RKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPESETPMSLLDYLV 1169

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1123 (45%), Positives = 699/1123 (62%), Gaps = 107/1123 (9%)

Query: 29   ERFVPLQELLKDKNYVP--SVENLEKVLCDETMLNDQKVRFSLLFEALAITLFTTNSGKS 86
            ++  PL ELL + N  P   VE L + L +E +L + + R SL+ E L I LFTT +G S
Sbjct: 7    DKVRPLHELLVEANLQPLKGVEGLAEALREEKVLKNDQWRPSLICETLIIALFTTRAGIS 66

Query: 87   ILQSIQTFTSKKRKLWAQSFENNNSNYASIVFSWKDNDILLLKFVRFLLANKTMPLKIDR 146
            +L        +KR                 V  W +++ L+L+F  ++L N++  ++   
Sbjct: 67   LLPLFSESAKRKR-------------VGPRVLEWHNDEELMLRFFSYILENRSSRIEPRL 113

Query: 147  YNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVV 206
            +     KLPL FLI SK    S++L++ YNLL DY+++IT  I+  +  +  F Q     
Sbjct: 114  FEKARWKLPLFFLIESKFLAASMVLDQNYNLLLDYVHTITPMIKRWVHRA--FTQ-GTFF 170

Query: 207  KRTLKDYDRMIECENCYCWYYFNAENSAHLKFDDNIACLMGSENNTENGLGDSRVNNNNY 266
            K T+  Y+R+ E ++   WY F  + S     ++  A       N+E  L       + Y
Sbjct: 171  KDTVVCYNRVYELKDSSEWYSFGTKKSN----EERRAIQQFLRENSEQVL-------DTY 219

Query: 267  HK--QPKDVVMSRTIND----------QEQIYSFELNHDGTLEIPNVMKHSLLRHELLFK 314
            H+  +P +    R IND           E +YSF++N DG+LEIPN+M H+ +RH++L  
Sbjct: 220  HEMVRPSN---ERAINDTASYHHRISQHENVYSFDINQDGSLEIPNIMSHASVRHDILQN 276

Query: 315  ILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGH 374
            ++ L    +PLL+ QF  + GLVDPL QP PNDKHIIS+D L+++ LGLM PAI ++ G 
Sbjct: 277  LMRLPLCDSPLLQWQFKLMAGLVDPLTQPPPNDKHIISLDLLYQMLLGLMEPAISNTLG- 335

Query: 375  NDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHWRTQLHRWLPHGLNTQ 434
            +D  DWKF+ CFNMQKII A++ RLN  DF+ LNS+NN+D  V WR  LH WLPHGLNTQ
Sbjct: 336  SDGCDWKFHLCFNMQKIIQASLKRLNLQDFDTLNSINNSDEDVSWRDNLHSWLPHGLNTQ 395

Query: 435  DLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGT 494
            +LEL+YMIDILAVYTIYKLYE LP+QLNPFL  +ISLWKNL+CVILL LEIDR EEE+ T
Sbjct: 396  NLELIYMIDILAVYTIYKLYEDLPVQLNPFLSPMISLWKNLTCVILLGLEIDRFEEEHET 455

Query: 495  YETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYAD 554
            +ETP++VRATIRGAAALR+V+ATILNG V T +HDF HE LNTFMSP+GRKL  GALYAD
Sbjct: 456  FETPVLVRATIRGAAALRAVVATILNGHVDTYKHDFMHEPLNTFMSPHGRKLCQGALYAD 515

Query: 555  LRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYXXXXXXXXXXXXXX 614
            LRSH+A+LLA GT +EDVT+L ADLQ+GDRFDED+RYMF+YEC +Y              
Sbjct: 516  LRSHAAALLALGTELEDVTNLLADLQAGDRFDEDVRYMFEYECDNY------------NE 563

Query: 615  GIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVFESTCNRNGERRVRNNIDV 674
            G   + +  K + +     QRRCNCIF+DD++  +       E     N E     ++ +
Sbjct: 564  GDSESEKDGKLAVEQPKILQRRCNCIFDDDEMAED-------EDFDGENDEAFFSKHLIL 616

Query: 675  VSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSYPFIHDPKLD 734
              N    TS  +S+S  P +VR+   FEFDYSG+DWRD+PR  N YYSP + FI  P L 
Sbjct: 617  QQNA--QTSLSMSSSGKPRAVRSGGAFEFDYSGKDWRDIPRGSNFYYSPDFEFIESPSLS 674

Query: 735  VIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNLTGISKHAEGENSTS 794
             +  LT + ++EKL  +ES+ L+RSVASCVKNEQD++ L +L      I  H + +    
Sbjct: 675  SLLALTKKASSEKLVEKESLTLLRSVASCVKNEQDEITLGNL------IDPHQDSQADEE 728

Query: 795  ISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFFT 854
                D     +  PDDIYE+W E S FE+++  NH +AW+LMDEML+C GYRR+LIWF T
Sbjct: 729  SRNAD-----KIEPDDIYEMWCENSTFEKIVYFNHTLAWKLMDEMLLCIGYRRVLIWFIT 783

Query: 855  HLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKD-DMIYEILKKKQKNDDASSLPFSRQ 913
            H+EL HSLI+Y+FEL+MGLRG       SD++ +D D+    L+   K     S+ FSRQ
Sbjct: 784  HMELNHSLIHYIFELVMGLRGN------SDENDRDVDLAGPPLQDVDKVKGELSVGFSRQ 837

Query: 914  GPIILSDIETKMLLQEFFMNAAIFLXXXXXXXX--------------XXDGEKISLYSLG 959
            G + LS IETKMLLQEFF NAAIF+                        + E +SLY++G
Sbjct: 838  GALQLSTIETKMLLQEFFTNAAIFISKKSEESTDIANEEQNNENRDLNGNSENVSLYAMG 897

Query: 960  LVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLA----- 1014
            L++LIC+MV+T I  +KF F++SEC FELQ LLM WIGI+PEAK LFFE+K+ +A     
Sbjct: 898  LMKLICFMVRTFINKEKFDFSESECVFELQALLMNWIGIIPEAKTLFFELKSLIAGFSTA 957

Query: 1015 -MEEDNDTGTMQHEGRRSLDIEK---KLNTKPASKLNLKLLSLFPSNSADNGENSAINTL 1070
               ++     ++++ +  +  E+   +++     + N KL++L P    +  EN+A+ TL
Sbjct: 958  TSVQEQKNAEVKNDTQEDVPKEQSPVRVSNTAGFEFNRKLMTLLPPLVKNKEENAAMQTL 1017

Query: 1071 RNFITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYI 1113
            R+FI   SF   V   GRK+V+ D KILPL K+D P+ LHEYI
Sbjct: 1018 RSFIKTSSFLNTVPVIGRKIVYEDDKILPLPKSDVPLALHEYI 1060

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1168 (44%), Positives = 703/1168 (60%), Gaps = 142/1168 (12%)

Query: 31   FVPLQELLKDKNYVPSVENLEKVLCDETMLNDQKV--RFSLLFEALAITLFTTNSGKSIL 88
            + PL+EL  ++NY PS+  L  +L D+ +LN+       SLL E + I   +T SGK +L
Sbjct: 31   YTPLRELFAERNYQPSLSQLLNLLSDDALLNNLTPIQEHSLLVECVIIGFLSTRSGK-LL 89

Query: 89   QSI--------QTFTSKKRKLWAQSFENNNSNYASIVFSWKDNDILLLKFVRFLLANKTM 140
            QS          TF   + K W  S + + + +  +   W  N +  LKF +FLL N   
Sbjct: 90   QSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRKKWSSNKLYFLKFTKFLLVNADG 149

Query: 141  PLKIDRYNLPEHKLPLSFLIVSKINI-PSILLNEGYNLLKDYLYSITGRIEELLMCSPKF 199
             + +D+Y  P +KLPL+FL     N+ P+ +L+  YNLL+DY+Y+          C P  
Sbjct: 150  NINVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLLQDYIYA----------CGPLL 199

Query: 200  NQPALVVKRTLKD---------YDRMIECENCYCWY-YFNAENSAHLKFDDNIACLMGSE 249
                 V+K TL++         Y   I+ +  Y WY      +  HL            +
Sbjct: 200  ---KCVMKDTLENGICLDLPGIYKLDIDLQFPYPWYDLLPPMHEGHLN--------ATKQ 248

Query: 250  NNTENGLGDSRVNNNNYHKQPK-DVVMSRTINDQEQIYSFELNHDGTLEIPNVMKHSLLR 308
            NN  N +  +         QP      +   N+ + +YSF+LN D T E+ NV+ H+  R
Sbjct: 249  NNNSNNIPLTM--------QPSIKTNNNGANNNNQTVYSFDLNTDKTFELDNVVSHTAKR 300

Query: 309  HELLFKILNLTPV-STPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPA 367
            H +L +++N   + +TPLL LQF+ + GLVDPL QP PN+K +IS+  L+ +F+GLMYP 
Sbjct: 301  HRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPN 360

Query: 368  IKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSV----------NNTDSSV 417
            +K     ND ++WKF+ CFNM K+I+ +M  L C +FN LN +             D   
Sbjct: 361  LKECFNANDGFNWKFHICFNMVKLINNSMVILKCDNFNKLNDIINSNNDNDEGTENDDDD 420

Query: 418  HWRTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSC 477
             W+ +L+ W+PHG+NTQDLEL+YMI+I+AVYTIY+LY  LPIQ+NPFL  LI+LWKNLS 
Sbjct: 421  AWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSA 480

Query: 478  VILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNT 537
            +ILL L+IDR EE   T+ TPL+VRATIRGAA+LR+V+ATILN  V  NEHDFKHE LNT
Sbjct: 481  IILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNT 540

Query: 538  FMSPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYEC 597
            FMSP+GRKL  GALYAD+RSH+A++LA G  +EDVTDL  DLQ+GDRFDEDIRYMFDYE 
Sbjct: 541  FMSPHGRKLCQGALYADIRSHAAAILALGAELEDVTDLLTDLQAGDRFDEDIRYMFDYEY 600

Query: 598  ADYXXXXXXXXXXXXXXGIVNAREKIKSSNDNNVFCQ--RRCNCIFNDDKLVAEDGLNEV 655
             DY                 + ++ ++   +  +     RRCNCIF DD ++ +D  N  
Sbjct: 601  DDYN----------------DFKDDVEEQEEMEIMGSFPRRCNCIFEDDNIINDDTDNIN 644

Query: 656  FESTCNRNGERRVRNNIDVVS----------NTAITTSNHVSTSINPFSVRARSTFEFDY 705
                 + + +    + I+ V+          + AI T N      +P S R++S+FEFDY
Sbjct: 645  ENDEDDDDEQEEYVDAIEGVTKDTPHNNLNPHDAIRTRNS-----HPNSKRSKSSFEFDY 699

Query: 706  SGEDWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVK 765
             G+DWRD+PR FN+YYSPSY FI  P ++ I  LT +   EKL  E+S LL+ +VASC+K
Sbjct: 700  GGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIK 759

Query: 766  NEQDQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERML 825
             EQD+M+  +L  + T    HA  EN       D+ + +  TPDDIY++WSEES FERML
Sbjct: 760  LEQDKMISKELLKHNTVKHPHA-AENE------DDADFKIATPDDIYDMWSEESKFERML 812

Query: 826  NVNHDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQ 885
             +N DVAWRLMDEMLMC GYRR+LIWF TH+EL HSLI Y+FEL+MGLRG  FSG+  + 
Sbjct: 813  YLNQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDET 872

Query: 886  DKKDDMIYEILKKKQKNDDASS----LPFSRQGPIILSDIETKMLLQEFFMNAAIFLXXX 941
            D K+D+++EI+  + KN +  +    LPFSRQGP+ILS+IE KMLLQEFF NAAI+    
Sbjct: 873  DSKNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSK 932

Query: 942  XXXXXXX---DGEKI-------SLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTL 991
                      +GE I       S+YS GLV+LIC+MVQ+L+ N+KF F KSECTFELQTL
Sbjct: 933  SNNEGTTNNDNGEGIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTL 992

Query: 992  LMTWIGILPEAKDLFFEIK-------TRLAMEEDN------------DTGTMQHEGRRSL 1032
            LM WIGI+PEA+DLFF +K       T+   E D+            D G   H G    
Sbjct: 993  LMNWIGIIPEAEDLFFTLKSGVSSSSTKTGRESDDHDNTHADNLSFSDDGDTGHPGISRF 1052

Query: 1033 DIEKKLNTKP-ASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSFDTQVNPPGRKVV 1091
            D +   ++ P  S  N +L+SL P    D  EN+A++TLR+FI  YSFD +    GRKVV
Sbjct: 1053 DTD---DSPPNESIFNKRLVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVV 1109

Query: 1092 FYDGKILPLTKADKPIPLHEYITLAELD 1119
            + D  +LPL  AD+PI  HEY+T  ELD
Sbjct: 1110 YSDEIVLPLPAADQPISFHEYLT--ELD 1135

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1097 (45%), Positives = 699/1097 (63%), Gaps = 93/1097 (8%)

Query: 47   VENLEKVLCDETMLNDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTS-----KKRKL 101
            VEN+  +  D + L  Q    S+L E L I+LFTT SG SIL  +    +     ++   
Sbjct: 31   VENVNTI-NDLSSLLGQNNEPSVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNS 89

Query: 102  WAQSFENNNSNYASIVFS-WKDN-DILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFL 159
            W +S  + + NY  +    W+ N +  L +F +FLL N+ +P  ++ Y+L ++KL L  L
Sbjct: 90   WLES-SSGDLNYKYLKHELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRL 148

Query: 160  IVSKINIPSILLN-EGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIE 218
            I S+ NI S++LN + YNLL D++      + +L+    + N+   ++ +    Y+R+ E
Sbjct: 149  INSESNIISLILNSDNYNLLLDFIMFFQPYMNDLISYIVEGNKFFEIIAK----YNRIYE 204

Query: 219  CENCYCWYYFN--AENSAHLKFDDNIACL--MGSENNTENGLGDSRVNNNNYHKQPKDVV 274
                + WY     +  S  +++ +++  +  M ++  T N        +  + +  + ++
Sbjct: 205  LNGFHTWYTLTIASNTSIAVRYLNDVLSIDPMITDQFTSN------YRDKAFQESEETLL 258

Query: 275  MSRTINDQEQI-YSFELNHDGTLEIPNVMKHSLLRHELLFKILNLTPVSTPLLELQFSTL 333
            MS+    ++ I +SF+LN  G  ++PN++KHS +RH++++ ILNL  + +P L+ QF  +
Sbjct: 259  MSQQQTAKDDIIFSFDLNETG--DLPNLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLLI 316

Query: 334  CGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIID 393
            CGLVDPL QP PN++HIISID +++LF+GLMY    +     D     F  CFNMQKII 
Sbjct: 317  CGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIIS 376

Query: 394  ATMSRLNCFDFNILNSVNNTDSSVHWRTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKL 453
             ++  LNC D++ L+++ N D    ++T L++WLPHG+NTQDLEL+YMI+I+A+YTIYKL
Sbjct: 377  RSLVLLNCNDYDTLSTILN-DFPNDYKTALNKWLPHGINTQDLELIYMINIIAIYTIYKL 435

Query: 454  YEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRS 513
            Y  LPIQLNPFL +L+SLWK LS ++L+ LEIDRIEE N TY+TP++VRATIRGAAALR+
Sbjct: 436  YSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRA 495

Query: 514  VIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYADLRSHSASLLAFGTS-IEDV 572
            VIATILN  V T EHDFKHES NTFMSP+GRKL  GAL ADLRSH+A++LA G   + DV
Sbjct: 496  VIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDV 555

Query: 573  TDLFADLQSGDRFDEDIRYMFDYECADYXXXXXXXXXXXXXXGIVNAREKIKSSNDNNVF 632
            T+L ADLQ+GDRFDED++Y+F+YE  DY                 N  E+++  +     
Sbjct: 556  TELLADLQAGDRFDEDVKYIFEYEYQDYNELGEEDEQ-------TNELEELEKRS----V 604

Query: 633  CQRRCNCIFNDDKLVAEDGLNEVFESTCNRNGERRVRNNIDVVSNTAITTSNHVSTSINP 692
             +RRCNCIF DDK++ +    EV        G    R ++++ S+ + T         NP
Sbjct: 605  KKRRCNCIFEDDKMLEDYEYYEV--------GNESRREDMNLESDKSRT---------NP 647

Query: 693  FSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNREE 752
            +SVR  S FEFDYSG+DWRDVPR FN+YYSPSY FI +PKL  + + TL+  TEKL+ E+
Sbjct: 648  YSVRVNSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTEKLSDED 707

Query: 753  SILLVRSVASCVKNEQDQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRTTPDDIY 812
            S+LL++SVASCVK EQ++M+L              E  ++T    T+ +  R  TPDD+Y
Sbjct: 708  SLLLLQSVASCVKLEQEKMIL--------------ENYSNTKNCSTEEDLDREVTPDDVY 753

Query: 813  EIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMG 872
            EIW EESAFERM+ +N +VAWRLMDEMLMC GYRR+L+WF TH+E+ HSL++Y+FEL+MG
Sbjct: 754  EIWCEESAFERMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMG 813

Query: 873  LRGKAFSGKASDQDKKDDMIYEILKKKQKNDDASSLPFSRQGPIILSDIETKMLLQEFFM 932
            LRG+    +    D+   ++ + +   +K   +  +PFSRQG IILS+IETKMLLQEFF 
Sbjct: 814  LRGQRDDSRNPGDDRLKSLLLQDMMTDKKG--SEKVPFSRQGSIILSEIETKMLLQEFFT 871

Query: 933  NAAIFLXXX-XXXXXXXDGEKISLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTL 991
            NAAIF            D E +SLY++GLV+LIC+MV+TL+ NDKF F+KSECTFELQTL
Sbjct: 872  NAAIFFSTNDTANMSSNDSENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTL 931

Query: 992  LMTWIGILPEAKDLFFEIKTRL---AMEEDNDT-GTMQHEGRRSLDIEKKLNTKPASKLN 1047
            LM WIGI+PEA++LFF +K  +   +ME  +D+ GT  +EG  S               N
Sbjct: 932  LMNWIGIIPEAQELFFTLKANVGEPSMEGKSDSDGTDSNEGELSW-------------YN 978

Query: 1048 LKLLSLFPSNSADNGENSAINTLRNFITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPI 1107
             KLL+L PS +    EN AI TLR+F+  YSF  +V   GRKV++ D KILP+ K  +PI
Sbjct: 979  SKLLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPI 1038

Query: 1108 PLHEYI--TLAELDVGD 1122
             L E I     E D GD
Sbjct: 1039 LLRELIDENFEEDDDGD 1055

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1168 (40%), Positives = 666/1168 (57%), Gaps = 95/1168 (8%)

Query: 1    MTKKKTTVNHVQKPVLAGGDPSGGSVCCERFVPLQELLKDKNYVPSVENLEKVLCDETML 60
            MTKKK  V+      +   D +   +   R          K+Y P   NL       T+ 
Sbjct: 1    MTKKKKAVS------VDSHDETHKGMALSRLC--------KDYYPDQRNL-------TIP 39

Query: 61   NDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKK-----RKLWAQSFENNNSNYAS 115
            + ++   +++ E L ++LF T  G SIL+     +  +      K W  S   +   Y  
Sbjct: 40   HVEEFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGYKK 99

Query: 116  IVFSWKDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGY 175
            +V  W  + ++LL+F   LL NK +PL+  ++N  E+KL L FL+  +     ++L+  Y
Sbjct: 100  LVKRWSTSTLVLLRFTDLLLQNKNVPLEYTKHNTAEYKLSLIFLLDKQNEF--LILDPDY 157

Query: 176  NLLKDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAE---- 231
            NLL DYL      IE +L+     N P L+ K  +  Y+++ E   C+ WY F       
Sbjct: 158  NLLLDYLLHAKPMIESILLG----NIPGLL-KALVYQYNKLPEFNGCHTWYTFRTHYHGT 212

Query: 232  ----NSAHLKFDDNIACLMGSENNTENGLGDSRVNNNNYHKQP----------------K 271
                +   +   D            E    +  V+ ++   +P                +
Sbjct: 213  QEIFHKFFIALTDKFTASKEIMPELEGWFVEGPVSRDSGCIKPITGDDYTSSAAIDDFNE 272

Query: 272  DVVMSRTINDQEQIYSFELNHDGTLEIPNVMKHSLLRHELLFKILNLTPVSTPLLELQFS 331
            D    +  N QEQ+YSFELN DGTLEIPNV  H+  RH+ L+K+L L    TPLL+  F 
Sbjct: 273  DYWTQQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLNDDPTPLLKSCFL 332

Query: 332  TLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYD-WKFYTCFNMQK 390
            T C L DP+ QP PNDKHI+S+D L  +FLGLMYP I +      + D W  + CFN+QK
Sbjct: 333  TFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQK 392

Query: 391  IIDATMSRLNCFDFNILNSVNNTDSSVHWRTQLHRWLPHGLNTQDLELLYMIDILAVYTI 450
            II+AT+SRLNC DF  LN +NN+D SV WR  L++WLP GLNTQDLEL+YM+DILA YTI
Sbjct: 393  IINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYTI 452

Query: 451  YKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAA 510
            YKLY   PIQ+NPFL  +ISLWKNL+CV+LL LEIDR+EEE  T+ TP+MVRATIRGA+A
Sbjct: 453  YKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGASA 512

Query: 511  LRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYADLRSHSASLLAFGTSIE 570
            LRSV+ATI+NG  +   HDFKHE +N FMSP+GRKL +GALYADLRSH+A++LA G  +E
Sbjct: 513  LRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATMLALGIELE 572

Query: 571  DVTDLFADLQSGDRFDEDIRYMFDYECADYXXXXXXXXXXXXXXGIVNAREKIKSSNDNN 630
             +TDL +DLQ GDRFDED++YMFDYE  DY               I  +RE+IK      
Sbjct: 573  TLTDLLSDLQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDELEDI-ESRERIKEVRG-- 629

Query: 631  VFCQRRCNCIFNDDKLVAEDGLNEVFESTCNRNGERRVRNNIDVVSNTAITTSNHVSTSI 690
                +RC+C+F+DD LV E+      E       +    ++ D +          +ST+ 
Sbjct: 630  --YYKRCHCVFDDDSLVPENEDGGGEEGDQEDTKKHLQDSHEDQLPPQQNVV---MSTTS 684

Query: 691  NPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNR 750
             P +VR+R T EFD++G DWRD+PR  N YY+ +Y F+     DV+  L      +KL R
Sbjct: 685  KPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMKEATRKKLER 744

Query: 751  EESILLVRSVASCVKNEQDQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRTTPDD 810
              +  ++RS+A+CVK EQ++ ++     N  G     +  N+T+I KT+NE     T D 
Sbjct: 745  NHASFILRSIATCVKLEQEEAIVRRALGNQDG----DKSSNATTI-KTENE----LTSDF 795

Query: 811  IYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELI 870
            IYE W E+S FE+M+  N D+ WR+MDEMLMC+GYRR+LIWF THLE+ HS+I+Y+FEL+
Sbjct: 796  IYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYIFELV 855

Query: 871  MGLRGKAFSGKASDQDKKDDMIYEILKKKQKNDDASSLPFSRQGPIILSDIETKMLLQEF 930
            MGLRG        ++ K  D +  + +    ++   +LPFSRQGPIILS IE  MLLQEF
Sbjct: 856  MGLRGNITYEDDEEKSKNLDALDGLAQGSSTSE--LTLPFSRQGPIILSSIEVNMLLQEF 913

Query: 931  FMNAAIFLXXXXXXXXXXDGEK------------ISLYSLGLVRLICYMVQTLITNDKFF 978
            F NAAIF           + E+            +  + +GL++L+C+MV TL+   KF 
Sbjct: 914  FTNAAIFFSSKLRESFDSENEELDENFEDEDEFSVPPHVIGLMKLVCFMVDTLMQKKKFD 973

Query: 979  FTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLAM--EEDNDTGTMQHEGRR-SLDIE 1035
            FT SE  FELQTLLM WIGI+PEA+DLFF++K+++    ++  + GT   E  +  +D  
Sbjct: 974  FTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQGTPVKESEKDDIDAP 1033

Query: 1036 KKLNTKPA-SKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSFDTQVNPPGRKVVFYD 1094
              L      S+ N KL+ L P  + +  E +A+  LR FI  YS   +    GRK+++ D
Sbjct: 1034 DTLEMNDTMSEHNKKLMMLIPPGTTN--ERNALTALRGFIGKYSLTNKTAVFGRKIIYQD 1091

Query: 1095 GKILPLTKADKPIPLHEYITLAELDVGD 1122
             +I+ +   DK +   E++    +D  D
Sbjct: 1092 DEIMGMYMTDKEMMYREFLAEFGIDYND 1119

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/1273 (38%), Positives = 690/1273 (54%), Gaps = 223/1273 (17%)

Query: 42   NYVPSVENLEKVLCDETMLNDQKVRFSLLFEALAITLFTTNSGKSILQSIQT---FTSKK 98
            +Y P+++ LE ++  +    D +   SLLFE+L + LFTTN G S+L  I T   FT+ K
Sbjct: 17   DYKPNIQLLETLI--DYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDK 74

Query: 99   RK----------LWAQSFENNNSNYASIVF---------------------------SWK 121
            +K              S  N + N  + V                             W+
Sbjct: 75   QKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWR 134

Query: 122  DNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVS----------------KIN 165
            ++ I LLKF +F+L N   PL  + +  P  KLPL FL+++                 I 
Sbjct: 135  NDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIY 194

Query: 166  IPSILLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECEN---C 222
              ++L+++ YNLL DYL+  T  +  LL      N   L+    +  Y++  E  N   C
Sbjct: 195  NNTLLMDKNYNLLLDYLHVSTPLLISLLHT----NLDPLLFNNIISSYNKSFELTNDNKC 250

Query: 223  YCWYYFNAENSAHLK---------------FDDNIACLMGSE-NNTENGLGDSRVNNNNY 266
              + + +++++ +                 FD +    + +E +N+   +  S    +N 
Sbjct: 251  LWYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEISNSLFNISSSSTTKSNM 310

Query: 267  HKQPKDVVMSRTINDQ---EQIYSFEL-----NHDGTLEIPNVMKHSLLRHELLFKILNL 318
            H + +   ++  +++    E   SF L     NH G L  P++M H   RH++L KILN+
Sbjct: 311  HNENEGADLNLLMDENSMGEHTLSFNLFENNINH-GILH-PDLMAHISKRHDILAKILNV 368

Query: 319  TP----VSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGH 374
                   ++PLL LQF  LC LVDPL QPTPN K+IISID LF+LFLG + P +      
Sbjct: 369  GDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSA 428

Query: 375  NDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHWRTQLHRWLPHGLNTQ 434
             D  +WKF  CFNM+KII++ M +LNC DFN LNS+NN+D SVHWRTQLH+WLP G NTQ
Sbjct: 429  EDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQ 488

Query: 435  DLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGT 494
            DLELLYM++ILA YTIYKL E LPIQLNPFL S++S WKNLSC ILL LEIDR+EEEN T
Sbjct: 489  DLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENET 548

Query: 495  YETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYAD 554
            ++TPL+VRAT+R + ALRS+IATILN  V    HDFKHESLNTFMSPYGRKL +GALY D
Sbjct: 549  FDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTD 608

Query: 555  LRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYXXXXXXXXXXXXXX 614
             RSH++++LA    +E VT L +DLQ GDRFDED++YMF++E  +               
Sbjct: 609  FRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEFEDYNTLPNVLGGEDDETST 668

Query: 615  GIVNAREKIKSSNDNNVF-----------------------CQRRCNCIFNDDKL----- 646
              +  RE +K  ++ N                         C RRCNCIF+DD++     
Sbjct: 669  DTLKNREMLKEIHNGNFIPDNEENDEREIRNYLEQKLREMNCHRRCNCIFSDDEIKDTSI 728

Query: 647  --------VAEDGLNEVFESTCNRNGERR-------------VRNNIDVVSNTAITTSNH 685
                     + +G+        N N  R+             +R NI+ ++   ++++  
Sbjct: 729  SDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSSTEM 788

Query: 686  VSTSI----------------NPFSVRARST---FEFDYSGEDWRDVPRDFNMYYSPSYP 726
             S  +                NP SV  ++    F+FDY+G+DWRD PR  N+YY+ +Y 
Sbjct: 789  ESLRVTGFNKPHAVRTSNLNNNPSSVNNKNNQNIFDFDYNGKDWRDTPRGMNLYYNLNYE 848

Query: 727  FIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLAD----------L 776
            FI  P LD++F LTL+    KL++++S LL+R VAS VKNEQD+++ +D          +
Sbjct: 849  FIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVKEIM 908

Query: 777  KTNLTGISKHAEGENSTSISKTDNEE-LRRTTPDDIYEIWSEESAFERMLNVNHDVAWRL 835
            + N  G+       N   I   + +E +   TPDDIYEIW EESAFERM+ +N++V +RL
Sbjct: 909  EQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFRL 968

Query: 836  MDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEI 895
            MDEMLMC GYRR+LIWF THLEL HS+I+Y+FEL+MG RG +    A+ +DK  +    +
Sbjct: 969  MDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGAT-EDKHTNTKGNV 1027

Query: 896  LKKKQK----------NDDAS----SLPFSRQGPIILSDIETKMLLQEFFMNAAIFLXXX 941
             + + K          ND +      LPFSRQG I LS+IE KML+QEF  NAAI     
Sbjct: 1028 NELENKNENELVNMLLNDYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHFNER 1087

Query: 942  XXXX-----------------XXXDGEKISLYSLGLVRLICYMVQTLITNDKFFFTKSEC 984
                                    D ++ISLYS+GL+RLIC+M+Q  + N+K      + 
Sbjct: 1088 NNLKHNPNSNDNSNSNEDNINKDEDEDEISLYSIGLMRLICFMIQAFLDNNKLKIEVDDS 1147

Query: 985  TFELQTLLMTWIGILPEAKDLFFEIKTRLA----------------MEEDNDTGTMQHEG 1028
             FELQTLLM WI I+PEAK LFF+IK  ++                +++DN+T   Q   
Sbjct: 1148 IFELQTLLMNWITIIPEAKKLFFQIKDIISNNQIDNNNFNNNLILDLDQDNNTIENQTSK 1207

Query: 1029 RRSLDIEKKLNTKPASKLNLKLLSLFPSNSADNG-ENSAINTLRNFITDYSFDTQVNPPG 1087
              +  +++       S  N KL+ LFP  S  N  EN+AI+TL+N++  + F  +V   G
Sbjct: 1208 DNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVPIIG 1267

Query: 1088 RKVVFYDGKILPL 1100
            RKV++ DGKIL +
Sbjct: 1268 RKVIYEDGKILKI 1280

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/1129 (40%), Positives = 662/1129 (58%), Gaps = 96/1129 (8%)

Query: 42   NYVPSVENLEKVLCDET----MLNDQKVRFSLLFEALAITLFTTNSGKSILQSI-QTFTS 96
            NY PS+  LE++L DE     +L D +V+ S + E   I LFTT  G S+L  +   F  
Sbjct: 20   NYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGISLLNCLTDNFGI 79

Query: 97   KKRKLWAQSFENNN--SNYASIVFSWKDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKL 154
             +     + F  N+       +   W  ++++L+KF+RF++ N+ M +     N    KL
Sbjct: 80   DEDN---KDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKL 136

Query: 155  PLSFLIVSKIN--IPSILLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVK----- 207
             L FLI ++ +  I   LL    +++++YL +I  +++ ++  S       +  +     
Sbjct: 137  QLDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDCEDSFFV 196

Query: 208  RTLKDYDRMIECENCYCWYYFNA--ENSAHLKFDDNIACLMGSENNT-----ENGLGDSR 260
            RT+  Y R+ E    + +Y +++   N + +     +  L G  N +      +G   + 
Sbjct: 197  RTILSYKRLYETLLHFEFYDYSSMKTNGSDIYVKALMKHLTGLSNFSFQLFKLSGYFYNT 256

Query: 261  VNNNNYHKQPKDVV-MSRTINDQEQIYSFELN---HDGTLEIPNVMKHSLLRHELLFKI- 315
            ++N +Y+      + +S   +D E   + E +       L+ P++M  +  RH  L K+ 
Sbjct: 257  IDNQSYNPSKFGFIPLSVDPDDGEVEENQETDNILQPSLLDFPDLMNETAKRHLALSKLI 316

Query: 316  ----LNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSS 371
                L     ++PLL++Q+ TL  L+DPL QP PND H+ISID L  +FLGLM P I + 
Sbjct: 317  IDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQ 376

Query: 372  QGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHWRTQLHRWLPHGL 431
              ++D  DW+F+ CFNMQ+II A++  LNC DF  L +V   D S  WR+QLH WLP GL
Sbjct: 377  LNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTV---DESKDWRSQLHLWLPRGL 433

Query: 432  NTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEE 491
            NTQ+LEL+YM  ILAVYTIYKLY   P+  NPFL SLISLWK+L+CV+L  L+IDR+EE 
Sbjct: 434  NTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEES 493

Query: 492  NGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGAL 551
            N +++TP++VRATIRGAAALRS++AT+LN  ++   HDF HESLNTFMSP+GRKL  GAL
Sbjct: 494  NQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGAL 553

Query: 552  YADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYXXXXXXXXXXX 611
            YADL++++AS+LA G   ++VTDL + LQ+GD+FDED++YMF+YE  DY           
Sbjct: 554  YADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMFEYEYEDYNEIYEDSSNEN 613

Query: 612  XXXGIVNAREKIKSSNDNNVFCQRRCNCIFN---DDKLVAEDGLNEVFESTCNRNGE--R 666
                 ++             F +RRCNCIF+     +   +D      E T + +GE   
Sbjct: 614  EENEEIDY-----------AFNKRRCNCIFSDDNLIEEEEDDEEESDVEKTSDIDGEIAT 662

Query: 667  RVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSYP 726
            + + + +    +    SN +S    P +VR++S FEFDYSG+DWRD+PR++N+YYSP Y 
Sbjct: 663  KSKEHTEKTIESDSGLSNQLS---KPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYN 719

Query: 727  FIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNLTGISKH 786
            FI  P L+ +F LTL+  +EKL +EE+ LL+ SVAS VKNEQD+M+  +L          
Sbjct: 720  FIDRPDLNTVFVLTLKATSEKLTKEEAALLLCSVASTVKNEQDRMIFGNLL--------- 770

Query: 787  AEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYR 846
             + ++ST+    D +  +  TPDDIYEIW EESAFER+L+ N D+AW+LMDEMLMC+GYR
Sbjct: 771  EQDKSSTADEHEDTK--KEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYR 828

Query: 847  RILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQKNDDAS 906
            R+LIWF TH+EL HSLI Y+F+L+MG RG   +   + ++ K   I E +     N    
Sbjct: 829  RVLIWFITHMELSHSLIIYIFDLMMGSRG--INKTDTSKNVKSTFITENISDSNSN---- 882

Query: 907  SLPFSRQGPIILSDIETKMLLQEFFMNAAIFLXXXXXXXXXX----------------DG 950
            SL FSR G + LS++ET+M+LQE F NAAI+                           + 
Sbjct: 883  SLKFSRMGHLKLSELETRMILQELFTNAAIYFSDKARKSNQSILTPDYSTEEEEFDEENE 942

Query: 951  EKISLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIK 1010
               S+YS+GL++LIC MV  LI N KF   +S+C FELQTLLM WI ILPEAK+L F+I 
Sbjct: 943  GGYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKIN 1002

Query: 1011 TRL---AMEEDNDTGTMQHEGRRSLDIEKKLNTKPAS--KLNLKLLSLFPSNSADNGENS 1065
            + L   +  E+++  +++    +S    K+L  K +   K N  LL L P       EN 
Sbjct: 1003 SSLSEFSHVENSELASIEGASTKS---HKQLVDKNSESYKYNEILLKLIPPTFGGKEENI 1059

Query: 1066 AINTLRNFITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYIT 1114
              NT R++I DYSFD++V+   RK++    +ILPL  ++KP   H+Y+T
Sbjct: 1060 IFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILPLQDSEKPFSFHDYLT 1108

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/1119 (39%), Positives = 624/1119 (55%), Gaps = 137/1119 (12%)

Query: 72   EALAITLFTTNSGKSILQ-----SIQTFTSKKRKLWAQSFEN--NNSNYASIVFSWKDND 124
            E L + LFTT  G S L+     S       + K W QS     +++ Y  +V  W  + 
Sbjct: 51   EKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQRVSDAAYKRMVKRWTSST 110

Query: 125  ILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKDYLYS 184
              +   +   L N    L    +  P HKL ++FL+  +  +  +++++ YNLL D+   
Sbjct: 111  EHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLLDPETEV--LVIDDEYNLLLDFALQ 168

Query: 185  ITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAEN------------ 232
                +E+LL    + + P+L+ K     + R+ +    Y WY F+AE             
Sbjct: 169  CRALVEQLLN---QIDLPSLLAK-CAYGHGRLFQLCGRYVWYTFSAEQFDEAQDICYKYL 224

Query: 233  -------SAHLKFDDNIACLM-------------GSENNTENGLGDSRVNNNNYHKQPKD 272
                   +A       I  L              G    TEN   DS  +++++ +    
Sbjct: 225  SVLTDKLTAQQDLIPQIQPLFEIISSSKASHWVYGDGLFTENPESDSNSDSDHWPQ---- 280

Query: 273  VVMSRTINDQEQIYSFELNHDGTLEIPNVMKHSLLRHELLFKILNLTPVST-PLLELQFS 331
                + ++ QE++YSF+L  DGTLE  NV   +  RH+ L+++LNL   +T PLL  QF 
Sbjct: 281  ----KRLSAQERVYSFDLKDDGTLEASNVFNRTRRRHQALYQVLNLQKQNTAPLLSSQFF 336

Query: 332  TLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKI 391
            TLC LVDP+ QPTPND HI+SID L  +FLGL+Y  I        H DW+F+ CFN+QKI
Sbjct: 337  TLCALVDPVTQPTPNDSHIVSIDLLSDMFLGLLYSEINEL-----HIDWRFHVCFNLQKI 391

Query: 392  IDATMSRLNCFDFNILNSVNNTDSSVHWRTQLHRWLPHGLNTQDLELLYMIDILAVYTIY 451
            + AT+ RLNC DF  LNSVNN+D S+ WR  LH+WLP GLNTQDLEL+YMIDILA+Y I+
Sbjct: 392  VQATLPRLNCHDFQRLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELIYMIDILAIYIIH 451

Query: 452  KLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAAL 511
            KLY  LP Q+NPFL S+ISLWKNL+ V+LL LEIDR EEE  T+ TP++VRA IRG++AL
Sbjct: 452  KLYRDLPAQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSAL 511

Query: 512  RSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYADLRSHSASLLAFGTSIED 571
            RSV+ATILNG V+   HDF+HE +N FMSP+GRKL HGALY D+RSH+A++LA G  +ED
Sbjct: 512  RSVVATILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELED 571

Query: 572  VTDLFADLQSGDRFDEDIRYMFDYECADYXXXXXXXXXXXXXXGIVNAREKIKSSNDNNV 631
            VT+L +DLQ GDRFDED++YMFDYE  +Y                V +RE+IK       
Sbjct: 572  VTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDELE-DVESRERIKEMRA--- 627

Query: 632  FCQRRCNCIFNDDKLVAEDGLNEVFESTCNRNGERRVRNNIDVVSNTAITTSNHVSTSIN 691
               +RC+C F+DD+L+ ED  +   +++  R       +N   +SNT+            
Sbjct: 628  -YYKRCHCQFDDDELLPEDEEDGRPDASPYRVTRDAPPDNNVKLSNTS-----------K 675

Query: 692  PFSVRA-RSTFEFDYSGEDWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNR 750
            P ++R+ + + EFD++G DWR +PR  N Y++ +Y F          +L    A +KL  
Sbjct: 676  PMALRSQKDSVEFDFNGRDWRGIPRGLNFYFNENYEFEKHLSSGQAHSLMCNAAEKKLPL 735

Query: 751  EESILLVRSVASCVKNEQDQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRTTPDD 810
            EE   L+R +A+CV  EQ+  VL      L G +  +E  +ST ++  D       T D 
Sbjct: 736  EEGTQLLRVIATCVAKEQELTVLR--SALLLGETPESEN-HSTLVADGD------LTTDF 786

Query: 811  IYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELI 870
            +YE W E S FE++L  N  + WR+MDEMLMC+GYRR+LIWF THLE+ +S+I Y++ L+
Sbjct: 787  VYEKWCENSMFEKILFHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSNSMIEYIYTLV 846

Query: 871  MGLRGKAFSGKASDQDKKDDMIYEILKKKQKNDDASSLPFSRQGPIILSDIETKMLLQEF 930
            +G RG                     +K   + D + +PFSRQG I+LSDIE KMLLQEF
Sbjct: 847  LGNRG---------------------EKAASDGDYAKVPFSRQGAIVLSDIEIKMLLQEF 885

Query: 931  FMNAAIFLXXXXXXX-----------XXXDGEKISLYSLGLVRLICYMVQTLITNDKFFF 979
            F NAAIF                       G  IS + +GL++L+CYMV++L+  + F F
Sbjct: 886  FTNAAIFFSKQLRESLGDGEDDEDQGDDEKGSGISPHVVGLMKLVCYMVKSLMQKEMFDF 945

Query: 980  TKSECTFELQTLLMTWIGILPEAKDLFFEIKTRL----------------AMEEDNDTGT 1023
               +  FELQTLLM+WI ILPEA+DLFF +++ +                A E D+ +  
Sbjct: 946  KDPDYIFELQTLLMSWICILPEARDLFFALRSLVDEQSQNIKLESESIASACEPDSQSEP 1005

Query: 1024 MQHEGRRSLDIEKKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSFDTQV 1083
               +G  + ++E +  T   S  N KL+SL P   A   ENSAI  LR+FI+ +S  T+ 
Sbjct: 1006 QLPQGTHA-ELEPE-ATHAVSIYNKKLMSLLP--PAAGTENSAITALRSFISKHSLTTKT 1061

Query: 1084 NPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDVGD 1122
               GR+V+  D  I+P+  +D+ +   +++    +D  D
Sbjct: 1062 ALFGRRVISQDDTIMPMYMSDREMDNRQFLAEFGIDYND 1100

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/1199 (37%), Positives = 650/1199 (54%), Gaps = 169/1199 (14%)

Query: 43   YVPSVENLEKVLCDETMLNDQKVRFSLLF-EALAITLFTTNSGKSILQSIQTFTSKKRKL 101
            Y PS+++L      E  + +    F L+  E + +TLF T  G SIL  +   +  + KL
Sbjct: 25   YKPSIQSLL-----ELNVQEGDPHFELMIVEKVVVTLFMTRGGNSILHLLYDLSCGRIKL 79

Query: 102  --WAQSFE--NNNSNYASIVFSWKDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLS 157
              + QS +  +N   + +    W      L +F+ F L N+   L    Y     KLPL 
Sbjct: 80   SEYRQSLKVRSNVHQWKTCYKEWGSRRDTLSRFLDFCLRNEDCALDYTEYGRVMRKLPLQ 139

Query: 158  FLIVSKINIPSILLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMI 217
            FL+ + ++  + +L+EGYNLL DY+ +     EELL+       P L+     +DY+R+ 
Sbjct: 140  FLLPAGLH--AYVLDEGYNLLLDYIINSRLMWEELLIQGIPRLLPELI-----EDYNRVF 192

Query: 218  ECENCYCWYYF--------NAENSAHLK-----FDDNIAC--LMGSENNT---------- 252
            E    Y WY          N+    H K     FD       L+   N T          
Sbjct: 193  EFNGYYTWYGGAPSGAGAANSTRELHTKVLYALFDKLTVAKELLPRLNATVWSHSWPPMY 252

Query: 253  -ENGLG------------DSRVNNNNYHKQPKDVVMSRTINDQEQIYSFELNHDGTLEIP 299
             ++G+             DS +  +++ +             +EQ+Y+FELN DG+LE P
Sbjct: 253  HKHGINEFSNEEEDLYDFDSELEGDSWPQHKSSA--------KEQVYTFELNRDGSLEFP 304

Query: 300  NVMKHSLLRHELLFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKL 359
            NV  H+  RHE L++IL L     PLL  QF TLC LVDP+ QP P +KHIISID ++++
Sbjct: 305  NVFLHTRRRHETLYRILGLPNRECPLLRAQFMTLCALVDPITQPPPTEKHIISIDLIYQM 364

Query: 360  FLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHW 419
            FLG +   ++SS    D   W+F+ C N+QKII ATM RLNC D  +LNS+NN+D +VHW
Sbjct: 365  FLGSISSLLESSLRGQD---WRFHVCHNLQKIILATMKRLNCHDSEVLNSINNSDETVHW 421

Query: 420  RTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVI 479
               + +W P GLNTQDLELLYM+D+L +YTIY+LY  LP+Q+NPFL     LWKNL+ V+
Sbjct: 422  NVNIGKWTPRGLNTQDLELLYMVDMLGIYTIYQLYSDLPVQMNPFLPLSFHLWKNLTNVL 481

Query: 480  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFM 539
            LL LEIDR EE+  T+ TP++VRATIRG+AALRSV+AT++N      EHDFKHE +N FM
Sbjct: 482  LLGLEIDRFEEDRETFSTPIIVRATIRGSAALRSVVATMINSHFSIKEHDFKHEPINLFM 541

Query: 540  SPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECAD 599
            SP+GRKL  GALYAD+RSH+A++LA G  + DVTDL +DLQ GDRFD+D++YMFDYE  D
Sbjct: 542  SPHGRKLCQGALYADVRSHAAAMLALGIELNDVTDLLSDLQPGDRFDDDVKYMFDYEYDD 601

Query: 600  YXXXXXXXXXXXXXXGI-----VNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNE 654
            Y               +     +  RE+IK          +RC+C+F+DD+L++++   +
Sbjct: 602  YNAIDPEQLYDENEEDLERLEEIQQRERIKDMRG----YYKRCHCVFDDDELLSDEEGTD 657

Query: 655  VFESTCNRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVP 714
              E T N   E      +++V+  + +    V       +VR+R   EFD++G+DWRD+P
Sbjct: 658  TGEHTDNHITETVQSAPLNLVTGVSTSGPQKV-------AVRSRDYVEFDFNGKDWRDIP 710

Query: 715  RDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLA 774
            R  N YY   Y F++    DV+  L     ++KL   +S  ++RSVA+C+K EQ++ ++ 
Sbjct: 711  RGMNFYYVEDYVFVNKLHADVLHYLMKEATSKKLESNQSSFILRSVATCIKLEQEKTMVH 770

Query: 775  DLKTNLTGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWR 834
            D       I K    ++ + +S + +E     T D IYE W E++ FE+M+  N+D+ WR
Sbjct: 771  D------AIFK---SKDKSPLSASGSEGSNGLTSDFIYEKWCEDALFEKMMYYNNDLVWR 821

Query: 835  LMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYE 894
            +MDEMLMC+GYRR+LIWF THLEL HS+I+Y+FEL+MG+RG   + K  +++   +   +
Sbjct: 822  MMDEMLMCSGYRRVLIWFITHLELSHSVIHYIFELVMGMRGNV-AYKDLEEEYIINRNLD 880

Query: 895  ILKKKQKNDDA--SSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLXXXXXXXXXXDGEK 952
            +L           +S+PFSRQGPI+LS IE  MLLQEFF+NAAI+           +   
Sbjct: 881  LLDSFSLGSSCIPASIPFSRQGPIVLSTIEVNMLLQEFFINAAIYFSNYLRDTASYEHLD 940

Query: 953  I-------------------------SLYSLGLVRLICYMVQTLITNDKFFFTKSECTFE 987
            +                         S + LGL++L+C+MV  LI   K  FT SE  FE
Sbjct: 941  VEQPEEQTEIEEGEAEDEIADERLTASSHVLGLMKLLCFMVDMLIEKKKLDFTDSEYLFE 1000

Query: 988  LQTLLMTWIGILPEAKDLFFEIKTRL---------------------------AMEEDND 1020
            LQTLLM WIG++PEA+ LFF++K+ L                            ++   D
Sbjct: 1001 LQTLLMNWIGLVPEARTLFFKLKSTLLNSSALNGSALSHLEGELASNDNDDSEPVDTAED 1060

Query: 1021 TGTMQH----EGRRSLDIEKKLNTKPASKLNLK---------------LLSLFPSNSADN 1061
             G M      +G    DI    N +P S  N                 L+ L P +SAD 
Sbjct: 1061 AGPMDKSNGLDGLPLCDIGALTNGQPTSAANSAPNGMSESNISYCNQMLIKLLPPHSAD- 1119

Query: 1062 GENSAINTLRNFITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDV 1120
             EN+A+  LR+FI  +   T+    GR+V++ D  I+ L  ADK +   E+  LAE  +
Sbjct: 1120 -ENAAVTALRSFIAKHPLTTKTAIFGRRVIYQDNAIMGLYMADKELQQREF--LAEFGI 1175

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/1111 (39%), Positives = 626/1111 (56%), Gaps = 150/1111 (13%)

Query: 66   RFSLLFEALAITLFTTNSGKSILQSIQTF--------------TSKKRKLWAQSFENNNS 111
            +F  L E   +TLFTT  G+ + Q ++                  + R  W    E   S
Sbjct: 7    QFDSLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAWT---EEALS 63

Query: 112  NYASIVFS--WKDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSI 169
             Y  + F   W+D         RF          I +YN P  KL +S L  S+ +   +
Sbjct: 64   KYIHLFFQHVWRDAGD------RF---------AIMQYNEPAFKLQVSDLFPSEFSKARL 108

Query: 170  LLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFN 229
            +LN  Y++L D++ ++  +++ L+  + +      +V   ++ Y R+ E  + + W+   
Sbjct: 109  VLNTDYDVLLDFVNTVRPQLKGLIRQAVQ----GSLVDPIVRKYGRVYEFHDYFHWF--- 161

Query: 230  AENSAHLKFDDNIACLMGSENNTENGLGDSRVNNNNYHKQPKDV---------------- 273
              N +  KF +    ++   N     L    +N+    K P DV                
Sbjct: 162  --NLSKKKFANRDVLIL---NKGTPDLFHYYINSF-CSKAPYDVHPLHPFLGELFEGNNN 215

Query: 274  VMSRTINDQEQIYSFELN---HDG----TLEIPNVMKHSLLRHELLFKILNLTPVSTPLL 326
            V  + +   E +Y F+L+   H+G    T+ + ++M+ S  RHE+L ++LNL  + +P L
Sbjct: 216  VKYQQLGTNEHVYEFDLDEETHNGSGNRTVAV-DLMQQSNQRHEILTRMLNLKEIDSPHL 274

Query: 327  ELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCF 386
              QF  +  LVDPL QP P+D +++S+D L+KLFL  + P  + ++  ND     F  CF
Sbjct: 275  YEQFKCMISLVDPLTQPPPSDTYVVSLDLLYKLFLAFL-PKNQDTE-QND----TFLLCF 328

Query: 387  NMQKIIDATMSRLNCFDFNILNSVNNT-----DSSVHWRTQLHRWLPHGLNTQDLELLYM 441
            NMQKII  T+ RL C+D+  L S++       +S  ++R  L  W+P+GLNTQDLELLYM
Sbjct: 329  NMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYM 388

Query: 442  IDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMV 501
            +DI+AVYTIY  Y  LPIQLNPFL  LISLWKNLS V+LL+LE+DR EE N T++TPL+V
Sbjct: 389  VDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLV 448

Query: 502  RATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYADLRSHSAS 561
            RATIRGA+ALR+V+A +LNG V+ NEHDFKHE LNTFMSP+GRKL  G+LYADLRSH+A+
Sbjct: 449  RATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAA 508

Query: 562  LLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYXXXXXXXXXXXXXXGIVNARE 621
            +L+ G  +EDVT+L +DLQ GDRFDEDIRYMF+YE  DY                  A  
Sbjct: 509  MLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDAAAAATTATA 568

Query: 622  KIKSSNDNN----VFCQRRCNCIFNDDKLVAEDGLNEVFESTCNRNGERRVRNNIDVVSN 677
               +    N       +RRCNCIF DDK++  D      ES  +  G +           
Sbjct: 569  SAAAITAANEGTGASQKRRCNCIFTDDKIIQSD------ESKVSLGGGKN---------- 612

Query: 678  TAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSYPFIHDPKLDVIF 737
                          P+SVR +S+FEFDYSG DWRDVPR  N+Y+ PSY F+  P L    
Sbjct: 613  -------------RPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFR 659

Query: 738  NLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNLTGISKHAEGENSTSISK 797
            N++ + A  KLN  ES  L++ VAS +K EQ+ +++  +     GI+   +G        
Sbjct: 660  NVSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVGDDG-------- 711

Query: 798  TDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFFTHLE 857
                     TPD+IY+ W ++  F+R+L +N ++AW+LMDE+LMC GYRR+L+WF TH+E
Sbjct: 712  -------LLTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHME 764

Query: 858  LKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQKNDDASSLPFSRQGPII 917
            L HS+I+Y+FEL+MGLRG+  S   + ++++   ++ +++    N    +L FSRQG + 
Sbjct: 765  LNHSVIHYIFELVMGLRGQELSADVTLEEQRKQALHNLMEIDTPN--GGTLMFSRQGNLA 822

Query: 918  LSDIETKMLLQEFFMNAAIFLXXXXXXXXXXDGEKISLYSLGLVRLICYMVQTLITNDKF 977
            LS+IE KMLLQEFF NAAIFL          +   +SLYS+GLV+LIC+MV+TLI N KF
Sbjct: 823  LSEIEVKMLLQEFFTNAAIFLSASESEEPESETSDVSLYSIGLVKLICFMVKTLIVNHKF 882

Query: 978  FFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLAMEEDNDTGTMQHEGRRSL----- 1032
             F+KSECTFELQTLLM W+GI+P+A++LFF +K  ++   D  T T       +L     
Sbjct: 883  EFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNIS---DTKTATTTTTTTSALGAPGD 939

Query: 1033 --------DIEKKLNTKPASKLNLKLLSLFP--SNSADNGENSAINTLRNFITDYSFDTQ 1082
                    D +     +  S+ N KL+ L P  + S   G + AI+ LRNF+  +S  ++
Sbjct: 940  IFPTLTDADDDNNAVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSE 999

Query: 1083 VNPPGRKVVFYDGKILPLTKADKPIPLHEYI 1113
            +   GR++V    +ILP    ++ + L EY+
Sbjct: 1000 IPVLGRRIVRRGSQILPQATPERTVTLREYL 1030

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1108 (39%), Positives = 621/1108 (56%), Gaps = 118/1108 (10%)

Query: 72   EALAITLFTTNSGKSILQ-----SIQTFTSKKRKLWAQS-FEN-NNSNYASIVFSWKDND 124
            E L I LFTT  G SIL+     S       + K W QS F++  ++ Y  +V  W  + 
Sbjct: 48   EKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSS 107

Query: 125  ILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKDYLYS 184
              +   + +LL N +  L    +   E+KL ++FL+     +  +++++ YNLL D+L  
Sbjct: 108  DYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTEL--LIIDDEYNLLLDFLLQ 165

Query: 185  ITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAEN------------ 232
                +EELL    + + P+L+ K  L  + R+ +    Y WY F+ E             
Sbjct: 166  TRASVEELL---SQADLPSLIAKSALSHH-RLFQLSGRYVWYTFSDERFAEAQDICYKYL 221

Query: 233  -------SAHLKFDDNIACLMGSENNTENG---LGDSRVNNN--NYHKQPKDVVMSRTIN 280
                   +A       I  L  S N++       GDS  +    +      D    + ++
Sbjct: 222  SVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQKKLS 281

Query: 281  DQEQIYSFELNHDGTLEIPNVMKHSLLRHELLFKILNLTPV-STPLLELQFSTLCGLVDP 339
              E+IYSF+L  DGTLE PNV   +  RH+ L+++L L    S+P L+ QF TLC LVDP
Sbjct: 282  AHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVDP 341

Query: 340  LMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRL 399
            + QPTPND HIISID L  +F+GL++  IK        ++W+F+ CFN+QKI+ +T+ RL
Sbjct: 342  VTQPTPNDSHIISIDLLSDMFIGLLHSEIKQLP-----FNWRFHICFNLQKILQSTLPRL 396

Query: 400  NCFDFNILNSVNNTDSSVHWRTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPI 459
            NC DF  LNSVNN+D S+ WR  LH+WLP GLNTQDLEL+YMIDILA+Y I+KLY   P+
Sbjct: 397  NCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPV 456

Query: 460  QLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATIL 519
            Q+NPFL S+ISLWKNL+ V+LL LEIDR EEE  T+ TP++VRA IRG++ALRSV+AT+L
Sbjct: 457  QMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVL 516

Query: 520  NGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADL 579
            NG V+   HDF+HE +N FMSP+GRKL HGALY D+RSH+A++LA G  +EDVT+L +DL
Sbjct: 517  NGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDL 576

Query: 580  QSGDRFDEDIRYMFDYECADYXXXXXXXXXXXXXXGIVNAREKIKSSNDNNVFCQRRCNC 639
            Q GDRFDED++YMFDYE  +Y                V +RE+IK          +RC+C
Sbjct: 577  QPGDRFDEDVKYMFDYEYDNYNEVGTEDMDEEELE-DVESRERIKEMRA----YYKRCHC 631

Query: 640  IFNDDKLVAEDGLNEVFESTCNRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVR-AR 698
             F+DD+L+ E+        +  R  +    +    +SNTA            P ++R  +
Sbjct: 632  QFDDDELLPEEEEESGIPISHTRISKELPPDTNVKLSNTA-----------KPVALRNKK 680

Query: 699  STFEFDYSGEDWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVR 758
             T EFD++G DWRD+PR  N Y++ +Y F    K      L    A  +L++EE++ L+R
Sbjct: 681  DTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLR 740

Query: 759  SVASCVKNEQDQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEE 818
             V++CV  EQ+  V   L++        A    ST ++  D       T D IYE W ++
Sbjct: 741  LVSTCVAKEQEHTV---LRSAFAADDSQALSCQSTLVADGD------LTTDYIYENWCQD 791

Query: 819  SAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAF 878
            S F++ML  N  + WR+MDEMLMC+GYRR+LIWF THLE+  S+I Y++ L+MG RG+  
Sbjct: 792  SLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGEKL 851

Query: 879  SGKASDQDKKDDMIYEILKKKQKNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFL 938
            + + +   K                    LPFSRQG I+LS+IE KMLLQEFF NAAIF 
Sbjct: 852  ANEETPFGK--------------------LPFSRQGDIVLSEIEIKMLLQEFFTNAAIFF 891

Query: 939  XXXXXXXXXXDGEK------ISLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLL 992
                      + E+      IS Y +GL+RL+C+MV++LI  + F F   +  FEL+TLL
Sbjct: 892  SKQLRESLGDEEEEETENLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLL 951

Query: 993  MTWIGILPEAKDLFFEIKTRLAMEE----DNDTGTMQ--------------HEGRRSLDI 1034
            M+WI ILPEA+DLFF +++R+  +       D   M                E   S D 
Sbjct: 952  MSWICILPEARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDS 1011

Query: 1035 EKKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSFDTQVNPPGRKVVFYD 1094
            E+   T   S  N KL+SL P       EN+A+  LR+FI+ +S        GR+V+ +D
Sbjct: 1012 EE---TNSVSIYNKKLISLLP--PVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHD 1066

Query: 1095 GKILPLTKADKPIPLHEYITLAELDVGD 1122
             +I+ +  +DK I    ++    +D  D
Sbjct: 1067 DRIMSMYMSDKDIDNRNFLAEFGIDYND 1094

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/932 (41%), Positives = 552/932 (59%), Gaps = 113/932 (12%)

Query: 277  RTINDQEQIYSFELNHDGTLEIPNVMKHSLLRHELLFKILNLTPVSTPLLELQFSTLCGL 336
            + ++ +EQ+++F+LN DGTLE PNV  H+  RHE+L+++L L     PLL+ QF TL  L
Sbjct: 283  QKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAEGPLLKAQFMTLAAL 342

Query: 337  VDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKS---SQGHNDHYDWKFYTCFNMQKIID 393
            VDP+ QP P + HIISID +F++FLG     I++   S+G     DW+F+ C+NMQKI+ 
Sbjct: 343  VDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGR----DWRFHVCYNMQKIVL 398

Query: 394  ATMSRLNCFDFNILNSVNNTDSSVHWRTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKL 453
            ATM RLNC D ++LN+VNN+D SVHW   L +W P GLNTQDLELLYM+D+L++Y +Y+L
Sbjct: 399  ATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAMYRL 458

Query: 454  YEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRS 513
            Y  LP+Q+NPFL   + LWKNL+ V+L  LEIDR EE+  T+ TP++VRA IRG AALRS
Sbjct: 459  YSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAALRS 518

Query: 514  VIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYADLRSHSASLLAFGTSIEDVT 573
            V+AT++N    + EHDFKHE +N FMSP+GRKL HGALYAD+RSH+A++L+ G  + DVT
Sbjct: 519  VVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAMLSLGIDLNDVT 578

Query: 574  DLFADLQSGDRFDEDIRYMFDYECADYXXXXXXXXXXXXXXGI-----VNAREKIKSSND 628
            DL +DLQ GDRFD+D++YMFDYE  DY               +     +  RE+IK    
Sbjct: 579  DLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEEDLERLEEIQQRERIKDMRG 638

Query: 629  NNVFCQRRCNCIFNDDKLVAEDGLNEVFESTCNRNGERRVRNNIDVVSNTAITTSNHVST 688
                  +RC+C+F+DD+L++++   E   S  +R   +   N++++ S+   TT N  ++
Sbjct: 639  ----YYKRCHCVFDDDELLSDEEEGETASSNIDR--PKYSHNSLNLPSSMLSTTFNGPNS 692

Query: 689  SINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKL 748
                F++R+R   +FD++G+DWRD+PR  N YY+  Y F++    DV++ L     T+K+
Sbjct: 693  Q--KFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYLMKEATTKKM 750

Query: 749  NREESILLVRSVASCVKNEQDQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRTTP 808
                +  ++RS+A+C+K EQ++ ++ D+    T      +G +S S S   NE     T 
Sbjct: 751  EPNHASFILRSIATCIKLEQEKSMVYDVMNGRTD-----KGSSSNSNSDRVNE----LTS 801

Query: 809  DDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFE 868
            D IYE W EES F +M+  N+D+ WR+MDEMLMC+GYRR+LIWF THLE+ HSLI+Y+FE
Sbjct: 802  DFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYIFE 861

Query: 869  LIMGLRGKA-FSGKASDQDKKDDMIYEILKKKQKNDDASSLPFSRQGPIILSDIETKMLL 927
            L+MG+RG   +  +A D  K  ++          +     +PFSRQGPIILS IE  MLL
Sbjct: 862  LVMGMRGNVDYDEEAEDDIKNRNLDILDSLSLGSSSVTIKIPFSRQGPIILSIIEINMLL 921

Query: 928  QEFFMNAAIFLXXXXXXXXX----------------------XDGEK----ISLYSLGLV 961
             EFF+NA I+                                 DG+K    +S + +GL+
Sbjct: 922  LEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIGLM 981

Query: 962  RLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTR-LAMEEDND 1020
            +L+C+MV  L+   KF FT SE  FELQTLLM WIGI+PEA++LFF++K+  L     ND
Sbjct: 982  KLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSILEASSQND 1041

Query: 1021 TGTMQHEGRRSL-------------DIEKKL----------------------------- 1038
            +     +G  ++              IE+K+                             
Sbjct: 1042 SSKSDKQGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCLSDADFPPTPIDINNLK 1101

Query: 1039 ----------NTKPASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSFDTQVNPPGR 1088
                      N    SK N  L+ L P +  DN EN+A+  LR+FIT +S   +    GR
Sbjct: 1102 LENVGSPEIDNNNNLSKYNKMLIELLPLH-VDN-ENTAVTALRSFITKHSLTNKTAVFGR 1159

Query: 1089 KVVFYDGKILPLTKADKPIPLHEYITLAELDV 1120
            +V++ D  I+ L  ADK +   E+  LAE  +
Sbjct: 1160 RVIYQDHAIMGLYMADKEMRQREF--LAEFGI 1189

 Score = 62.0 bits (149), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 77/164 (46%), Gaps = 13/164 (7%)

Query: 68  SLLFEALAITLFTTNSGKSILQSIQTFTSKKRKL--WAQSFE--NNNSNYASIVFSWKDN 123
           +L+ E + +TLF T SG S+L  +      + KL  + QS +  +N+S + S    W   
Sbjct: 46  ALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSR 105

Query: 124 DILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKDYLY 183
             +L +F+ F L N+   L    Y     KLPL FL+   +     L+++ YNLL DY+ 
Sbjct: 106 RDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLR--PYLIDDEYNLLLDYMI 163

Query: 184 SITGRIEELLMCS-PKFNQPALVVKRTLKDYDRMIECENCYCWY 226
                 E LL    PKF  P LV      +Y+R  E    Y WY
Sbjct: 164 QSRPMWEMLLTQGIPKF-LPELV-----DEYNRSYEFNGYYVWY 201

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/896 (44%), Positives = 558/896 (62%), Gaps = 100/896 (11%)

Query: 282  QEQIYSFELNHDGTLEIP-NVMKHSLLRHELLFKILNLTPV-STPLLELQFSTLCGLVDP 339
            +E++YSF+LN+DG++ +P N+M ++  RH++L K+LN     S+PLLELQF  + GLVDP
Sbjct: 394  EEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVDP 453

Query: 340  LMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRL 399
            L QP PNDKHIIS+D L++LF+ ++YP  +  Q +N  ++WK + CF M KII+  M +L
Sbjct: 454  LSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQ-NNLGFNWKTHVCFQMVKIINNCMEKL 512

Query: 400  NC------FDFNILNSVNN-----------------TDSSV--HWRTQLHRWLPHGLNTQ 434
            NC      +D       NN                 TD  V  +WR+ L +WLPHGLNTQ
Sbjct: 513  NCNDLQKLYDLTGFQGENNKEELLQQQQQQQQQQQQTDRFVDGNWRSTLEQWLPHGLNTQ 572

Query: 435  DLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGT 494
            DLELLYM+ ILA YT+ KL  ++PIQLNPFL +LI+LWK L+ +++L L+IDR EE + T
Sbjct: 573  DLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHET 632

Query: 495  YETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYAD 554
            Y+TPL+V+ATIRGA+ALRSV+ATILN  ++ N+HDFKHE+LNTFMSP+GRKL +GALY D
Sbjct: 633  YKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCD 692

Query: 555  LRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYXXXXXXXXXXXXXX 614
            ++  +ASL A G  + ++ +L + L+ GDRFDEDI YMF+YE  DY              
Sbjct: 693  IKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHE----- 747

Query: 615  GIVNAREKIKSSNDN-NVFC---------QRRCNCIFNDDKLVAEDGLNEVFESTCNRNG 664
               +  + +KS++DN +++          QRRCNCIF       ED      +   N + 
Sbjct: 748  ---DLGKTLKSNDDNSDIYVLNEVKLDRYQRRCNCIF-------EDDKILQDDDDGNGDE 797

Query: 665  ERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPS 724
            ++  +   +       +  + +      ++VR+++TFEFDYSG+DWRD+PR FN+YYS S
Sbjct: 798  QQGEQEEQEGTPKNVASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTS 857

Query: 725  YPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNLTGIS 784
            Y FI D  LD + NLT + +T+KLN ++SI L++ +AS +K EQ+ M++ DL   L G  
Sbjct: 858  YSFIDDSSLDTMINLTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDL---LKGKD 914

Query: 785  K-HAEGENSTSISKTDNEELRRT---TPDDIYEIWSEESAFERMLNVNHDVAWRLMDEML 840
            + H+   N    SK + E  R T   TPDDI++ W ++  F  ML+ N +++WRLMDEML
Sbjct: 915  QLHSNIINPLVNSKEEKE--RSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEML 972

Query: 841  MCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQ 900
            MC GYRR+LIW+ TH++L HSLI Y+FEL+MGLRG  F   A++ + K+++++E++  K 
Sbjct: 973  MCNGYRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPF---ANNNECKNELLHELMLGK- 1028

Query: 901  KNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLXXXXXXXXXXDGE--------- 951
            K  D  + PFSRQGP+ILSDIETKMLLQEFF NAAI+           DG+         
Sbjct: 1029 KIVDNHTYPFSRQGPLILSDIETKMLLQEFFSNAAIYF-DNDLATNEGDGQLEHTTEDIS 1087

Query: 952  ------------KISLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGIL 999
                         +S+YS+GL++LIC MV +LI N KF FTKS+C FELQTLLM WIGIL
Sbjct: 1088 INSDEIENNENHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIL 1147

Query: 1000 PEAKDLFFEIKTRL-AMEEDNDTGTMQH----EGRRSLDIEKKLNTKPASKLN------L 1048
             EAK+LFF++K+ +    E  D G        + R+S +   K       K+N      L
Sbjct: 1148 KEAKELFFKLKSDIEETSESTDGGDDDDFESIDSRKSSESNGKWEGSRIGKMNDFNKRLL 1207

Query: 1049 KLLSLFPSNSADNGENSAINTLRNFITDYSFDTQVNP-PGRKVVFYDGKILPLTKA 1103
            +LL+   S   D   ++     R  + +YSF ++     GRKVV+ D +ILPL K 
Sbjct: 1208 RLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPKV 1263

 Score = 88.6 bits (218), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 108/212 (50%), Gaps = 28/212 (13%)

Query: 31  FVPLQELL-------KDKNYVPSVENLEKVLCDE----TMLNDQKVR-FSLLFEALAITL 78
             P+ EL+       K K Y P++ENL+  L DE     M   +KV+ FS++ E L I  
Sbjct: 66  LTPMSELIPTIFTNHKFKIYKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAY 125

Query: 79  FTTNSGKSILQSIQTFTSKKRKLWAQSFENNNSNYASIVFSWKDNDILLLKFVRFLLANK 138
           FTT SG+SIL  +  F +K++    Q+          +  +W+ N+ L   F+ FL+ NK
Sbjct: 126 FTTKSGQSILNYL--FDTKRKPPTVQN--------KILRKTWEVNEFLYFCFIDFLIRNK 175

Query: 139 TMPLKIDRYNLPEHKLPLSFLI----VSKINIPSILLNEGYNLLKDYLYSITGRIEELLM 194
              + ID++N PE+KL + FL+    +S I  PSI+L+  YN+L DYL + +  +  +L+
Sbjct: 176 NNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNMLTDYLDATSNWL--ILL 233

Query: 195 CSPKFNQPALVVKRTLKDYDRMIECENCYCWY 226
                         T+  Y+R+ +    + WY
Sbjct: 234 IKMTILNVGPFFYNTIIRYNRIPQFNGHFQWY 265

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/1143 (36%), Positives = 617/1143 (53%), Gaps = 137/1143 (11%)

Query: 44   VPSVENLEKVLCDETMLNDQ--KVRF--SLLFEALAITLFTTNSGKSILQSIQTFTSKKR 99
            V   E LEK+  DE +      + RF  +  +E L I LFTT  G  IL         K 
Sbjct: 86   VIPFEYLEKIYRDEDLSTTSYSRPRFEDNFFYELLTIALFTTKPGNKILHFF------KN 139

Query: 100  KLWAQSFENNNSN--------YASIVFSWKDNDILLLKFVRFLLANKTMPLKIDRYNLPE 151
                 + E+N+S+        Y  +   WK  D  L   ++F+L N+ + + +  Y    
Sbjct: 140  TGLDSAIEHNDSDDTLFHSPAYEHLKMLWKWEDEYLHNLLQFILKNRNVDIDLGNYCKTS 199

Query: 152  HKLPLSFLIVSKIN--IPSILLNEGYNLLKDYLYSITGRIEELLMCSPK--FNQPALVVK 207
            +K PL+FL+    N      LL+E +N+L++YLY+    I+  +  + +    +      
Sbjct: 200  YKRPLTFLLTCPNNNIKHRFLLSEEFNILEEYLYAAQSNIKSKIAIAIQSTIGKHMNFFT 259

Query: 208  RTLKDYDRMIECENCYCWYYFNAENSAHLKFDDNI-----------------ACLMGSEN 250
             TL  YDR+ E    Y  Y    + +A  +FD+++                 A L+ S  
Sbjct: 260  MTLHLYDRVTEYNQSYLRYEITDDENALCQFDESLLDVLLEFERYVTTDDIEAILLQSGR 319

Query: 251  NTENGLGDSRVNNNNYHKQPKDVVMSRTIN------DQEQIYSFELNHDGTLEIPNVMKH 304
              +     S +   +Y K  +  + S T N      ++E I SF++N +G  E+PN+MK 
Sbjct: 320  INKVKDISSAIERGDY-KWEQGTLRSLTPNNHKADNEEEVILSFDINENGLQEVPNIMKD 378

Query: 305  SLLRHELLFKILNLTPVST--PLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLG 362
            S+LRH +LF+ L L+  +T  P LE+QF TL GLVDPL QPTPND HIISID L  L+ G
Sbjct: 379  SMLRHSILFEFLGLSQRNTLAPYLEMQFKTLAGLVDPLTQPTPNDTHIISIDLLHGLYTG 438

Query: 363  LMYPA-IKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHWRT 421
            L++PA IKS +  N  YDWK+   FN+ KI+  ++ +L+C  ++ LN++ N +    WR 
Sbjct: 439  LVHPALIKSGKARN--YDWKYLCGFNLIKIVWKSLKKLHCSSYDTLNNIGNFEEGNDWRQ 496

Query: 422  QLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILL 481
             L  W+P  LNTQDLELLYMIDIL+VY IYKLYE  PIQ NPFLF L S+WK ++ +I L
Sbjct: 497  TLEYWIPKNLNTQDLELLYMIDILSVYAIYKLYEDQPIQNNPFLFELFSVWKYITKIIFL 556

Query: 482  ALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSP 541
             L++DRIEE+N + ETPLM+RAT+RGA+A R+ + TILN  ++ NEHDFKHE +NTFMSP
Sbjct: 557  GLQVDRIEEQNDSEETPLMIRATVRGASAFRAALTTILNRQIENNEHDFKHEPINTFMSP 616

Query: 542  YGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYX 601
            +GRKL  G+LYAD+R  +   +  G  ++D+T+L  DLQ GDRFDED+ YMFDYE  DY 
Sbjct: 617  HGRKLCSGSLYADMRVSTKIFVENGVELDDITNLLTDLQPGDRFDEDVEYMFDYEYEDY- 675

Query: 602  XXXXXXXXXXXXXGIVNAREKIKSSNDNN--------VFCQRRCNCIFNDDKLVAEDGLN 653
                          +V+  E +    DN         +F  RRCNC+F DDK++ E  ++
Sbjct: 676  -------------NLVSDSEDMDEKADNESDGVRPAPIF--RRCNCVFEDDKIMDESTID 720

Query: 654  EVFESTCNRNGERRVRNNIDVVSNTAITTSNH-----VSTSINPFSVRARSTFEFDYSGE 708
                        + +  +++ + N AI+T +      + +   PF+VR RS F+F+Y G+
Sbjct: 721  -----------HQSLITDME-LENNAISTKDENDKIKIISQPEPFTVRMRSFFDFNYGGK 768

Query: 709  DWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQ 768
            DWRD+PR  N+YY+  + F+ +       +   +     L+  ES  L++ VASC++ EQ
Sbjct: 769  DWRDIPRGENLYYNGEFVFVQECSSSEFASYFSKAVNSVLDISESNRLIQLVASCIREEQ 828

Query: 769  DQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVN 828
            D+MV+        G+S+        + SK         T D+IY+  S  + F +ML  +
Sbjct: 829  DRMVI------YHGMSQLPLANGDVNKSK--------LTVDEIYDQISSSNNFAKMLYQD 874

Query: 829  HDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKK 888
             ++A  LMDE+LM  GYRR+LIWF TH+ +   LI+Y+FEL+MG R     G A+  +  
Sbjct: 875  TELACGLMDELLMIVGYRRVLIWFLTHINITFPLIHYIFELVMGYRVGFSDGDANGDN-- 932

Query: 889  DDMIYEILKKKQKNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLXXXXXXX--- 945
                        K        FSR G + LS IE +MLLQEFF+NA + L          
Sbjct: 933  -----------NKKSSTGKCGFSRLGTVALSSIEKQMLLQEFFLNATVSLSAKSFESNGT 981

Query: 946  --------XXXDGEKISLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIG 997
                       D E IS Y++G+V LIC MV+TL+   +   +KSE T ELQTLL+ WI 
Sbjct: 982  EIDNYDDNADEDNEYISSYAVGIVTLICNMVKTLVRAGQMDVSKSEYTVELQTLLVNWIS 1041

Query: 998  ILPEAKDLFFEIKTRLAMEEDNDTGTMQHEGRRSLDIEKKLNTKPASKLNLKLLSLFPSN 1057
            ++PEAK+LFF +K      E +   +++      L     +N +PA+  ++ L     ++
Sbjct: 1042 LIPEAKELFFFLKQE--AHEFDIQDSLEPINESELQTSGNIN-EPAATDSIPLDDTINTS 1098

Query: 1058 SADNGENS-AINTLRNFITDYSFDTQVNPP--GRKVVFYDGKILPLTKADKPIPLHEYIT 1114
               + +NS A + L  F+     +T V PP  GRKV++   KILPL + ++PIP H    
Sbjct: 1099 LTSSTKNSNATDALSTFLETVE-ETSVQPPQIGRKVIYKGTKILPLPEQERPIPFHLLFE 1157

Query: 1115 LAE 1117
             AE
Sbjct: 1158 RAE 1160

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/1161 (35%), Positives = 607/1161 (52%), Gaps = 158/1161 (13%)

Query: 32   VPLQELLKDKNYVPSVENLEKVLCDET----MLNDQKVRFSLLFEALAITLFTTNSGKSI 87
            V L+++L    Y PSV NL+ +L +      ML D   R  L  E + +TL  + SG S+
Sbjct: 3    VTLKDILP--KYRPSVYNLKNLLRNNELVLDMLADVNERNVLASEVVMMTLLCSKSGSSM 60

Query: 88   LQ-------SIQTFTSKKRKLWAQSFENNNSNYASIVFSWKDNDILLLKFVRFLLAN--- 137
            L+       +I  + + +  ++ ++         ++   W++ND+LL+KF+  LL+N   
Sbjct: 61   LEYYMSNIDTIDDYKTSENSIYKKN--------TALALRWENNDVLLIKFLTILLSNRKT 112

Query: 138  -------------KTMPLKID-RYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKDYLY 183
                         K M    D R+   +H    S+L  +      I+ +E ++ L+ Y  
Sbjct: 113  LIKFTTGKDDTLSKNMAFAQDLRFLFNKHYDETSYLPAA------IVKSEQFDYLEAYCS 166

Query: 184  SITGRIEELLMCSPKFNQPALVV-----KRTLKDYDRMIECENCYCWYYFNAENSAHLKF 238
             I  +I+ +L+ S   ++    V      + +K Y R       +        NS    +
Sbjct: 167  IIWPKIKNILLESLNIDKQFQDVTNSFFHKIIKLYKREYLVSAEFLTLINVLTNSVLFSY 226

Query: 239  DDNIACLMGSENNTENGLGDSRVNNNNYHKQPKDVVMSR--TINDQEQIYSFELNHDGTL 296
                  +M SE     G   S  +   Y   P   V  R   +N   +  S  +  +   
Sbjct: 227  -----IVMLSE-----GYISSNYDGLLYKSPPTYNVKQRENMMNSFGEFQSSAMLTNDEN 276

Query: 297  EIPNVMKHSLLRHELLFKIL------NLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHI 350
               ++MK +  R  +L+K+L       + P S  L+ L F+ +C LVDPL QP PND+H+
Sbjct: 277  NSIDLMKLTERRQNILYKVLIFSKLKQIEPESFQLMSLLFNRICALVDPLTQPIPNDEHV 336

Query: 351  ISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSV 410
            IS+D L+K+FL +M P ++        YDW++    N+QKI+      LNC+D   LN V
Sbjct: 337  ISLDLLYKIFLAMMLPHVQVLIERESSYDWRYEISNNLQKILFYAFLNLNCYDMEKLNKV 396

Query: 411  NNTDSSVHWRTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLIS 470
               D + HW+ QLH WLPHGLN Q+LELLYMI I  VY I+KLYE  P+  NPFL +L+S
Sbjct: 397  ---DETKHWKEQLHLWLPHGLNPQNLELLYMICIFCVYAIFKLYEDKPLHFNPFLPTLLS 453

Query: 471  LWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDF 530
             WK L+ V+L  L++DR EEEN ++ TP+MVRATIRGA+ALRSV+A+ILN  +   +HDF
Sbjct: 454  TWKKLTYVMLYGLQVDRFEEENESFNTPIMVRATIRGASALRSVVASILNNQMDGKKHDF 513

Query: 531  KHESLNTFMSPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIR 590
            +HE LNTFMSP+GRKL  GALYADL+S++AS+LA G   +D+T+L + LQ GD FDED++
Sbjct: 514  QHEPLNTFMSPHGRKLCTGALYADLKSYTASMLACGMEFKDITELLSYLQPGDCFDEDVK 573

Query: 591  YMFDYECADYXXXXXXXXXXXXXXGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAED 650
            YMF+YE  DY                 N+ E IK +     F +RRC C+F+DD ++   
Sbjct: 574  YMFEYEYDDYNEPEEDESDEDGERN--NSEENIKFN-----FNRRRCRCVFSDDDVLEHG 626

Query: 651  GLNEVFESTCNRNGERRVRNNID--VVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGE 708
              N+      N        N++D  V+ N  I               + ++  EFD+ G+
Sbjct: 627  DFNDANSEYSN---SEENSNDVDNFVLPNDGID--------------KPKNGVEFDFDGK 669

Query: 709  DWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQ 768
            DWR VPR  NM+YS  Y FI +P   +I +L    +   L++++S LL+R++AS +K  Q
Sbjct: 670  DWRAVPRHLNMFYSFDYIFIENPLEVLIRSLISEASASALSKKKSHLLLRNIASVIKINQ 729

Query: 769  DQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVN 828
            D  +L   ++            N T  SK+ N      +  D+ ++ +    FE +L  N
Sbjct: 730  DSRILGSKRS-----------PNGTDSSKSQN----GLSTGDLIKLITAGDTFENILKFN 774

Query: 829  HDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKK 888
             ++   LMDE+LM  GYRR+L+WF THL L H++IYY+FEL+M  R     G+ SD +++
Sbjct: 775  RELGCFLMDELLMILGYRRVLLWFLTHLTLSHTIIYYIFELLMHHR-----GQVSDTERE 829

Query: 889  DDMIYEILKKKQKNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLXXXXXXXXX- 947
               +              S  FSRQG + LSD+E +MLLQEFF NA +F           
Sbjct: 830  QSEL--------------SYTFSRQGELRLSDLEREMLLQEFFTNATMFFSSKSVLFASD 875

Query: 948  ----------XDGEK--ISLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTW 995
                       DGE+   SLY++GL+R+ C M+ +L  N  F  + SE  FELQTLLM W
Sbjct: 876  TGDNNEINTDVDGEEGLYSLYAVGLMRVTCIMIISLFDNADFDLSSSESIFELQTLLMGW 935

Query: 996  IGILPEAKDLFFEIKTRLAMEEDNDTGTMQHEGRRSLDIEKKL--NTKPASKLNLKLLSL 1053
            I I+PEAK LFF++K  +      D   ++     S   +K          + N KLL  
Sbjct: 936  INIIPEAKLLFFKLKESVKSFNGIDNPELKSIEESSTTTKKTTIDENSEQYRFNKKLLKT 995

Query: 1054 FP-SNSADNGENSAINTLRNFITDYSFDTQVNPP--GRKVVFYDGKILPLTKADKPIPLH 1110
            FP S S D+G+   + T ++F+ +YSFD++  PP  GRKV++   +IL LT  +KPI LH
Sbjct: 996  FPKSFSGDDGD-ILLKTFKDFLRNYSFDSE--PPYIGRKVIYESDEILQLTDIEKPISLH 1052

Query: 1111 EYITLAEL-------DVGDSE 1124
            ++++  +L       D GD E
Sbjct: 1053 KFLSGEQLYDVDIQFDYGDKE 1073

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  389 bits (999), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 326/1141 (28%), Positives = 538/1141 (47%), Gaps = 137/1141 (12%)

Query: 51   EKVLCDETMLNDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKKRKLWAQSFE--- 107
            EK       L D  V  S+L E L I LFTT  G++++   Q     KR       E   
Sbjct: 4    EKSSVQRLFLADSDVDESVLLEKLVIALFTTVPGQAVV--TQLINDAKRTNDVDGVECLI 61

Query: 108  -NNNSNYASIVFSWKDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINI 166
              N+  + ++  +W  +  +L  F+ ++L N+T  + ++RY+    K+ + FL+ ++   
Sbjct: 62   RMNDPYWVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPK 121

Query: 167  PSILLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWY 226
             +  L +  N+L DYL++    IE +L    K +    +  + L  Y+R+ E    Y W+
Sbjct: 122  FTAPLWDTSNILLDYLHNAKPLIESVL---KKLDGSQFL--QCLMKYNRLYEFNGSYQWF 176

Query: 227  YFNAENSAHLKFDDNI----ACLMGSENNTENGL---------GDSRVNN------NNYH 267
                ++++H +    I    +  + +  N  N +         GD R+N+      N+ H
Sbjct: 177  T-PPQSTSHAESPTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGH 235

Query: 268  KQPKDVVMSRTINDQEQIYSFELNHDGTLEIPNVMKHSLLRHELLFKILNLTPVSTPLLE 327
              P        ++ Q+      LN                R  L FK L L     PLL 
Sbjct: 236  NNPP-------LSKQDDHNPLNLNGKSD------------RFNLFFK-LGLHKEPHPLLA 275

Query: 328  LQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCFN 387
             QF++LC   DP+ QP PND HIIS+D L  L+LG +   I      N    WK +   N
Sbjct: 276  EQFNSLCLFADPMTQPPPNDSHIISLDLLHDLYLGSLTAYIVKLIP-NYQKVWKIHLSAN 334

Query: 388  MQKIIDATMSRLNCFDFNILNSVNNTD--SSVHWRTQLHRWLPHGLNTQDLELLYMIDIL 445
            ++ I  A +  L  +D+  L+++ +    S   +   +  W+P+ L+  ++E+LYMI  L
Sbjct: 335  LETITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGL 394

Query: 446  AVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATI 505
            + Y+++K++   P +LNPFL  ++  W+ LS  ++L L+IDR EE    Y TP++V A I
Sbjct: 395  SFYSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVI 454

Query: 506  RGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYADLRSHSASLLAF 565
            RGA+ALRS+IATILNG V    HDFKH+    FMSP+GRKL +GALY     + A+LL  
Sbjct: 455  RGASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPS 514

Query: 566  GTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYXXXXXXXXXXXXXXGIVNAREKIKS 625
            G   +++ +L  D+Q GDR DED+RYMFDYE  DY                 + + +++ 
Sbjct: 515  GMDYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLM-FTSTKNELEQ 573

Query: 626  SNDNNVF--CQRRCNCIFNDDKLVAEDGLNEVFESTCNRNGERRV-------RNNIDVVS 676
             N   +     +RC C F+D+    +   ++  +   + NGE+ V       + N     
Sbjct: 574  KNRFRMLRGLYKRCLCKFSDEDDNDD---DDDDDDDDDYNGEKSVVGLDENGQINEAETP 630

Query: 677  NTAITTSNHVS--------TSINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSYPFI 728
             T   +SN V+         S N F   +  T  +D +G+DWRD+PR  N+YY   Y F+
Sbjct: 631  QTFSESSNAVAFTSLMTHRDSQNDFV--SHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFL 688

Query: 729  HDPKLDVI--FNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNLTGISKH 786
               KLD +  F L  R     +   ++  ++RS+A+CVK EQ+Q++L  +          
Sbjct: 689  S--KLDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLI---------- 736

Query: 787  AEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERML---NVNHDVAWRLMDEMLMCT 843
                 + + ++ D + L  +T + I  I++++    +       N  + W++ DE++M  
Sbjct: 737  -----TATSAEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSH 791

Query: 844  GYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQKND 903
            G+RR+LI+  TH     S I+YV+EL+ GLRG        +  K   +         + +
Sbjct: 792  GHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFE 851

Query: 904  DASSLPFSRQGPIILSDIETKMLLQEFFMNAA----------------------IFLXXX 941
              +++ FSRQG I LS IE KMLLQEFF+  +                      +++   
Sbjct: 852  RVAAIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDY 911

Query: 942  XXXXXXXDGEKISLYSLGLVRLICYMVQTLITNDKFFFTKSE-CTFELQTLLMTWIGILP 1000
                      K  +   G V+++C++++ ++ + +F F   E   +EL+  LM W     
Sbjct: 912  GEEFFSATSRKAEMS--GKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSA 969

Query: 1001 EAKDLFFEIKTRLAMEEDNDTGTMQHEGRRSLDIEKKLNTKPASKLNLKLL----SLFPS 1056
            EA  ++  +K++ A+ +  D GT   + R + D + +L      KL L  +         
Sbjct: 970  EACSMYALLKSK-ALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETD 1028

Query: 1057 NSADNGENSAINTLR--NFITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYIT 1114
             S +NG+ ++I + R    +   S D Q   P  KV  +  +  PLT+     P+H  IT
Sbjct: 1029 TSIENGDKTSIMSERFSRMLPVQSLDGQ---PVDKVFRHLLQKYPLTEG---TPIHGRIT 1082

Query: 1115 L 1115
            L
Sbjct: 1083 L 1083

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 127,808,473
Number of extensions: 6052240
Number of successful extensions: 20359
Number of sequences better than 10.0: 40
Number of HSP's gapped: 20783
Number of HSP's successfully gapped: 52
Length of query: 1124
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1004
Effective length of database: 39,721,479
Effective search space: 39880364916
Effective search space used: 39880364916
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)