Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2293.495ON1651658781e-122
YGR133W (PEX4)3.495ON1831657551e-103
Suva_7.4213.495ON1651647291e-99
Skud_7.4443.495ON1621627073e-96
CAGL0I10450g3.495ON1621644234e-53
NCAS0E007803.495ON1711624002e-49
NDAI0G009103.495ON1631583974e-49
Kwal_55.212463.495ON1601603941e-48
SAKL0F02706g3.495ON1611603922e-48
TDEL0D056303.495ON1501563903e-48
ZYRO0D09878g3.495ON1531563861e-47
TPHA0D042603.495ON1581583834e-47
Kpol_480.133.495ON1571583757e-46
KLTH0F14894g3.495ON1661603713e-45
AFR314W3.495ON1551613322e-39
TBLA0C045003.495ON1651593228e-38
Ecym_12343.495ON1611593202e-37
KNAG0B007803.495ON1531553071e-35
KAFR0C019903.495ON1511602895e-33
KLLA0E04027g3.495ON1581662829e-32
NDAI0A011608.375ON2161362075e-20
TBLA0H031308.375ON2141362068e-20
SAKL0A00396g8.375ON2151472041e-19
ZYRO0C03784g8.375ON2181362041e-19
CAGL0E00671g8.375ON2131362022e-19
KLTH0A07546g8.375ON2151361989e-19
Kwal_23.64858.375ON2151361981e-18
Kpol_1030.108.375ON2151351971e-18
KNAG0A048108.375ON2141361953e-18
KLLA0C18656g8.375ON2281061954e-18
Smik_4.2973.308ON1481231904e-18
Skud_4.4418.375ON2151361935e-18
Suva_2.3438.375ON2151361936e-18
Smik_4.4258.375ON2151361936e-18
TPHA0L008508.375ON2161351936e-18
YDR177W (UBC1)8.375ON2151361927e-18
Suva_2.2183.308ON1481231887e-18
Skud_4.3143.308ON1481231887e-18
YDR059C (UBC5)3.308ON1481231887e-18
NCAS0B031508.375ON2141361927e-18
CAGL0M03399g1.436ON2141341911e-17
KAFR0B060608.375ON2131361911e-17
Ecym_60388.375ON2111361892e-17
Smik_15.5177.54ON1561011852e-17
Skud_15.5047.54ON1561011834e-17
TDEL0F049908.375ON2171361875e-17
ADR169C8.375ON2111361857e-17
Kwal_14.18286.109ON152991818e-17
Suva_8.3897.54ON1561011801e-16
Suva_4.3263.308ON1481231791e-16
NCAS0D032206.109ON171991802e-16
KLTH0E14300g3.308ON1471531792e-16
SAKL0B06512g3.308ON1471531792e-16
AER173C3.308ON1471531792e-16
Ecym_74313.308ON1471531792e-16
TPHA0J017506.109ON169991802e-16
KLTH0H06732g6.109ON160991792e-16
KAFR0C002703.308ON1471511782e-16
ZYRO0D04466g7.54ON1591301792e-16
TDEL0G036106.109ON169991792e-16
YGL058W (RAD6)6.109ON172991792e-16
SAKL0A07260g6.109ON169991793e-16
Ecym_30776.109ON170991793e-16
AAR156C6.109ON170991793e-16
Kpol_461.86.109ON167991783e-16
Smik_7.2226.109ON171991783e-16
ZYRO0C04950g6.109ON168991783e-16
TDEL0H039707.54ON1561141773e-16
Suva_7.2136.109ON173991783e-16
KNAG0F025706.109ON151991773e-16
CAGL0I00352g6.109ON167991784e-16
KLLA0C05632g6.109ON164991774e-16
KNAG0J023403.308ON1611231775e-16
YOR339C (UBC11)7.54ON1561011766e-16
KAFR0A047006.109ON153991756e-16
TBLA0F024406.109ON174991767e-16
KNAG0H018701.436ON2101181787e-16
CAGL0E04752g3.308ON1471231748e-16
TBLA0I021303.308ON1481531749e-16
Skud_2.2073.308ON1481231749e-16
Smik_2.2193.308ON1481231749e-16
YBR082C (UBC4)3.308ON1481231749e-16
NDAI0A054903.308ON1471511731e-15
Kpol_1052.23.308ON1481531731e-15
Suva_5.531.436ON2151261771e-15
NCAS0A108003.308ON1481511731e-15
NDAI0I016506.109ON176991751e-15
KLLA0A11198g1.436ON2021301752e-15
TPHA0A038503.308ON1481531722e-15
TDEL0F021003.308ON1471531722e-15
KLLA0E12563g3.308ON1481531712e-15
NDAI0E038707.54ON1641141713e-15
KLTH0H13816g1.436ON2331341753e-15
NDAI0D011401.436ON2451211753e-15
Kwal_27.124013.308ON2361231753e-15
Skud_7.2226.109ON170991714e-15
Smik_5.981.436ON2151181744e-15
YEL012W (UBC8)1.436ON2181181734e-15
ZYRO0G12870g3.308ON1471501694e-15
AEL045W1.436ON2111281735e-15
Kpol_1065.127.54ON1591141705e-15
SAKL0D10560g1.436ON2071301725e-15
KAFR0H029601.436ON1871191715e-15
Kpol_1030.181.436ON2231191736e-15
SAKL0B10582g7.54ON1611141688e-15
Skud_5.871.436ON2101181718e-15
TBLA0A012901.436ON2191191719e-15
TDEL0B065702.569ON1651451681e-14
Kwal_34.161741.436ON2131211701e-14
TPHA0O009201.436ON2261191701e-14
TPHA0I024602.569ON1671511662e-14
Ecym_13481.436ON2111331682e-14
KLLA0E07745g2.569ON1651451662e-14
SAKL0D13552g2.569ON1651451653e-14
TDEL0B056701.436ON2031191673e-14
ZYRO0E03806g1.436ON2091191673e-14
NCAS0G031301.436ON2311181674e-14
ZYRO0E06358g2.569ON1651451611e-13
Ecym_45782.569ON1651451601e-13
ABR059W2.569ON1651451592e-13
KLTH0D01760g7.54ON1611141573e-13
Kpol_1056.52.569ON1651451574e-13
KNAG0M021502.569ON1701451575e-13
KAFR0A021602.569ON1651491557e-13
TBLA0H026102.569ON1651491541e-12
NDAI0B015202.569ON1651451531e-12
Kwal_26.70097.54ON1611141504e-12
KLTH0D07986g2.569ON1651451504e-12
Kwal_26.82242.569ON1651451504e-12
TDEL0A013408.230ON1571011495e-12
KNAG0H029808.230ON1521341485e-12
KLLA0C17622g8.230ON1591011486e-12
Ecym_55638.230ON1641211488e-12
Smik_13.1862.569ON1651491488e-12
Suva_13.1892.569ON1651491488e-12
SAKL0H17930g8.230ON1531171479e-12
Kwal_56.234828.230ON1491011461e-11
Skud_13.1762.569ON1651491471e-11
YMR022W (UBC7)2.569ON1651491471e-11
KAFR0H012303.308ON1101051431e-11
NCAS0A127402.569ON1651451461e-11
AGR121C8.230ON1541021452e-11
Kpol_1075.1b8.230ON1521171443e-11
CAGL0M07568g2.569ON1651451443e-11
KLTH0G14366g8.230ON1491011433e-11
NCAS0B040108.230ON1531011433e-11
ZYRO0B11682g8.230ON1511311424e-11
CAGL0G08063g8.230ON1491011425e-11
NCAS0A059404.49ON1931071445e-11
NDAI0J015408.230ON1541171408e-11
KAFR0A024208.230ON1471171381e-10
Kpol_483.164.249ON122941362e-10
Suva_2.2538.230ON1431171372e-10
YDR092W (UBC13)8.230ON1531171373e-10
Smik_4.3358.230ON1431171363e-10
Skud_4.3528.230ON1431171353e-10
TBLA0F037908.230ON1511011355e-10
TPHA0B007704.249ON1571111356e-10
CAGL0D06468g4.49ON1871161358e-10
YDL064W (UBC9)4.249ON157941339e-10
Skud_4.1914.249ON157941321e-09
Smik_4.1714.249ON157941321e-09
Suva_4.1864.249ON157941322e-09
CAGL0D00814g4.249ON1571111312e-09
TPHA0B034108.230ON1521171302e-09
SAKL0H03058g4.249ON157941303e-09
KLTH0D14344g4.249ON1571001294e-09
KLLA0E05039g4.249ON1571111294e-09
Kwal_23.42274.249ON122941265e-09
KLLA0E20395g7.392ON2511241316e-09
KNAG0D043904.249ON1571001268e-09
Skud_12.3894.49ON1871301289e-09
Ecym_32704.249ON157941261e-08
KLLA0E19119g6.187ON139961241e-08
Smik_12.3894.49ON1871301252e-08
AER056C4.249ON157941242e-08
ZYRO0B12386g4.249ON157941242e-08
YGL087C (MMS2)6.187ON1371121223e-08
Suva_7.1826.187ON1371121214e-08
Kpol_414.2singletonOFF1921141235e-08
Kpol_YGOB_414.24.49ON1931141225e-08
TBLA0I029604.249ON1571111215e-08
TDEL0E012204.249ON157941215e-08
TBLA0E015704.49ON194921225e-08
NCAS0A024904.249ON1571001216e-08
NDAI0D043804.249ON1571111191e-07
Suva_10.4014.49ON1871061182e-07
YLR306W (UBC12)4.49ON1881311173e-07
Kpol_1045.397.392ON2531241175e-07
CAGL0I05478g7.392ON2461241165e-07
CAGL0H03157g6.187ON1391421135e-07
KAFR0G032404.249ON157941146e-07
Skud_5.2257.392ON2501241167e-07
KAFR0L017507.392ON2511261167e-07
TBLA0D006007.392ON2561241158e-07
YER100W (UBC6)7.392ON2501241159e-07
Smik_5.2467.392ON2501241159e-07
KNAG0I029404.49ON1971031131e-06
ZYRO0B03344g7.392ON250901141e-06
KLTH0H04796g6.187ON138961101e-06
KNAG0B023607.392ON2511261141e-06
KLTH0C06688g7.392ON2461121131e-06
Suva_5.2197.392ON2491241132e-06
AFL064W6.187ON138961092e-06
KAFR0F030404.49ON1691121102e-06
TPHA0J022506.187ON1371271083e-06
TDEL0G015806.187ON1381131083e-06
NCAS0A143907.392ON2401241113e-06
NDAI0A016507.392ON2511241104e-06
Ecym_46837.392ON2431231104e-06
TDEL0E055604.49ON187941084e-06
TDEL0C015507.392ON2481241095e-06
Ecym_22306.187ON1381071056e-06
SAKL0F12474g7.392ON2511241087e-06
NCAS0E026007.392ON2551261087e-06
KLTH0H09504g4.49ON184921068e-06
Ecym_83714.49ON2671001089e-06
SAKL0H24112g4.49ON185841051e-05
Skud_7.1956.187ON100731021e-05
Smik_7.1966.187ON100671011e-05
NCAS0D036606.187ON138961022e-05
AGR372W7.392ON2421241042e-05
KLLA0C17248g4.49ON184831032e-05
TPHA0F003904.49ON193911033e-05
ADL035C4.49ON200931033e-05
TPHA0K008207.392ON2571241033e-05
ZYRO0G08228g6.187ON1381131004e-05
Kwal_27.111826.187ON10174984e-05
Kwal_27.108377.392ON2461121025e-05
SAKL0A05192g6.187ON14064986e-05
KAFR0C021406.187ON13896978e-05
TBLA0A019006.187ON13996979e-05
NDAI0D029104.49ON189108972e-04
NDAI0E041707.392ON257167972e-04
NDAI0I012306.187ON15761943e-04
NCAS0I014303.301ON258120929e-04
KNAG0F021306.187ON13899870.002
NDAI0A055303.301ON273120890.003
NCAS0A107703.301ON273120880.003
CAGL0E04598g3.301ON295120880.003
KNAG0H010403.301ON296120880.004
Skud_4.3063.301ON297120870.004
Suva_2.2113.301ON297120870.005
Smik_4.2903.301ON297120870.005
YDR054C (CDC34)3.301ON295115860.006
TPHA0M012803.301ON435120870.006
Kwal_27.104443.301ON278120860.006
NDAI0A075703.301ON23994860.006
TDEL0D032603.301ON28994860.006
Kpol_1065.453.301ON323120850.009
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.229
         (165 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   342   e-122
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   295   e-103
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   285   1e-99
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   276   3e-96
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   167   4e-53
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   158   2e-49
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   157   4e-49
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   156   1e-48
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   155   2e-48
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   154   3e-48
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   153   1e-47
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   152   4e-47
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   149   7e-46
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   147   3e-45
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   132   2e-39
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   128   8e-38
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   127   2e-37
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   122   1e-35
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   115   5e-33
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   113   9e-32
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      84   5e-20
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    84   8e-20
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    83   1e-19
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    83   1e-19
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    82   2e-19
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    81   9e-19
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    81   1e-18
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    80   1e-18
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    80   3e-18
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    80   4e-18
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    78   4e-18
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    79   5e-18
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    79   6e-18
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    79   6e-18
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    79   6e-18
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    79   7e-18
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    77   7e-18
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    77   7e-18
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    77   7e-18
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      79   7e-18
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    78   1e-17
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    78   1e-17
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    77   2e-17
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    76   2e-17
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    75   4e-17
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    77   5e-17
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    76   7e-17
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    74   8e-17
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    74   1e-16
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    74   1e-16
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      74   2e-16
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    74   2e-16
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    74   2e-16
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    74   2e-16
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    74   2e-16
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    74   2e-16
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    74   2e-16
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    73   2e-16
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    74   2e-16
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    74   2e-16
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    74   2e-16
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    74   3e-16
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    74   3e-16
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    74   3e-16
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    73   3e-16
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    73   3e-16
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    73   3e-16
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    73   3e-16
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    73   3e-16
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    73   3e-16
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    73   4e-16
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    73   4e-16
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    73   5e-16
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    72   6e-16
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    72   6e-16
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    72   7e-16
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    73   7e-16
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    72   8e-16
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    72   9e-16
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    72   9e-16
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    72   9e-16
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    72   9e-16
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    71   1e-15
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    71   1e-15
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    73   1e-15
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    71   1e-15
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      72   1e-15
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    72   2e-15
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    71   2e-15
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    71   2e-15
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    70   2e-15
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    70   3e-15
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    72   3e-15
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    72   3e-15
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    72   3e-15
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    70   4e-15
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    72   4e-15
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    71   4e-15
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    70   4e-15
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    71   5e-15
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    70   5e-15
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    71   5e-15
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    70   5e-15
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    71   6e-15
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    69   8e-15
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    70   8e-15
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    70   9e-15
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    69   1e-14
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    70   1e-14
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    70   1e-14
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    69   2e-14
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    69   2e-14
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    69   2e-14
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    68   3e-14
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    69   3e-14
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    69   3e-14
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                69   4e-14
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    67   1e-13
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    66   1e-13
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    66   2e-13
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    65   3e-13
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    65   4e-13
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    65   5e-13
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    64   7e-13
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    64   1e-12
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    64   1e-12
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    62   4e-12
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    62   4e-12
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    62   4e-12
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    62   5e-12
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    62   5e-12
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    62   6e-12
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    62   8e-12
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    62   8e-12
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    62   8e-12
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    61   9e-12
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    61   1e-11
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    61   1e-11
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    61   1e-11
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    60   1e-11
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    61   1e-11
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    60   2e-11
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    60   3e-11
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    60   3e-11
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    60   3e-11
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    60   3e-11
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    59   4e-11
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    59   5e-11
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     60   5e-11
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    59   8e-11
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    58   1e-10
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    57   2e-10
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    57   2e-10
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    57   3e-10
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    57   3e-10
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    57   3e-10
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    57   5e-10
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    57   6e-10
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    57   8e-10
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    56   9e-10
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    55   1e-09
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    55   1e-09
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    55   2e-09
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    55   2e-09
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    55   2e-09
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    55   3e-09
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    54   4e-09
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    54   4e-09
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    53   5e-09
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    55   6e-09
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    53   8e-09
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    54   9e-09
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    53   1e-08
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    52   1e-08
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    53   2e-08
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    52   2e-08
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    52   2e-08
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    52   3e-08
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    51   4e-08
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    52   5e-08
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    52   5e-08
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    51   5e-08
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    51   5e-08
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    52   5e-08
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    51   6e-08
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    50   1e-07
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    50   2e-07
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    50   3e-07
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    50   5e-07
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    49   5e-07
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    48   5e-07
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    49   6e-07
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    49   7e-07
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    49   7e-07
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    49   8e-07
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    49   9e-07
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    49   9e-07
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    48   1e-06
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    49   1e-06
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    47   1e-06
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    49   1e-06
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    48   1e-06
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    48   2e-06
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    47   2e-06
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    47   2e-06
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    46   3e-06
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    46   3e-06
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    47   3e-06
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    47   4e-06
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    47   4e-06
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    46   4e-06
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    47   5e-06
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    45   6e-06
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    46   7e-06
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    46   7e-06
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    45   8e-06
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    46   9e-06
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    45   1e-05
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    44   1e-05
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    44   1e-05
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    44   2e-05
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    45   2e-05
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    44   2e-05
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    44   3e-05
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    44   3e-05
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    44   3e-05
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    43   4e-05
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    42   4e-05
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    44   5e-05
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    42   6e-05
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    42   8e-05
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    42   9e-05
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       42   2e-04
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    42   2e-04
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    41   3e-04
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                40   9e-04
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    38   0.002
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    39   0.003
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    39   0.003
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    39   0.003
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                39   0.004
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    38   0.004
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    38   0.005
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    38   0.005
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    38   0.006
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    38   0.006
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    38   0.006
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    38   0.006
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    38   0.006
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    37   0.009
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    37   0.009
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    37   0.009
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                37   0.009
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    37   0.010
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    35   0.011
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    37   0.012
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    37   0.013
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    37   0.013
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    37   0.017
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    35   0.053
NDAI0C00670 Chr3 (130848..132401) [1554 bp, 517 aa] {ON}               32   0.77 
Ecym_8386 Chr8 complement(786255..788990) [2736 bp, 911 aa] {ON}...    32   0.86 
Kwal_26.7007 s26 (161304..162179) [876 bp, 291 aa] {ON} YAL034W-...    30   2.2  
NDAI0C05320 Chr3 (1232721..1234361) [1641 bp, 546 aa] {ON} Anc_8...    30   4.3  
Ecym_1514 Chr1 complement(1060426..1064322) [3897 bp, 1298 aa] {...    29   5.8  
SAKL0E11110g Chr5 (933600..935456) [1857 bp, 618 aa] {ON} simila...    28   8.4  

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  342 bits (878), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 165/165 (100%), Positives = 165/165 (100%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
           HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW
Sbjct: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSRYH 165
           RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSRYH
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSRYH 165

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  295 bits (755), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 151/165 (91%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           MSRI KEY+VILKTLASDDPI NPYRGII SLNPIDETDLS+WEA I GPS TPYEN+QF
Sbjct: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            ILI+VPSSYPM PP+I+F QN+ILHCNVKSATGEICL+ILKPE+WTPVWDLLHCVHAVW
Sbjct: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSRYH 165
           RLLREPVCDSPLDVD+GNIIRC D SAYQGIVKYFLAERER   H
Sbjct: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERINNH 183

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  285 bits (729), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 134/164 (81%), Positives = 146/164 (89%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           MSRITKEYR+I KTLASDDP VNPYRGII SLNP DETDLS+WEA I GP HTPYE YQF
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            +LIDVP SYPM PP+I FE++ ILHCN+ S+TGEICLDILK +DWTPVWDLLHCVHAVW
Sbjct: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSRY 164
           RLLREPVCDSPLDVDMGNIIRC D+ AYQGIVKYFLAERER+ +
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERERNNH 164

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  276 bits (707), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 129/162 (79%), Positives = 146/162 (90%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           MSRI KEY  I KTLAS+DPIVNPY+G+I SLNPIDETDLS+WEA I GP+HTPYE+Y+F
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            ILIDVPSSYPM PP I F++N+ILHCN+KS TGEICLDILKPEDWTPVWDLLHCVHA+W
Sbjct: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERS 162
           RLL+EPV DSPLDVDMGNIIRC D  AYQGI++YFLAER+R+
Sbjct: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDRN 162

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  167 bits (423), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 107/164 (65%), Gaps = 12/164 (7%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           M+RI+KE   I K L   D         +  L P+D++DLSRW A I GP+ TPY  Y+F
Sbjct: 1   MARISKELLKIRKALEHGD------SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEF 54

Query: 61  HILIDVPSSYPMTPPRINFEQNDIL------HCNVKSATGEICLDILKPEDWTPVWDLLH 114
            + I+VP+SYPM PP I F  +         HCNV   TGEICLDILKPE W+P+WD+LH
Sbjct: 55  KLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILH 114

Query: 115 CVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAE 158
            V A+  LL+EPV DSPLDVDM NI++  D SAY GI++YFL E
Sbjct: 115 VVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  158 bits (400), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 74/162 (45%), Positives = 109/162 (67%), Gaps = 5/162 (3%)

Query: 1   MSRITKEYRVILKTLASDDPIVN-----PYRGIIRSLNPIDETDLSRWEAKIYGPSHTPY 55
           MSR+ KEY+ I  TL+ +    N      +  II  L+PI  +DL+ W+A+I GP  TPY
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60

Query: 56  ENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHC 115
            N++F + I+ P +YP+ PP I+F+   + HCNV   TG ICLDIL+ + WTP W+L+  
Sbjct: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120

Query: 116 VHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLA 157
           + A+W LL++PV DSPL+VD+ NI+R  D+SAY G++ Y+L+
Sbjct: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  157 bits (397), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 105/158 (66%), Gaps = 2/158 (1%)

Query: 1   MSRITKEYRVILKTLASD-DPIVNPYRGIIRSLNPID-ETDLSRWEAKIYGPSHTPYENY 58
           MSRI KEY+ I K L ++ +   + +  II SL PID + DL++WEA I GP  TPY  +
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60

Query: 59  QFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHA 118
            F + I +P  YP  PP   F+   + HCNV   TGEICLDILK + WTPVW+L+  + A
Sbjct: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120

Query: 119 VWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           +W LL++PV +SPL+VD+ N++R  D SAY G++ Y+L
Sbjct: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYL 158

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  156 bits (394), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 101/160 (63%), Gaps = 5/160 (3%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KEY+ +LKTL  D     P    IR L P+ + +L  WEA I GPS TPY+ ++F +
Sbjct: 4   RLAKEYKTLLKTLKED-----PAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSL 58

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
           LI +PS+YP+ PP++ F    + HCNV   +G IC+++L+   W+P WDLLH VHA+W L
Sbjct: 59  LITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLL 118

Query: 123 LREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERS 162
           L  P  DSPLDVD+  + R  D SA+ G+V Y+L    R 
Sbjct: 119 LANPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRG 158

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  155 bits (392), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 104/160 (65%), Gaps = 8/160 (5%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + RITKE++ + KTLA D     P    I  L P D  ++  W A I GP  TPY +  F
Sbjct: 3   LQRITKEFKSVRKTLAED-----PSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVF 57

Query: 61  HILIDVPSSYPMTPPRINF---EQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVH 117
            + +++P  YP+ PPR+ F    +N+I HCNV   TGEICLDIL  E W+PVWDL+H +H
Sbjct: 58  ALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIH 117

Query: 118 AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLA 157
           A+W LL EPV +SPL+VD+ N+++  D  AY+G++KY++ 
Sbjct: 118 AIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  154 bits (390), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 101/156 (64%), Gaps = 8/156 (5%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           M+RI +EY+ I  TL S+  +V        SL PID  DLSRW  +I GP+ TPYE + F
Sbjct: 1   MARIAREYKHIQATLGSESSLV-------VSLEPID-GDLSRWAGEIRGPTGTPYEGHTF 52

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + + +   YP TPP++ F +  + HCNV   TG ICL+IL PE W+P WDLLH + A+ 
Sbjct: 53  SLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAII 112

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           +LL +P  DSPLD+D+ NI+R  D SAY G+V Y+L
Sbjct: 113 QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  153 bits (386), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 99/156 (63%), Gaps = 5/156 (3%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           MSR  KEY+ I K L   D +   Y  +I  + P  + DL+RWEA I GPS TPYE   F
Sbjct: 1   MSRAAKEYKTITKVLKEGDEV---YSQLIVGMEP--KEDLTRWEALIRGPSGTPYEGCNF 55

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + + +P  YPM+PP + FE   + H NV   TGEICLDIL  + W+P WDLLH V A+ 
Sbjct: 56  RLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIG 115

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           +LL EPV  SPL+VD+ NI++  D +AY G+V Y++
Sbjct: 116 QLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  152 bits (383), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 105/158 (66%), Gaps = 7/158 (4%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + R+ KE R+I K L+        Y   I  L P+   +  +W A + GP +TPY  + F
Sbjct: 3   LKRLLKEKRLIEKELSG-------YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSF 55

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            +LI++PS YP+ PP I FE   + HCNV+ +TG+ICL+IL+ E W+PVW+L++ + A++
Sbjct: 56  KLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY 115

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAE 158
           +LL+EPV DSPL++D+ NI+R  D SAY G++ Y+L E
Sbjct: 116 QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  149 bits (375), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 103/158 (65%), Gaps = 7/158 (4%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KEY+V+ K L +       ++ II SL PID  DL+ W A I GP +TPY  + F +
Sbjct: 5   RLLKEYQVVKKELGN-------HKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDL 57

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I +   YP+ PP++ F    + HCN++  TG+ICL+IL   +W+PVW+LL  V A+++L
Sbjct: 58  RIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQL 117

Query: 123 LREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERE 160
           L +PV DSPL++D+ NI++  D SAY G+++Y+L  + 
Sbjct: 118 LSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  147 bits (371), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 95/160 (59%), Gaps = 5/160 (3%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KEYR + KTL  D     P    I SL P+ E +L +WE+ I GP  TPY  ++F +
Sbjct: 4   RLAKEYRALSKTLGRD-----PEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTL 58

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+   +YP+ PP++ F+   + HCNV   +G ICL +L    WTP WDLLH VHA+W L
Sbjct: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLL 118

Query: 123 LREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERS 162
           L  P  DSPLDVD+  ++R  D SA+  ++ Y+L    R 
Sbjct: 119 LASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSRG 158

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  132 bits (332), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 97/161 (60%), Gaps = 11/161 (6%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDE--TDLSRWEAKIYGPSHTPYENY 58
           M RI +EY+ + K LA    ++        SL P+ E   DL RWEA   GP +TPY  +
Sbjct: 1   MRRILREYKQLQKQLALHPAVL--------SLAPVGEENGDLHRWEAHFQGPENTPYAGF 52

Query: 59  QFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHA 118
            F + I+VP +YP  PP+ +F  + I H N+K +TGE+CLD+LK E W+PV++LL  V A
Sbjct: 53  TFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEA 112

Query: 119 VWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAER 159
           +  LL EP  DSPLDVD+  +    D +AY G+V Y L  R
Sbjct: 113 ISTLLAEPGVDSPLDVDLSRLY-TTDRAAYDGVVNYRLRTR 152

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  128 bits (322), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 95/159 (59%), Gaps = 11/159 (6%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDE--TDLSRWEAKIYGPSHTPYENY 58
           MSRI KEY  I K  A  D +         +L+P+    +DLS W + I GP  +PY N 
Sbjct: 1   MSRIIKEYNHIRKLNALPDNMT--------TLHPVSNATSDLSNWHSIILGPKDSPYHNK 52

Query: 59  QFHILIDVPSSYPMTPPRINFEQNDIL-HCNVKSATGEICLDILKPEDWTPVWDLLHCVH 117
            F + I +P+ YP  PP I F +N I  HCNV   TGEICL+ILK E+W+PVW+LL+ V 
Sbjct: 53  SFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQ 112

Query: 118 AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           A+ +LL  P   SPL++D+  ++   D  AY  ++KY+L
Sbjct: 113 AIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  127 bits (320), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 95/159 (59%), Gaps = 10/159 (6%)

Query: 2   SRITKEYRVILKTLASDDPIVNPYRGIIRSLNPI-DETDLSRWEAKIYGPSHTPYENYQF 60
           SR+  EY+ I + L S + I+         L P  D   LS+WEA+  GP +TPY ++ F
Sbjct: 10  SRMLAEYKQIREQLQSHESIL--------MLCPAGDGGSLSKWEAQFCGPENTPYADFTF 61

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + I++P  YP  PP   F  N I H N+K +TGE+CLD+LK E W+P+++LL  V A+ 
Sbjct: 62  TLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIR 121

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAER 159
            LL EP  DSPLDVD+  +    D+ AYQG+V Y L  R
Sbjct: 122 TLLAEPGVDSPLDVDLAKLYS-VDKQAYQGLVTYRLCSR 159

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  122 bits (307), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 89/155 (57%), Gaps = 10/155 (6%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ +EYR ++    + +           +L+P D  DL+ WEA + GP  TPYE + F +
Sbjct: 4   RVLREYRRLVAAGGAANE---------SNLHPTDPADLTHWEATLEGPQGTPYEGHSFPL 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            + VP  YP  PP + F +  + H NVK  TGE+CLD L    WTPV DL + V AV RL
Sbjct: 55  RVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRL 113

Query: 123 LREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLA 157
           L EP  +SPL++++  + R  D  AY GI+KY LA
Sbjct: 114 LAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLA 148

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  115 bits (289), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 93/160 (58%), Gaps = 11/160 (6%)

Query: 2   SRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFH 61
           SRI KEY+   ++L S           I +L+PI   DL+ WE  I GP H+P+ N+ F 
Sbjct: 3   SRILKEYKDS-RSLQSQ---------YILALDPISTDDLTHWECTIKGPLHSPFANHTFK 52

Query: 62  ILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWR 121
           + ID+P +YP+T P   FE   + H NV   TGEICLDIL   +W+PV+++ + V A+  
Sbjct: 53  LRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVW 111

Query: 122 LLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERER 161
           LL EP   SPL++D+ N++R  D  AY  ++ Y L    +
Sbjct: 112 LLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  113 bits (282), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 97/166 (58%), Gaps = 12/166 (7%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQ- 59
           MSRI KEY  + K L +      P    I  L P+D+ DLS W  +  GPS +P+E ++ 
Sbjct: 1   MSRIVKEYMGLQKRLQT------PEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFEL 54

Query: 60  -FHILIDVPSSYPMT-PPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVH 117
             +I ID+   YP++  PR+ FE   + H NVK  TGEICLD+LK + WTP++ LL  V 
Sbjct: 55  GLNITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVG 112

Query: 118 AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           A+  LL +P  DSPLD+D+  I   AD  AY  IV+Y L E   +R
Sbjct: 113 AIRDLLADPGLDSPLDLDIAQIYD-ADYEAYVQIVRYRLEEARLAR 157

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 84.3 bits (207), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE + +      DDP           L  ++E+D+   +   +GP  TPYE  QF I
Sbjct: 6   RIMKELQAV-----KDDPTAK------IGLEFVNESDIHHLKGSFFGPPGTPYEGGQFII 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 84.0 bits (206), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 72/136 (52%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE + +      DDP  N       +L+ ++E+D+   +    GP  TPYE  +F I
Sbjct: 6   RIMKEMQAV-----KDDPAAN------ITLDFVNESDIHHLKGSFLGPPGTPYEGGRFMI 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 83.2 bits (204), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 77/147 (52%), Gaps = 16/147 (10%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE +      A DDP  N       +L+ + E+D+   +   YGP  TPYE   F +
Sbjct: 6   RIIKEIQA-----AKDDPEAN------ITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIQVPLEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN-IIRCADESAY 148
           L+ P  + P D ++    IR  D+S++
Sbjct: 113 LQSPEPNDPQDAEVAQHFIR--DKSSF 137

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 83.2 bits (204), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 71/136 (52%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE + +      DDP  N       +L  I E+D+ R +    GP  TPY+  +F I
Sbjct: 6   RLMKELQAV-----RDDPAAN------ITLEFISESDIHRLKGSFLGPPETPYQGGRFII 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 71/136 (52%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE + +      DDP  N       SL  + E+D+   +    GP  TPYE  +F +
Sbjct: 6   RIMKELQAV-----KDDPEAN------ISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+ + + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFD-SKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 80.9 bits (198), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 69/136 (50%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE + I      DDP           L  ++E D+   +    GP  TPYEN +F +
Sbjct: 6   RVMKELQAI-----KDDPEAK------VDLQLVNENDIHLLKGSFLGPPGTPYENGKFIV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H NV S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFD-TKVYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 80.9 bits (198), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 69/136 (50%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE + I      DDP           L  ++E D+   +    GP  TPYEN ++ +
Sbjct: 6   RVMKELQAI-----KDDPEAR------VDLQLVNENDIHLLKGSFLGPPGTPYENGKYIV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F Q  + H NV S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKF-QTKVYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 70/135 (51%), Gaps = 13/135 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE + +      DDP  N       +L  + E+D+   +    GP  TPY+  +F +
Sbjct: 6   RIMKEMQAV-----KDDPAAN------INLEFVSESDIHHLKGSFLGPPETPYQGGRFIV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMG 137
           L+ P  + P D ++ 
Sbjct: 113 LQSPEPNDPQDAEVA 127

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 79.7 bits (195), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 71/136 (52%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE + +      DDP  +       +L  ++E+D+   +    GP  TPY+  QF +
Sbjct: 6   RIMKEMQAV-----KDDPEAH------ITLEFVNESDIHHLKGTFQGPPETPYDRGQFVV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H NV S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFD-TKVYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 79.7 bits (195), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 60/106 (56%), Gaps = 2/106 (1%)

Query: 32  LNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKS 91
           L  ++E+D+   +    GPS TPYE  +F + I++P  YP  PP++ F+   + H NV S
Sbjct: 24  LKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVEYPYKPPQMKFD-TKVYHPNVSS 82

Query: 92  ATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
            TG ICLDILK   WTPV  L   + ++  LL+ P  + P D  + 
Sbjct: 83  VTGAICLDILK-NAWTPVITLKSALISLQALLQSPEPNDPQDAQVA 127

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 67/123 (54%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVK 90
           S  P+ + DL  W+A I GPS +PY    F + I  P+ YP  PP++NF    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNIN 80

Query: 91  SATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQG 150
           S +G ICLDILK + W+P   L   + +V  LL +   D PL  ++  I +  D++ Y+ 
Sbjct: 81  S-SGNICLDILK-DQWSPALTLSKVLLSVCSLLTDANPDDPLVPEIAQIYK-TDKAKYEA 137

Query: 151 IVK 153
             K
Sbjct: 138 TAK 140

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 79.0 bits (193), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE + +      DDP  +       +L  + E+D+   +    GP  TPYE  +F +
Sbjct: 6   RIMKEIQAV-----KDDPAAH------ITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 79.0 bits (193), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE + +      DDP  +       +L  + E+D+   +    GP  TPYE  +F +
Sbjct: 6   RIMKEIQAV-----KDDPAAH------ITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 79.0 bits (193), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE + +      DDP  +       +L  + E+D+   +    GP  TPYE  +F +
Sbjct: 6   RIMKEIQAV-----KDDPAAH------ITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 79.0 bits (193), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 67/135 (49%), Gaps = 13/135 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE   +      DDP  N        L  + E D+   +    GP  TPYE  +F +
Sbjct: 6   RIMKEMEAV-----RDDPEAN------IDLEFVSEADIHHLKGSFLGPPETPYEGGKFIV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMG 137
           L+ P  + P D ++ 
Sbjct: 113 LQSPEPNDPQDAEVA 127

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 78.6 bits (192), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE + +      DDP  +       +L  + E+D+   +    GP  TPYE  +F +
Sbjct: 6   RIMKEIQAV-----KDDPAAH------ITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMQFDTK-VYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 77.0 bits (188), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 67/123 (54%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVK 90
           S  P+ + DL  W+A I GPS +PY    F + I  P+ YP  PP++NF    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNIN 80

Query: 91  SATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQG 150
           S +G ICLDILK + W+P   L   + ++  LL +   D PL  ++  I +  D++ Y+ 
Sbjct: 81  S-SGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYK-TDKAKYEA 137

Query: 151 IVK 153
             K
Sbjct: 138 TAK 140

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 77.0 bits (188), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 67/123 (54%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVK 90
           S  P+ + DL  W+A I GPS +PY    F + I  P+ YP  PP++NF    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNIN 80

Query: 91  SATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQG 150
           S +G ICLDILK + W+P   L   + ++  LL +   D PL  ++  I +  D++ Y+ 
Sbjct: 81  S-SGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYK-TDKAKYEA 137

Query: 151 IVK 153
             K
Sbjct: 138 TAK 140

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 77.0 bits (188), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 67/123 (54%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVK 90
           S  P+ + DL  W+A I GPS +PY    F + I  P+ YP  PP++NF    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNIN 80

Query: 91  SATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQG 150
           S +G ICLDILK + W+P   L   + ++  LL +   D PL  ++  I +  D++ Y+ 
Sbjct: 81  S-SGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYK-TDKAKYEA 137

Query: 151 IVK 153
             K
Sbjct: 138 TAK 140

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 78.6 bits (192), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 68/136 (50%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE + +      DDP           L  ++E+D+   +    GP  TPYE  QF +
Sbjct: 6   RIMKELQAV-----KDDPEAR------IELEFVNESDIHHLKGSFLGPPGTPYEGGQFIV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP + F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPMMKFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 72/134 (53%), Gaps = 9/134 (6%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           E  +  +  K YGP  TPYE   + + +++P +YP   P I F  N I H N+  A+G I
Sbjct: 27  EDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 85

Query: 97  CLDILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIV--- 152
           CLD++    W+P++DLL+ V   +  LL+EP    PL+ +  N ++  D+  Y+  V   
Sbjct: 86  CLDVINST-WSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAAN-LQLKDKKVYEEKVREY 143

Query: 153 --KYFLAERERSRY 164
             KY   ER  S++
Sbjct: 144 IDKYATKERYESQF 157

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 69/136 (50%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE + +      DDP          +L  + E+D+   +    GP  TPYEN  F +
Sbjct: 6   RIMKELQAV-----KDDPEAK------ITLEFVIESDIHHLKGSFIGPPGTPYENGAFVV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPQMKFD-TKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 69/136 (50%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE + +      DDP  N       SL+ + E+D+   +    GP  TPY   +F +
Sbjct: 6   RLMKEIQSV-----KDDPDAN------ISLSFVSESDIHHLKGTFLGPPGTPYHGGKFVV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIQVPLEYPFKPPKMQFDTK-VYHPNISSVTGAICLDILK-NSWSPVLTLKTSLISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAK 128

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 60/101 (59%), Gaps = 3/101 (2%)

Query: 34  PIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSAT 93
           P+D+ DL+ W   I GP  TPY   +F I ++ P +YP  PP+I F  + + H NV   +
Sbjct: 32  PVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKF-VSPMWHPNV-DKS 89

Query: 94  GEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
           G ICLDILK E W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNKSPLNA 129

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 75.1 bits (183), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 34  PIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSAT 93
           P+D+ DL+ W   I GP  TPY + +F I ++ P +YP  PP++ F  + + H NV   +
Sbjct: 32  PVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKF-VSPMWHPNV-DKS 89

Query: 94  GEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
           G ICLDILK E W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA 129

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 76.6 bits (187), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 68/136 (50%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI KE + +      DDP          +L  + E+D+   +    GP  TPY+   F +
Sbjct: 6   RIMKEMQAV-----KDDPAAK------INLEFVTESDIHHLKGSFLGPPGTPYDGGLFIV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I+VP  YP  PP++ F+   + H NV S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKFDTK-VYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 75.9 bits (185), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 67/136 (49%), Gaps = 13/136 (9%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE + +      DDP  N       SL  + E+D+   +    GP  TPY    F +
Sbjct: 6   RLMKEIQSV-----KDDPDAN------ISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIV 54

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I VP  YP  PP++ F+   + H N+ S TG ICLDILK   W+PV  L   + ++  L
Sbjct: 55  DIQVPLEYPFKPPKMQFD-TKVYHPNISSVTGAICLDILK-NSWSPVLTLKTSLISLQAL 112

Query: 123 LREPVCDSPLDVDMGN 138
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAK 128

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 74.3 bits (181), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  ++I H NV  A GEICLDIL+
Sbjct: 21  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEIFHPNVY-ANGEICLDILQ 78

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 79  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 60/101 (59%), Gaps = 3/101 (2%)

Query: 34  PIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSAT 93
           P D+ DL+ W   I GP  TPY + +F I ++ P SYP  PP++ F  + + H NV   +
Sbjct: 32  PEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKF-VSPMWHPNV-DMS 89

Query: 94  GEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
           G ICLDILK E W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA 129

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 73.6 bits (179), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 67/123 (54%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVK 90
           S  P+ + DL  W+A I GP+ +PY    F + I  P+ YP  PP+I+F    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNI- 79

Query: 91  SATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQG 150
           +A G ICLDILK + W+P   L   + ++  LL +   D PL  ++ +I +  D S Y+ 
Sbjct: 80  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRSKYEA 137

Query: 151 IVK 153
             +
Sbjct: 138 TAR 140

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 76/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + RITKE    L  L  D P          S  P+ + DL  W+A I GP  +PY    F
Sbjct: 3   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + I  P+ YP  PP+I+F    I H N+ +A G ICLDILK + W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKISFTTK-IYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
            LL +   D PL  ++ +I +  D + Y+   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 139

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 76/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + RITKE    L  L  D P          S  P+ + DL  W+A I GP  +PY    F
Sbjct: 3   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + I  P+ YP  PP+I+F    I H N+ +A G ICLDILK + W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKISFTTK-IYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
            LL +   D PL  ++ +I +  D + Y+   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 139

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 76/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + RITKE    L  L  D P          S  P+ + DL  W+A I GP  +PY    F
Sbjct: 3   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + I  P+ YP  PP+I+F    I H N+ +A G ICLDILK + W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKISFTTK-IYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
            LL +   D PL  ++ +I +  D + Y+   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 139

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 76/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + RITKE    L  L  D P          S  P+ + DL  W+A I GP  +PY    F
Sbjct: 3   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + I  P+ YP  PP+I+F    I H N+ +A G ICLDILK + W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKISFTTK-IYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
            LL +   D PL  ++ +I +  D + Y+   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 139

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GPS TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKF-ISEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 32  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 89

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 90  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 77/151 (50%), Gaps = 16/151 (10%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RI+KE   + K     DPI +       S  P+ + DL  W+A I GP  +PY    F +
Sbjct: 5   RISKELNDLRK-----DPITS------FSAGPVGD-DLFHWQASIMGPPDSPYAGGVFFL 52

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I  P+ YP  PP+I+F    I H N+ +A G ICLDILK + W+P   L   + ++  L
Sbjct: 53  SIHFPTDYPFKPPKISFTTK-IYHPNI-NANGNICLDILK-DQWSPALTLSKVLLSICSL 109

Query: 123 LREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
           L +   D PL  ++ +I +  D S Y+   +
Sbjct: 110 LTDANPDDPLVPEIAHIYKT-DRSKYETTAR 139

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 72/130 (55%), Gaps = 7/130 (5%)

Query: 7   EYRVILKTLASD--DPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILI 64
           E   ++K L S+    +++P  G+  S  P +E DL  W   I GP  TPYE+ +F I +
Sbjct: 9   EGHSVVKRLQSELVQLMMSPTPGL--SAFPNNEDDLRDWSGMIVGPEGTPYESLKFKISL 66

Query: 65  DVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLR 124
             P SYP  PP++ F  + + H NV   +G ICLDILK + W+ V+++   + ++  L  
Sbjct: 67  HFPDSYPYVPPKVKF-ISPMWHPNV-DMSGNICLDILK-DQWSAVYNVQTILLSLQSLFE 123

Query: 125 EPVCDSPLDV 134
           EP   SPL+ 
Sbjct: 124 EPNNSSPLNA 133

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 73.6 bits (179), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 73.6 bits (179), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 73.6 bits (179), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-VSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 65/114 (57%), Gaps = 5/114 (4%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           +++P  G+  S  P  E DL++W   I GP  TPYEN +F + +     YP  PP++ F 
Sbjct: 22  MMSPTPGL--SAFPASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTF- 78

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
            + + H NV   +G ICLDILK + W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 79  VSPMWHPNV-DMSGNICLDILK-DQWSAVYNVQTILLSLQALLEEPNNGSPLNA 130

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKF-LSEMFHPNVY-ANGEICLDILQ 78

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 79  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 73.2 bits (178), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 72.8 bits (177), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQ 131

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 72.8 bits (177), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 66/123 (53%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVK 90
           S  P+ + DL  W+A I GP  +PY    F + I  P+ YP  PP+I+F    I H N+ 
Sbjct: 36  SAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNI- 92

Query: 91  SATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQG 150
           +A G ICLDILK + W+P   L   + ++  LL +   D PL  ++ +I +  D S Y+ 
Sbjct: 93  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRSKYEA 150

Query: 151 IVK 153
             +
Sbjct: 151 TAR 153

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 72.4 bits (176), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 58/101 (57%), Gaps = 3/101 (2%)

Query: 34  PIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSAT 93
           P+D+ DL+ W   I GP  TPY   +F + +  P +YP  PP I F  + + H NV   +
Sbjct: 32  PVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKF-LSPMWHPNV-DKS 89

Query: 94  GEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
           G ICLDILK E W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA 129

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 72.0 bits (175), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKF-LSEMFHPNVY-ANGEICLDILQ 78

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 79  -NRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 72.4 bits (176), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GPS TPYE+  F ++++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPSDTPYEDGTFRLVLEFDEEYPNKPPHVKF-LSEMFHPNVY-ANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 131

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 73.2 bits (178), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 67/118 (56%), Gaps = 4/118 (3%)

Query: 40  LSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLD 99
           +  +  K +GP  TPYEN  + + +++P +YP   P I F  N I H N+  A+G ICLD
Sbjct: 30  MQEFHIKFHGPKDTPYENGVWRLHVELPDNYPFKSPSIGF-VNKIYHPNIDIASGSICLD 88

Query: 100 ILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           ++    W+P++DLL+ V   +  LL+EP    PL+ +    ++  D+  Y+  +K ++
Sbjct: 89  VINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKMYEEKIKEYI 144

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 71.6 bits (174), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 66/123 (53%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVK 90
           S  P+ + DL  W+A I GP  +PY    F + I  P+ YP  PP+I+F    I H N+ 
Sbjct: 22  SAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNI- 78

Query: 91  SATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQG 150
           +A G ICLDILK + W+P   L   + ++  LL +   D PL  ++ +I +  D + Y+ 
Sbjct: 79  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRAKYEA 136

Query: 151 IVK 153
             +
Sbjct: 137 TAR 139

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + RITKE    L  L  D P          S  P+ + D+  W+A I GP  +PY    F
Sbjct: 4   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DIYHWQASIMGPPDSPYAGGVF 51

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + I  P+ YP  PP+I+F    I H N+ +A G ICLDILK + W+P   +   + ++ 
Sbjct: 52  FLSIHFPTDYPFKPPKISFTTK-IYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 108

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
            LL +   D PL  ++ +I +  D   Y+   K
Sbjct: 109 SLLTDANPDDPLVPEIAHIYK-TDRPKYEATAK 140

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 66/123 (53%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVK 90
           S  P+ + DL  W+A I GP+ +PY    F + I  P+ YP  PP+I+F    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNI- 79

Query: 91  SATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQG 150
           +A G ICLDILK + W+P   L   + ++  LL +   D PL  ++ +I +  D   Y+ 
Sbjct: 80  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRPKYEA 137

Query: 151 IVK 153
             +
Sbjct: 138 TAR 140

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 66/123 (53%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVK 90
           S  P+ + DL  W+A I GP+ +PY    F + I  P+ YP  PP+I+F    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNI- 79

Query: 91  SATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQG 150
           +A G ICLDILK + W+P   L   + ++  LL +   D PL  ++ +I +  D   Y+ 
Sbjct: 80  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRPKYEA 137

Query: 151 IVK 153
             +
Sbjct: 138 TAR 140

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 66/123 (53%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVK 90
           S  P+ + DL  W+A I GP+ +PY    F + I  P+ YP  PP+I+F    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNI- 79

Query: 91  SATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQG 150
           +A G ICLDILK + W+P   L   + ++  LL +   D PL  ++ +I +  D   Y+ 
Sbjct: 80  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRPKYEA 137

Query: 151 IVK 153
             +
Sbjct: 138 TAR 140

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 74/151 (49%), Gaps = 16/151 (10%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RITKE    L  +  D P          S  P+ + DL  W+A I GP  +PY    F +
Sbjct: 5   RITKE----LSDMGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVFFL 52

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I  P+ YP  PP+I+F    I H N+ +A G ICLDILK + W+P   L   + ++  L
Sbjct: 53  SIHFPTDYPFKPPKISFTTK-IYHPNI-NANGNICLDILK-DQWSPALTLSKVLLSICSL 109

Query: 123 LREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
           L +   D PL  ++ +I +  D   Y+   +
Sbjct: 110 LTDANPDDPLVPEIAHIYK-TDRPKYEATAR 139

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 76/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + RITKE    L  L  D P          S  P+ + D+  W+A I GP  +PY    F
Sbjct: 4   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DVYHWQASIMGPPDSPYAGGVF 51

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + I  P+ YP  PP+I+F    I H N+ +A G ICLDILK + W+P   +   + ++ 
Sbjct: 52  FLSIHFPTDYPFKPPKISFTTK-IYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 108

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
            LL +   D PL  ++ ++ +  D + Y+   K
Sbjct: 109 SLLTDANPDDPLVPEIAHLYK-TDRAKYEATAK 140

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 70/126 (55%), Gaps = 7/126 (5%)

Query: 40  LSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLD 99
           +  +  K  GP  TPYEN  + + +++P +YP   P I F  N I H N+  A+G ICLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 87

Query: 100 ILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL-- 156
           ++    W+P++DL++ V   +  LL+EP    PL+ +    ++  D+  Y+  +K ++  
Sbjct: 88  VINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYIDK 145

Query: 157 -AERER 161
            A RE+
Sbjct: 146 YATREK 151

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 74/151 (49%), Gaps = 16/151 (10%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           RITKE    L  +  D P          S  P+ + DL  W+A I GP  +PY    F +
Sbjct: 6   RITKE----LSDMGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVFFL 53

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122
            I  P+ YP  PP+I+F    I H N+ +A G ICLDILK + W+P   L   + ++  L
Sbjct: 54  SIHFPTDYPFKPPKISFTTK-IYHPNI-NANGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 123 LREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
           L +   D PL  ++ +I +  D   Y+   +
Sbjct: 111 LTDANPDDPLVPEIAHIYK-TDRPKYEATAR 140

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 72.0 bits (175), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ TPYE+  F +L++    YP+  P + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 70/130 (53%), Gaps = 5/130 (3%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           E  +  +  K +GP  TPYE   + + +++P +YP   P I F  N I H N+ +A+G I
Sbjct: 27  EDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 85

Query: 97  CLDILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAY-QGIVKY 154
           CLD++    W+P++DLL+ V   +  LL+EP    PL+ +    ++  D+  Y Q I +Y
Sbjct: 86  CLDVINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKDKDMYEQKIHEY 143

Query: 155 FLAERERSRY 164
                 + +Y
Sbjct: 144 INKYATKEKY 153

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + RITKE    L  L  D P          S  P+ + D+  W+A I GP  +PY    F
Sbjct: 4   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DIYHWQASIMGPPDSPYAGGVF 51

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + I  P+ YP  PP+I+F    I H N+ +A G ICLDILK + W+P   +   + ++ 
Sbjct: 52  FLSIHFPTDYPFKPPKISFTTK-IYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 108

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
            LL +   D PL  ++ ++ +  D   Y+   K
Sbjct: 109 SLLTDANPDDPLVPEIAHLYK-TDRPKYEATAK 140

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + RITKE    L  L  D P          S  P+ + D+  W+A I GP  +PY    F
Sbjct: 3   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DIYHWQASIMGPPDSPYAGGVF 50

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + I  P+ YP  PP+I F    I H N+ +A G ICLDILK + W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKIAFTTK-IYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
            LL +   D PL  ++ +I +  D + Y+   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYK-TDRAKYEATAR 139

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 76/153 (49%), Gaps = 16/153 (10%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + RITKE    L  L  D P          S  P+ + D+  W+A I GP  +PY    F
Sbjct: 4   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DVYHWQASIMGPPDSPYAGGVF 51

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + I  P+ YP  PP+I+F    I H N+ +A G ICLDILK + W+P   +   + ++ 
Sbjct: 52  FLSIHFPTDYPFKPPKISFTTK-IYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 108

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
            LL +   D PL  ++ ++ +  D + Y+   +
Sbjct: 109 SLLTDANPDDPLVPEIAHLYK-TDRAKYEATAR 140

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 64/114 (56%), Gaps = 5/114 (4%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           +++P  G+  S  P DE DL+ W A I GP  TPY+  +F +      SYP  PP + F 
Sbjct: 29  MMSPTPGL--SAFPNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKF- 85

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
            + + H NV   +G ICLDILK + W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 86  ISPMWHPNV-DMSGNICLDILK-DQWSAVYNVETILLSLQALLEEPNNSSPLNA 137

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 72.0 bits (175), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 73/134 (54%), Gaps = 9/134 (6%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           + ++  +  K +GP  TPYE   + + +++P +YP   P I F  N I H N+ +A+G I
Sbjct: 26  DDNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 84

Query: 97  CLDILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQG----- 150
           CLD++    W+P++DL++ V   +  LL+EP    PL+ +    ++  ++  Y+      
Sbjct: 85  CLDVINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKNKELYEQKIREF 142

Query: 151 IVKYFLAERERSRY 164
           I KY   ER RS +
Sbjct: 143 IDKYATEERYRSMF 156

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 72.0 bits (175), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 68/121 (56%), Gaps = 4/121 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           ++  +  K  GP  TPYEN  + + +++P +YP   P I F  N I H N+  A+G ICL
Sbjct: 46  NMQEFYIKFCGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 104

Query: 99  DILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLA 157
           D++    W+P++DLL+ V   +  LL+EP    PL+ +    +   D+  Y+  +K ++A
Sbjct: 105 DVINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELKDKKLYEERIKEYIA 162

Query: 158 E 158
           +
Sbjct: 163 K 163

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 72.0 bits (175), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 66/123 (53%), Gaps = 5/123 (4%)

Query: 31  SLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVK 90
           S  P+ + DL  W+A I GP  +PY    F + I  P+ YP  PP+I+F    I H N+ 
Sbjct: 111 SAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNI- 167

Query: 91  SATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQG 150
           +A G ICLDILK + W+P   +   + ++  LL +   D PL  ++ +I +  D + Y+ 
Sbjct: 168 NANGNICLDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRAKYEA 225

Query: 151 IVK 153
             K
Sbjct: 226 TAK 228

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 70.5 bits (171), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 56/99 (56%), Gaps = 3/99 (3%)

Query: 43  WEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK 102
           W A I GP+ T YE+  F +L++    YP  PP + F  +++ H NV  A GEICLDIL+
Sbjct: 36  WNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKF-LSEMFHPNV-YANGEICLDILQ 93

Query: 103 PEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 71.6 bits (174), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 66/118 (55%), Gaps = 4/118 (3%)

Query: 40  LSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLD 99
           +  +  K  GP  TPYEN  + + +++P +YP   P I F  N I H N+  A+G ICLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 87

Query: 100 ILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           ++    W+P++DL++ V   +  LL+EP    PL+ +    ++  D+  Y+  +K ++
Sbjct: 88  VINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 71.2 bits (173), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 66/118 (55%), Gaps = 4/118 (3%)

Query: 40  LSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLD 99
           +  +  K  GP  TPYEN  + + +++P +YP   P I F  N I H N+  A+G ICLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 87

Query: 100 ILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           ++    W+P++DL++ V   +  LL+EP    PL+ +    ++  D+  Y+  +K ++
Sbjct: 88  VINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 69.7 bits (169), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 74/150 (49%), Gaps = 16/150 (10%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + RITKE    L  L  D P          S  P+ + D+  W+A I GP  +PY    F
Sbjct: 3   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DVYHWQASIMGPPDSPYAGGVF 50

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120
            + I  P+ YP  PP+I F    I H N+ +A G ICLDILK + W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKIAFTTK-IYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQG 150
            LL +   D PL  ++ +I +  D + Y+ 
Sbjct: 108 SLLTDANPDDPLVPEIAHIYK-TDRAKYEA 136

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 71.2 bits (173), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 69/128 (53%), Gaps = 7/128 (5%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           + ++  +  K +GP  TPYE   + + +++P +YP   P I F  N I H N+ +A+G I
Sbjct: 26  DDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 84

Query: 97  CLDILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNII----RCADESAYQGI 151
           CLD++    W+P++DLL+ V   +  LL+EP    PL+ +   +     +  +E   + I
Sbjct: 85  CLDVINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKNPQMYEEKIQEYI 143

Query: 152 VKYFLAER 159
            KY   ER
Sbjct: 144 DKYATEER 151

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 70.1 bits (170), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 64/114 (56%), Gaps = 5/114 (4%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           I++P  G+  S  P  E +L++W   I GP  +PY   +F I +  P  YP  PP++ F 
Sbjct: 25  IMSPTPGL--SAFPDHEENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKF- 81

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
            + + H NV   +G ICLD+LK E W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 82  VSPMWHPNV-DLSGNICLDVLK-EKWSAVYNVQTILLSLQALLGEPNNSSPLNA 133

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 70.9 bits (172), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 69/130 (53%), Gaps = 7/130 (5%)

Query: 40  LSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLD 99
           +  +  K +GP  TPYE   + + +++P +YP   P I F  N I H N+ +A+G ICLD
Sbjct: 17  MQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICLD 75

Query: 100 ILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNI----IRCADESAYQGIVKY 154
           ++    W+P++DL++ V   +  LL+EP    PL+ +   +        +E   + I KY
Sbjct: 76  VINST-WSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKNKELYEEKIQEYIDKY 134

Query: 155 FLAERERSRY 164
             +ER  + +
Sbjct: 135 ATSERYEAMF 144

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 70.5 bits (171), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 68/119 (57%), Gaps = 4/119 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           ++  +  K +GP  TPYE+  + + +++P +YP   P I F  N I H N+  A+G ICL
Sbjct: 28  NMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDVASGSICL 86

Query: 99  DILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           D++    W+P++DL++ V   +  LL+EP    PL+ +    ++  D+  Y+  +K ++
Sbjct: 87  DVIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKVLYEQKIKEYI 143

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 71.2 bits (173), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 68/119 (57%), Gaps = 4/119 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           ++  +  K  GP  TPYEN  + + +++P +YP   P I F  N I H N+  A+G ICL
Sbjct: 29  NMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 87

Query: 99  DILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           D++    W+P++DLL+ V   +  LL+EP    PL+ +    ++  D++ Y+  +K ++
Sbjct: 88  DVINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLYEQKIKEYI 144

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 69.3 bits (168), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 67/114 (58%), Gaps = 5/114 (4%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           +++P  G+  S  P +E DL++W   I GP  TPYE  +F I +  P SYP T PR+ F 
Sbjct: 27  MMSPSPGL--SAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTF- 83

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
            + + H NV   +G ICLDILK + W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 84  VSPMWHPNV-DMSGNICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNA 135

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 70.5 bits (171), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 66/118 (55%), Gaps = 4/118 (3%)

Query: 40  LSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLD 99
           +  +  K  GP  TPYEN  + + +++P +YP   P I F  N I H N+  A+G ICLD
Sbjct: 28  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 86

Query: 100 ILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           ++    W+P++DL++ +   +  LL+EP    PL+ +    ++  D+  Y+  +K ++
Sbjct: 87  VINST-WSPLYDLINILEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 142

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 70.5 bits (171), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 67/119 (56%), Gaps = 4/119 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           ++  +  K +GP  TPYE   + + +++P +YP   P I F  N I H N+  A+G ICL
Sbjct: 28  NMQEFFIKFFGPDETPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 86

Query: 99  DILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           D++    W+P++DL++ V   +  LL+EP    PL+ +    ++  D+  Y+  +K ++
Sbjct: 87  DVIN-STWSPLYDLINIVEWMIPGLLKEPNGTDPLNNEAAG-LQLRDKKLYEEKIKEYI 143

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 69.3 bits (168), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 74/145 (51%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KEY+ +++         +P  GI+ +  P  E++L  W+  I GP  TPYE   F+ 
Sbjct: 8   RLLKEYQQLIR---------DPPPGILAA--PKSESNLFLWDCLIQGPPDTPYEGGIFNA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDWTPVW 110
            +D P  YP++PP++ F  + ILH N+    GE+C+ I            L  E W+PV 
Sbjct: 57  RLDFPKDYPLSPPKLTFTPS-ILHPNIYH-NGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  +VD
Sbjct: 115 SVEKILLSVMSMLSEPNIESGANVD 139

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 70.1 bits (170), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 68/121 (56%), Gaps = 4/121 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           ++  +  K +GP  TPYE   + + +++P +YP   P I F  N I H N+ +A+G ICL
Sbjct: 16  NMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSICL 74

Query: 99  DILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLA 157
           D++    W+P++DLL+ +   +  LL+EP    PL+ +    ++   +  Y+  ++ F+ 
Sbjct: 75  DVINSA-WSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAA-TLQLKSKELYERKIREFID 132

Query: 158 E 158
           +
Sbjct: 133 Q 133

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 70.1 bits (170), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 67/119 (56%), Gaps = 4/119 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           ++  +  K +GP  TPYE   + + +++P +YP   P I F  N I H N+  A+G ICL
Sbjct: 30  NMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 88

Query: 99  DILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           D++    W+P++DLL+ +   +  LL+EP    PL+ +    ++  D+  Y+  +K ++
Sbjct: 89  DVINST-WSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIYEEKIKEYI 145

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 68.6 bits (166), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 75/151 (49%), Gaps = 25/151 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KEY+ +++    + P      GI+    P DE ++  W+  I GP  TPYEN  F+ 
Sbjct: 10  RLLKEYQQLIR----ESP-----PGIVAG--PSDENNMFEWDCLISGPPETPYENGVFNA 58

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDWTPVW 110
            +  P  YP++PP++ F  + +LH N+    GE+C+ I            L  E W+PV 
Sbjct: 59  TLLFPKDYPLSPPKLTFTPS-LLHPNIY-PNGEVCISILHSPGDDPNMYELAEERWSPVQ 116

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
            +   + +V  +L EP  +S  ++D   + R
Sbjct: 117 SVEKILLSVMSMLSEPNIESGANIDASILYR 147

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 69.3 bits (168), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 71/133 (53%), Gaps = 7/133 (5%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           + ++  +  K  GP  TPYE   + + +++P +YP   P I F  N I H N+ +A+G I
Sbjct: 26  DDNMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 84

Query: 97  CLDILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNII----RCADESAYQGI 151
           CLD++    W+P++DL++ V   +  LL+EP    PL+ +   +     +  +E   + I
Sbjct: 85  CLDVIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKNPKMYEEKIQEYI 143

Query: 152 VKYFLAERERSRY 164
            KY  +E+   ++
Sbjct: 144 DKYATSEKYDQQF 156

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 68.6 bits (166), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 73/145 (50%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE    L+ L  D P      GI+ S  PID+++L +W+  I GP  + YE   F+ 
Sbjct: 8   RLLKE----LEKLTKDSP-----EGILAS--PIDDSNLFQWDCLIMGPPDSCYEGGVFNA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKP------------EDWTPVW 110
            +D P  YP+ PP++ F Q  ILH N+    GE+C+ IL              E W+PV 
Sbjct: 57  RLDFPKDYPLNPPKLTF-QPSILHPNIY-PNGEVCISILHSPGSDPNMYEHECERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEMILLSVMSILSEPNIESGANID 139

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 68.2 bits (165), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 72/145 (49%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE    L+ LA D P      GI+    P  E +L  W+  I GP  +PYE   F+ 
Sbjct: 8   RLLKE----LQQLARDSP-----EGIVA--GPKSEDNLFLWDCLITGPPDSPYEGGVFNA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDWTPVW 110
           +++ P  YP++PPR+ F  + ILH N+    GE+C+ I            L  E W+PV 
Sbjct: 57  MLEFPKDYPLSPPRLTFTPS-ILHPNIY-PNGEVCISILHSPGEDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVTSMLSEPNVESGANID 139

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 68.9 bits (167), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           ++  +  K  GP  TPYE   + + +++P +YP   P I F  N ILH N+  A+G ICL
Sbjct: 16  NMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKILHPNIDVASGSICL 74

Query: 99  DILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           D++    W+P++DL + V   +  LL+EP    PL+ +    ++  D+  Y+  +K ++
Sbjct: 75  DVINST-WSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 131

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 68.9 bits (167), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           ++  +  K +GP  TPYE   + + +++P +YP   P I F  N I H N+  A+G ICL
Sbjct: 30  NMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICL 88

Query: 99  DILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           D++    W+P++DL + V   +  LL+EP    PL+ +    ++  D+  Y+  +K ++
Sbjct: 89  DVINST-WSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 145

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 68.9 bits (167), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 65/118 (55%), Gaps = 4/118 (3%)

Query: 40  LSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLD 99
           +  +  K +GP  TPYE   + + +++P +YP   P I F  N I H N+  A+G ICLD
Sbjct: 52  MQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLD 110

Query: 100 ILKPEDWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           ++    W+P++DLL+ V   +  LL+EP    PL+ +    +   D+  Y+  ++ ++
Sbjct: 111 VINST-WSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LELRDKKLYEEKIREYI 166

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 66.6 bits (161), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 71/145 (48%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE + ++K  ++         GI+    P  E DL  W+  I GP  TPYE   F+ 
Sbjct: 8   RLLKELQQLMKDSST---------GIVA--GPRSENDLFVWDCLIQGPPDTPYEGGIFNA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDWTPVW 110
            ++ P  YP++PP++ F  + ILH N+    GE+C+ I            L  E W+PV 
Sbjct: 57  KLEFPKDYPLSPPKLTFTPS-ILHPNIYH-NGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  +VD
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANVD 139

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 73/145 (50%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE + +LK    D P      GI+    P++E ++  W+  I GP  +PYE   F+ 
Sbjct: 8   RLMKEMQQLLK----DCP-----EGIVAG--PVNEENMFLWDCLIAGPPDSPYEGGIFNA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL------------KPEDWTPVW 110
            +  P+ YP++PP++ F  + ILH NV    GE+C+ IL              E W+PV 
Sbjct: 57  RLQFPTDYPLSPPKLTFTPS-ILHPNVY-PNGEVCISILHAPGEDPNMYEEASERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANID 139

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 65.9 bits (159), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 71/145 (48%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE + +L+   S D IV           P+ E +L  W+  I GP+ +PYE   F+ 
Sbjct: 8   RLMKELQQLLRD--SPDGIV---------AGPVSEDNLFLWDCLIEGPADSPYEGGVFNA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL------------KPEDWTPVW 110
            +  P  YP++PP++ F  + ILH NV    GE+C+ IL              E W+PV 
Sbjct: 57  RLQFPRDYPLSPPKLTFTPS-ILHPNVY-PNGEVCISILHAPGEDPNMYEEASERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANID 139

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 65.1 bits (157), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 67/114 (58%), Gaps = 5/114 (4%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           +++P  G+  S  P DE DL++W   I GP  TPYE  +F I ++   +YP T P++ F 
Sbjct: 27  MLSPSPGL--SAFPEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRF- 83

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
            + + H NV   +G ICLDILK + W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 84  VSPMWHPNV-DMSGNICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNA 135

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 65.1 bits (157), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 71/145 (48%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KEY+ +++    D P      GI+    P +E DL  W+  I GP  TPYE+  F+ 
Sbjct: 8   RLFKEYQQLIR----DSP-----PGIVAG--PANENDLFLWDCLIQGPPDTPYEHGVFNA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDWTPVW 110
            +  P  YP++PP + F    ILH N+    GE+C+ I            L  E W+PV 
Sbjct: 57  QLRFPRDYPLSPPTLTFTPA-ILHPNIY-PNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANID 139

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 65.1 bits (157), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 71/145 (48%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE + +++         +P  GI+    P DE+DL  W+  + GP  +PYE   F  
Sbjct: 8   RLLKELQQLMR---------DPPPGIV--AGPQDESDLFLWDCLVQGPPDSPYEGGVFEA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDWTPVW 110
            +  P  YP++PP++ F  + +LH NV    GE+C+ I            L  E W+PV 
Sbjct: 57  QLRFPRDYPLSPPKLTFVPS-VLHPNVY-PNGEVCISILHAPGEDPNQYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVVSMLSEPNVESGANID 139

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 64.3 bits (155), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 75/149 (50%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRVI--LKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENY 58
           MS+ T + R++  L+ L  D P      GI+    P  E ++ +W+  + GP  +PYE  
Sbjct: 1   MSK-TAQKRLLKELQQLMKDSP-----PGIVAG--PKTEDNIFQWDCLVQGPPDSPYEGG 52

Query: 59  QFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDW 106
            F+  +D P  YP++PP++ F  + ILH N+    GE+C+ I            L  E W
Sbjct: 53  VFNAQLDFPKDYPLSPPKLTFTPS-ILHPNI-YPNGEVCISILHSPGEDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNIESGANID 139

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 63.9 bits (154), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 76/149 (51%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRVI--LKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENY 58
           MSR T + R++  L+ L  D P      GII +  P  E+DL  W+  + GP  TPY   
Sbjct: 1   MSR-TAQKRLLKELQQLTRDPP-----PGIIAA--PKTESDLFTWDCLVAGPPDTPYAGG 52

Query: 59  QFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILK-----------PED-W 106
            F+  +  P+ YP++PP + F  + ILH NV    GE+C+ IL            PE+ W
Sbjct: 53  LFNCQLQFPTDYPLSPPTLTFTPS-ILHPNVY-PNGEVCISILHAPGSDPNMYELPEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVVSMLSEPNVESGANID 139

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 70/145 (48%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE    L+ L  D P      GI+    P +E +L  W+  + GP  T YE   F+ 
Sbjct: 8   RLLKE----LQQLNKDSP-----PGIVAG--PANENNLFVWDCLVQGPPDTAYEGGIFNA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDWTPVW 110
            +D P  YP++PP++ F  + ILH N+    GE+C+ I            L  E W+PV 
Sbjct: 57  RLDFPKDYPLSPPKLTFTPS-ILHPNIY-PNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVMSMLSEPNIESGANID 139

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 62.4 bits (150), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 66/114 (57%), Gaps = 5/114 (4%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           +++P  G+  S  P  E DL++W   I GP  TPYE  +F I ++   +YP T P++ F 
Sbjct: 27  MMSPSPGL--SAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRF- 83

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDV 134
            + + H NV   +G ICLDILK + W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 84  VSPMWHPNV-DMSGNICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNA 135

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 62.4 bits (150), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 71/145 (48%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE + +LK    D P      GI+    P  E +L  W+  I GP  +PY+   F+ 
Sbjct: 8   RLFKELQQLLK----DSP-----EGIVA--GPRSEDNLFLWDCLISGPPDSPYQGGVFNA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDWTPVW 110
            ++ P  YP++PP++ F  + ILH N+    GE+C+ I            L  E W+PV 
Sbjct: 57  TLEFPKDYPLSPPKLLFTPS-ILHPNIY-PNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANID 139

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 62.4 bits (150), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 71/145 (48%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE + +LK    D P      GI+    P  E +L  W+  I GP  +PY+   F+ 
Sbjct: 8   RLFKELQQLLK----DSP-----EGIVA--GPKSEDNLFVWDCLISGPPDSPYQGGVFNA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDWTPVW 110
            ++ P  YP++PP++ F  + ILH N+    GE+C+ I            L  E W+PV 
Sbjct: 57  TLEFPKDYPLSPPKLLFTPS-ILHPNIY-PNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVMSMLSEPNVESGANID 139

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 62.0 bits (149), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           E +L  ++  I GP  +PYEN  F++ + +P  YPM  P++ F    I H N+    G I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRF-LTKIYHPNI-DKLGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 61.6 bits (148), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 68/134 (50%), Gaps = 6/134 (4%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           I +P  GI  +  P D+ +L  +E  + GP  +PYEN  F + + +P  YPM  P++ F 
Sbjct: 16  ITDPVPGI--TAEPHDD-NLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRF- 71

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNII 140
              I H N+    G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+    
Sbjct: 72  LTKIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDW 129

Query: 141 RCADESAYQGIVKY 154
              +E+A Q   K+
Sbjct: 130 IKDEEAAKQTAKKW 143

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 61.6 bits (148), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 3/101 (2%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           E +L  ++  I GP  +PYEN  F + + +P  YPM  P++ F    I H N+    G I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-NNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 61.6 bits (148), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 4/121 (3%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           E +L  ++  I GP  + YEN  F + + +P  YPM PP++ F    I H N+    G I
Sbjct: 29  EDNLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156
           CLD+LK  +W+P   +   + ++  LL  P  + PL  D+      ADE A     K++ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSIQALLATPNPNDPLANDVAEDW-IADEDAAIAKAKHWT 144

Query: 157 A 157
           A
Sbjct: 145 A 145

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 61.6 bits (148), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 74/149 (49%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRVI--LKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENY 58
           MS+ T + R++  L+ L  D P      GI+    P  E ++  W+  I GP  TPY + 
Sbjct: 1   MSK-TAQKRLLKELQQLIKDSP-----PGIVAG--PKSENNIFVWDCLIQGPPDTPYADG 52

Query: 59  QFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDW 106
            F+  ++ P  YP++PP++ F  + ILH N+    GE+C+ I            L  E W
Sbjct: 53  VFNAKLEFPKDYPLSPPKLTFTPS-ILHPNI-YPNGEVCISILHSPGDDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNIESGANID 139

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 61.6 bits (148), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 74/149 (49%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRVI--LKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENY 58
           MS+ T + R++  L+ L  D P      GI+    P  E ++  W+  I GP  TPY + 
Sbjct: 1   MSK-TAQKRLLKELQQLIKDSP-----PGIVAG--PKSENNIFVWDCLIQGPPDTPYADG 52

Query: 59  QFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDW 106
            F+  ++ P  YP++PP++ F  + ILH N+    GE+C+ I            L  E W
Sbjct: 53  VFNTKLEFPKDYPLSPPKLTFTPS-ILHPNI-YPNGEVCISILHSPGDDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNIESGANID 139

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 61.2 bits (147), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           + +P  GI  S  P D+ +L  ++  I GP  +PYEN  F + + +P  YPM  P++ F 
Sbjct: 16  VSDPVPGI--SAEPHDD-NLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRF- 71

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
              I H N+    G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 72  LTKIYHPNIDR-LGRICLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 3/101 (2%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           E +L  ++  I GP  +PYEN  F + + +P  YPM  P++ F    I H N+    G I
Sbjct: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 61.2 bits (147), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 74/149 (49%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRVI--LKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENY 58
           MS+ T + R++  L+ L  D P      GI+    P  E ++  W+  I GP  TPY + 
Sbjct: 1   MSK-TAQKRLLKELQQLIKDSP-----PGIVAG--PKSENNIFVWDCLIQGPPDTPYADG 52

Query: 59  QFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDW 106
            F+  ++ P  YP++PP++ F  + ILH N+    GE+C+ I            L  E W
Sbjct: 53  IFNAKLEFPKDYPLSPPKLTFTPS-ILHPNI-YPNGEVCISILHSPGDDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNIESGANID 139

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 61.2 bits (147), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 74/149 (49%), Gaps = 24/149 (16%)

Query: 1   MSRITKEYRVI--LKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENY 58
           MS+ T + R++  L+ L  D P      GI+    P  E ++  W+  I GP  TPY + 
Sbjct: 1   MSK-TAQKRLLKELQQLIKDSP-----PGIVAG--PKSENNIFIWDCLIQGPPDTPYADG 52

Query: 59  QFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDW 106
            F+  ++ P  YP++PP++ F  + ILH N+    GE+C+ I            L  E W
Sbjct: 53  VFNAKLEFPKDYPLSPPKLTFTPS-ILHPNI-YPNGEVCISILHSPGDDPNMYELAEERW 110

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVD 135
           +PV  +   + +V  +L EP  +S  ++D
Sbjct: 111 SPVQSVEKILLSVMSMLSEPNIESGANID 139

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 59.7 bits (143), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 4/105 (3%)

Query: 49  GPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTP 108
           GP  +PY    F + I  P+ YP  PP+I+F    I H N+ +A G ICLDILK + W+P
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNI-NANGNICLDILK-DQWSP 58

Query: 109 VWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
              L   + ++  LL +   D PL  ++ +I +  D   Y+   +
Sbjct: 59  ALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRPKYEATAR 102

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 70/145 (48%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE    L+ L  D P      GI+    P +E +L  W+  + GP  T YE   F+ 
Sbjct: 8   RLLKE----LQQLTKDSP-----PGIVAC--PKNENNLFIWDCLVQGPPDTAYEGGIFNA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI------------LKPEDWTPVW 110
            ++ P  YP++PP++ F  + ILH N+    GE+C+ I            L  E W+PV 
Sbjct: 57  RLEFPKDYPLSPPKLTFTPS-ILHPNIY-PNGEVCISILHSPGDDPNMYELAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SIEKILLSVMSMLSEPNIESGANID 139

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (52%), Gaps = 3/102 (2%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           E +L  ++  I GP  +PYE+  F + + +P  YPM PP++ F    I H N+    G I
Sbjct: 29  EDNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGN 138
           CLD+LK  +W+P   +   + ++  LL  P  + PL  D+  
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSIQALLATPNPNDPLANDVAK 127

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           + +P  GI  +  P D+ +L  +E  I GP  +PYEN  F + + +P  YPM  P++ F 
Sbjct: 16  VSDPVPGI--TAEPHDD-NLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRF- 71

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
              I H N+    G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 72  LTKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 69/145 (47%), Gaps = 25/145 (17%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+ KE    L+ L  D P      GI+    P  + +L  W+  I GP  TPY    F+ 
Sbjct: 8   RLYKE----LQQLIKDSP-----PGIVA--GPKSDDNLFVWDCLIQGPPDTPYAGGVFNA 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL------------KPEDWTPVW 110
            ++ P  YP++PP++ F  + ILH N+    GE+C+ IL              E W+PV 
Sbjct: 57  QLEFPKDYPLSPPKLTFTPS-ILHPNIY-PNGEVCISILHSPGDDPNMYESAEERWSPVQ 114

Query: 111 DLLHCVHAVWRLLREPVCDSPLDVD 135
            +   + +V  +L EP  +S  ++D
Sbjct: 115 SVEKILLSVMSMLSEPNIESGANID 139

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 59.7 bits (143), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 53/101 (52%), Gaps = 3/101 (2%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           E +L  ++  I GP  +PYE+  F + + +P  YPM  P++ F    I H N+    G I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 59.7 bits (143), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 53/101 (52%), Gaps = 3/101 (2%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           E +L  +   + GP+ +PYEN  F + + +P  YPM  P++ F    I H N+    G I
Sbjct: 29  EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRF-LTKIYHPNIDR-LGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 59.3 bits (142), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 66/131 (50%), Gaps = 13/131 (9%)

Query: 9   RVILKT--LASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDV 66
           R+I +T  LASD     P  GI  S  P  E +L  +   I GP  +PYEN  F + + +
Sbjct: 7   RIIKETERLASD-----PVPGI--SAEP-HEDNLRYFAVTIEGPEESPYENGVFELELYL 58

Query: 67  PSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREP 126
           P  YPM  P++ F    I H N+    G ICLD+LK  +W+P   +   + ++  LL  P
Sbjct: 59  PDDYPMEAPKVRF-LTRIYHPNIDR-LGRICLDVLK-NNWSPALQIRTVLLSIQALLASP 115

Query: 127 VCDSPLDVDMG 137
             + PL  D+ 
Sbjct: 116 NPNDPLANDVA 126

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 59.3 bits (142), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 53/101 (52%), Gaps = 3/101 (2%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           E +L  ++  I GPS +PYE   F + + +P  YPM  P++ F    I H N+    G I
Sbjct: 29  EDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRF-LTKIYHPNI-DRLGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 60.1 bits (144), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 4/107 (3%)

Query: 47  IYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDW 106
           I  P    Y+N  F   ++   +YPM PP++   +N I H N+    G++CL+IL+ EDW
Sbjct: 74  IISPDEGYYKNGHFRFSLEFNDNYPMEPPKV-VCRNRIYHPNI-DVQGKVCLNILR-EDW 130

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVK 153
           +P  DL   +  +  L  EP    PL+ D   +    D +A+   V+
Sbjct: 131 SPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVF-SKDSNAFAKFVR 176

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 58.5 bits (140), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           I +P  GI  +  P D+ +L  +   + GP+ +PYEN  F + + +P  YPM  P++ F 
Sbjct: 16  ISDPVPGI--TAEPHDD-NLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRF- 71

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
              I H N+    G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 72  LTKIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 57.8 bits (138), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 6/117 (5%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           I +P  GI  +  P D+ +L  ++  I GP  +PYE   F + + +P  YPM  P++ F 
Sbjct: 12  ISDPVPGI--TAEPHDD-NLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRF- 67

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
              I H N+    G ICLDILK  +W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 68  LTKIYHPNI-DRLGRICLDILK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 57.0 bits (136), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           DL RWEA I G + T +    + I I+ P  YP  PP++ F +    H NV   +G ICL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMFPKG-FYHPNV-YPSGTICL 59

Query: 99  DILKPE-DWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL  E DW P   L   V  V  LL  P  +SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           + +P  GI  +  P D+ +L  ++  I GP  +PYE+  F + + +P  YPM  P++ F 
Sbjct: 6   VSDPVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRF- 61

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
              I H N+    G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 62  LTKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           + +P  GI  +  P D+ +L  ++  I GP  +PYE+  F + + +P  YPM  P++ F 
Sbjct: 16  VSDPVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRF- 71

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
              I H N+    G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 72  LTKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           + +P  GI  +  P D+ +L  ++  I GP  +PYE+  F + + +P  YPM  P++ F 
Sbjct: 6   VSDPVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRF- 61

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
              I H N+    G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 62  LTKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 56.6 bits (135), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           + +P  GI  +  P D+ +L  ++  I GP  +PYE+  F + + +P  YPM  P++ F 
Sbjct: 6   VSDPVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRF- 61

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
              I H N+    G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 62  LTRIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 56.6 bits (135), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 37  ETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           E +L  +   I GP  + YEN  F + + +P  YPM  P++ F    I H N+    G I
Sbjct: 29  EDNLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRF-LTKIYHPNI-DRLGRI 86

Query: 97  CLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           CLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 87  CLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 56.6 bits (135), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 23  NPYRGIIRSLNPIDET-DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQ 81
           +P+    + L   D T DL  WEA I G + T + +  + I I+ P  YP  PP++ F  
Sbjct: 20  HPFSFFAKPLKKADGTMDLQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKFPA 79

Query: 82  NDILHCNVKSATGEICLDIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
               H N+   +G +CL IL + +DW P   L   V  V  LL  P  +SP
Sbjct: 80  G-FYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 56.6 bits (135), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 14/116 (12%)

Query: 50  PSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPV 109
           P    Y+  +F        +YP+ PP++    N I H N+    G+ICL+IL+ EDW+P 
Sbjct: 71  PDEGFYKGGKFRFTATFLETYPIDPPKV-ICNNKIFHPNI-DPHGKICLNILR-EDWSPA 127

Query: 110 WDLLHCVHAVWRLLREPVCDSPLD-----------VDMGNIIRCADESAYQGIVKY 154
            DL   V  +  L +EP  + PL+           ++ GN++R A   A  G   Y
Sbjct: 128 LDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDKLEFGNLVRLAMSGAMVGSTYY 183

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 55.8 bits (133), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           DL +WEA I G   T +    + I ++ P+ YP  PP++ F      H NV   +G ICL
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKFPAG-FYHPNV-YPSGTICL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL + +DW P   L   V  V  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           DL +WEA I G   T +    + I ++ P+ YP  PP++ F      H NV   +G ICL
Sbjct: 37  DLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKFPAG-FYHPNV-YPSGTICL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL + +DW P   L   V  V  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           DL +WEA I G   T +    + I ++ P+ YP  PP++ F      H NV   +G ICL
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKFPAG-FYHPNV-YPSGTICL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL + +DW P   L   V  V  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           DL +WEA I G   T +    + I ++ P+ YP  PP++ F      H NV   +G ICL
Sbjct: 37  DLQKWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKFPAG-FYHPNV-YPSGTICL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL + +DW P   L   V  V  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 53/111 (47%), Gaps = 9/111 (8%)

Query: 22  VNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQ 81
             P +G   +LN      L +WEA I G   T +++  F I ++ P  YP  PP++ F  
Sbjct: 26  AKPTKGPDGTLN------LQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKFPA 79

Query: 82  NDILHCNVKSATGEICLDIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
               H N+   +G +CL IL + +DW P   L   V  V  LL  P  +SP
Sbjct: 80  G-FYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 54.7 bits (130), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 60/117 (51%), Gaps = 6/117 (5%)

Query: 21  IVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFE 80
           + +P  GI  +  P D+ +L  +   I GP  +PYE+  F + + +P  YPM  P++ F 
Sbjct: 16  VSDPVPGI--TAEPHDD-NLRYFSVTIEGPEGSPYEHGIFDLELFLPDDYPMESPKVRF- 71

Query: 81  QNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
              I H N+    G ICLD+LK  +W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 72  LTKIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 54.7 bits (130), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           +L +WEA I G   T ++   + I I+ P  YP  PP++ F      H N+   +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKFPAG-FYHPNI-YPSGTVCL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL + +DW P   L   V  V  LL  P  DSP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSP 128

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 54.3 bits (129), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 3/100 (3%)

Query: 33  NPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSA 92
            P    +L +WEA I G   T +++  F I I+ P  YP  PP++ F      H N+   
Sbjct: 31  KPDGSMNLQKWEAGIPGKEGTIWKDGVFPITIEYPDDYPSKPPKVKFPAG-FYHPNI-YP 88

Query: 93  TGEICLDIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
           +G +CL IL + +DW P   L      V  LL  P  +SP
Sbjct: 89  SGTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 54.3 bits (129), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 23  NPYRGIIRSLNPIDET-DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQ 81
           +PY    +     D + +L +WEA I G   T ++N  + + I+ P  YP  PP++ F  
Sbjct: 20  HPYGFFAKPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKFPA 79

Query: 82  NDILHCNVKSATGEICLDIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
               H NV   +G ICL IL + +DW P   L   +  V  LL  P  +SP
Sbjct: 80  G-FYHPNV-YPSGTICLSILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSP 128

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 53.1 bits (126), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           +L +WEA I G   T ++   F I I+ P  YP  PP++ F      H N+   +G +CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAG-FYHPNI-YPSGTVCL 59

Query: 99  DIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL + +DW P   L      V  LL  P  +SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 55.1 bits (131), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+ I         + NP   II + +   E ++  W   I GP  TPYEN Q+H 
Sbjct: 9   RLTKEYKNI---------VNNPPPFIIAAPH---EDNILEWHYVITGPPSTPYENGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  PS YP  PP I     N     N +     +CL +    PE W P W ++  ++ +
Sbjct: 57  TLTFPSDYPFNPPAIRMITPNGRFKENTR-----LCLSMSDYHPEAWNPAWSVVTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 53.1 bits (126), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 47/100 (47%), Gaps = 3/100 (3%)

Query: 33  NPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSA 92
            P    DL RWEA I G   T + +  + + I+ P  YP  PP++    N   H NV   
Sbjct: 31  KPDGTMDLQRWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKLPAN-FYHPNV-YP 88

Query: 93  TGEICLDIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
           +G ICL IL + +DW P   L      +  LL  P  +SP
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 53.9 bits (128), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 63/130 (48%), Gaps = 10/130 (7%)

Query: 32  LNPIDETDLSRWEAKIYGPSHTPYENYQFH----ILIDVPSSYPMTPPRINFEQNDILHC 87
           + P D TD  R ++     + +P E Y  H      +D    YP+ PP++   +  I H 
Sbjct: 49  ITPPDSTD--RMQSPKLEVTVSPDEGYYNHGSINFGLDFNEVYPIEPPKVACLKK-IFHP 105

Query: 88  NVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESA 147
           N+    G +CL+IL+ EDW+P  DL   +  +  L  EP  + PL+ D   +  C +E  
Sbjct: 106 NI-DLKGNVCLNILR-EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLF-CQNEKK 162

Query: 148 YQGIVKYFLA 157
           +  IV+  ++
Sbjct: 163 FAEIVRSTMS 172

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           +L +WEA I G   T +++  + I I+ P  YP  PP++ F      H N+   +G +CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKFPAG-FYHPNI-YPSGTVCL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL + +DW P   +   +  V  LL  P  DSP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPDSP 128

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
          [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
          Saccharomyces cerevisiae YGL087C MMS2 Protein involved
          in error-free postreplication DNA repair forms a
          heteromeric complex with Ubc13p that has a
          ubiquitin-conjugating activity cooperates with
          chromatin-associated RING finger proteins Rad18p and
          Rad5p
          Length = 139

 Score = 52.4 bits (124), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 1  MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
          MS++ + +R +L+ L   +  + P       L+  D+  +++W   I GP H+ +EN  +
Sbjct: 1  MSKVPRSFR-LLEELEKGEKGLGP-ESCSYGLSDSDDITMTKWNGTILGPPHSNHENRIY 58

Query: 61 HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           +LI+   SYP  PP++ F     L C V S TGE+
Sbjct: 59 SVLIECGPSYPDEPPKVKFVSKINLPC-VNSTTGEV 93

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 62/130 (47%), Gaps = 5/130 (3%)

Query: 28  IIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHC 87
           +I S +  + T   + E  +  P    Y +   +  +D    YP+ PP++   +  I H 
Sbjct: 48  VITSPDSTNRTHSPKLEITV-NPDEGYYTHGSINFSLDFNEVYPIEPPKVACLKR-IFHP 105

Query: 88  NVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESA 147
           N+    G +CL+IL+ EDW+P  DL   V  +  L  EP  + PL+ D   ++ C DE  
Sbjct: 106 NI-DFKGNVCLNILR-EDWSPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLL-CQDEKE 162

Query: 148 YQGIVKYFLA 157
           +   V+  ++
Sbjct: 163 FAEAVRSTMS 172

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           +L +WEA I G   T +++  + I I+ P  YP  PPR+ F      H N+   +G +CL
Sbjct: 37  NLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKFPAG-FYHPNI-YPSGTVCL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL + +DW P   +   +  V  LL  P  +SP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPNSP 128

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           +L +WEA I G   T +++  + I I+ P  YP  PP++ F      H N+   +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKFPAG-FYHPNI-YPSGTVCL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL + +DW P   L      V  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 3/112 (2%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           MS++ + +R +L+ L   +    P       L   D+  +++W   I GP H+ +EN  +
Sbjct: 1   MSKVPRNFR-LLEELEKGEKGFGP-ESCSYGLADSDDITMTKWNGTILGPPHSNHENRIY 58

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDL 112
            + ID   +YP +PP++ F     L C V   TGE+  D     DW   + +
Sbjct: 59  SLSIDCGPNYPDSPPKVTFISKINLPC-VNPTTGEVQTDFHTLRDWKRAYTM 109

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 51.2 bits (121), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 3/112 (2%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           MS++ + +R +L+ L   +    P       L   D+  +++W   I GP H+ +EN  +
Sbjct: 1   MSKVPRNFR-LLEELEKGEKGFGP-ESCSYGLADSDDITMTKWNGTILGPPHSNHENRIY 58

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDL 112
            + I+   +YP +PP++ F     L C V   TGEI  D     DW   + +
Sbjct: 59  SLSIECGPNYPDSPPKVTFISKINLPC-VNQTTGEIQTDFHTLRDWKRAYTM 109

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 52.0 bits (123), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 47  IYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDW 106
           +  P    Y++ +F   +    +YP+ PP I    N I H N+    G+ICL+IL+ EDW
Sbjct: 73  LISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNI-DLDGKICLNILR-EDW 129

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERE 160
           +P  DL   +  +  L  E     PL+ +  NI+  +DE  ++  V+  +A ++
Sbjct: 130 SPALDLNSIIIGLLYLFLECNAKDPLNKEAANILH-SDEDMFRKYVRDSMAGKK 182

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 47  IYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDW 106
           +  P    Y++ +F   +    +YP+ PP I    N I H N+    G+ICL+IL+ EDW
Sbjct: 74  LISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNI-DLDGKICLNILR-EDW 130

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERE 160
           +P  DL   +  +  L  E     PL+ +  NI+  +DE  ++  V+  +A ++
Sbjct: 131 SPALDLNSIIIGLLYLFLECNAKDPLNKEAANILH-SDEDMFRKYVRDSMAGKK 183

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 51.2 bits (121), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 52/111 (46%), Gaps = 4/111 (3%)

Query: 23  NPYRGIIRSLNPIDET-DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQ 81
           +P+    +    +D + +L  WEA I G   T +    + I I+ P  YP  PP++ F  
Sbjct: 20  HPFGFFAKPTKKVDGSMNLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKFPA 79

Query: 82  NDILHCNVKSATGEICLDIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
               H N+   +G +CL IL + +DW P   L   V  V  LL  P  +SP
Sbjct: 80  G-FYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 51.2 bits (121), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           +L +WEA I G   T +++  + I I+ P  YP  PP++ F      H N+   +G +CL
Sbjct: 37  NLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRFPAG-FYHPNI-YPSGTVCL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL + +DW P   L   V  V  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 3/92 (3%)

Query: 50  PSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPV 109
           P    Y++  F   +    SYP+ PP + F +  I H N+    G+ICL+IL+ EDW+PV
Sbjct: 75  PDEGIYKDGYFPFSMVFKDSYPIEPPVVKFLKK-IYHPNI-DLNGKICLNILR-EDWSPV 131

Query: 110 WDLLHCVHAVWRLLREPVCDSPLDVDMGNIIR 141
            DL   +  +  L  EP    PL++  G +++
Sbjct: 132 LDLQSIIIGLMFLFLEPNPRDPLNLKAGELLK 163

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 48/100 (48%), Gaps = 3/100 (3%)

Query: 33  NPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSA 92
           +P    +L +WEA I G   T +    + I I+ P+ YP  PP++    N   H NV   
Sbjct: 31  HPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKLPAN-FYHPNV-YP 88

Query: 93  TGEICLDIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
           +G ICL IL + +DW P   L      +  LL  P  +SP
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 4/111 (3%)

Query: 23  NPYRGIIRSLNPIDET-DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQ 81
           +P+    +     D T +L +WEA I G   T +    + I I+ P+ YP  PP++    
Sbjct: 20  HPFGFFAKPTKKTDGTMNLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKLPA 79

Query: 82  NDILHCNVKSATGEICLDILKPE-DWTPVWDLLHCVHAVWRLLREPVCDSP 131
               H NV   +G ICL IL  E DW P   L      +  LL  P  +SP
Sbjct: 80  G-FYHPNV-YPSGTICLSILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 4/106 (3%)

Query: 47  IYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDW 106
           +  P    Y +      +D    YP+ PP++   +  I H N+    G +CL+IL+ EDW
Sbjct: 66  VVSPDEGYYNHGSISFSLDFNEVYPIEPPKVTCLKK-IFHPNI-DLNGNVCLNILR-EDW 122

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIV 152
           +P  DL   +  +  L  EP  + PL+ D   +  C D+  +   V
Sbjct: 123 SPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLF-CQDQKKFAETV 167

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 60/131 (45%), Gaps = 5/131 (3%)

Query: 27  GIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILH 86
            +I S +  D +   + E  I  P    Y     +  +D    YP+ PP++   +  I H
Sbjct: 48  NVITSPDSADRSQSPKLEV-IVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKK-IFH 105

Query: 87  CNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADES 146
            N+    G +CL+IL+ EDW+P  DL   +  +  L  EP  + PL+ D   ++ C  E 
Sbjct: 106 PNI-DLKGNVCLNILR-EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLL-CEGEK 162

Query: 147 AYQGIVKYFLA 157
            +   V+  ++
Sbjct: 163 EFAEAVRLTMS 173

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+++++         NP   II   N   E+++  W   I GP  +PY + Q+H 
Sbjct: 9   RLTKEYKMMME---------NPTPYIIARPN---ESNILEWHYVITGPPDSPYHDGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  PS YP  PP I     N     N +     +CL +    P+ W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRFKENTR-----LCLSMSDYHPDTWNPGWSVATILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+++++         NP   II   N   E ++  W   I GP  TPY+  Q+H 
Sbjct: 9   RLTKEYKMMVE---------NPPPFIIARPN---EENILEWHYVISGPPDTPYDGGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  PS YP  PP I     N     N +     +CL +    P+ W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMITPNGRFKENTR-----LCLSMSDYHPDTWNPGWSVATILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 48.1 bits (113), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 65/142 (45%), Gaps = 4/142 (2%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           MS++ + +R +L+ L   +  + P       L   D+  ++RW   I GP H+ +EN  +
Sbjct: 1   MSKVPRSFR-LLEELEKGEKGLGP-ESCSYGLADADDITMTRWNGTILGPPHSNHENRIY 58

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKP-EDWTPVWDLLHCVHAV 119
            + I+    YP  PP I F     L C V  +TGE+  +     +DW  ++++   +  +
Sbjct: 59  SVSIECGPKYPDEPPTITFISKINLPC-VDQSTGEVNKEKFNTLKDWKRLYNMETILLDL 117

Query: 120 WRLLREPVCDSPLDVDMGNIIR 141
            + +  P     +  + G+  +
Sbjct: 118 RKEMASPANKKLVQPEEGSTFK 139

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 48.5 bits (114), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 44/94 (46%), Gaps = 3/94 (3%)

Query: 39  DLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICL 98
           +L RWEA I G   T +    + + I+ P  YP  PP++        H NV   +G ICL
Sbjct: 37  NLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKLPAG-FYHPNV-YPSGTICL 94

Query: 99  DIL-KPEDWTPVWDLLHCVHAVWRLLREPVCDSP 131
            IL + +DW P   L      +  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 49.3 bits (116), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+++++         NP   I+   N   E ++  W   I GP+ TPY+  Q+H 
Sbjct: 9   RLTKEYKLMVE---------NPPPYILARPN---EDNILEWHYIITGPAETPYKGGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  PS YP  PP I     N     N +     +CL +    P+ W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 49.3 bits (116), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 56/126 (44%), Gaps = 20/126 (15%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + R+TKEY++I++         NP   I+   N   E ++  W   I GPS TPY + Q+
Sbjct: 7   LKRLTKEYKLIVE---------NPPPYIVARPN---EDNILEWHYVITGPSDTPYSSGQY 54

Query: 61  HILIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVH 117
           H  +  PS YP  PP I     N     N +     +CL +    P+ W P W +   + 
Sbjct: 55  HGTLTFPSDYPYKPPAIRMITPNGRFKENTR-----LCLSMSDYHPDLWNPGWSVSTILT 109

Query: 118 AVWRLL 123
            +   +
Sbjct: 110 GLLSFM 115

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 48.9 bits (115), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 57/124 (45%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+++++T         PY     +  P +E+++  W   I GP  TPY+  Q+H 
Sbjct: 9   RLTKEYKMMVETPP-------PYI----TARP-NESNILEWHYIIIGPQDTPYDGGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  PS YP  PP I     N     N +     +CL +    P+ W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMITPNGRFKENTR-----LCLSMSDYHPDTWNPGWSVATILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+++++         NP   I+   N   E ++  W   I GP+ TPY+  Q+H 
Sbjct: 9   RLTKEYKLMVE---------NPPPYILARPN---EDNILEWHYIITGPADTPYKGGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  PS YP  PP I     N     N +     +CL +    P+ W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMITPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+++++         NP   I+   N   E ++  W   I GP+ TPY+  Q+H 
Sbjct: 9   RLTKEYKLMVE---------NPPPYILARPN---EDNILEWHYIITGPADTPYKGGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  PS YP  PP I     N     N +     +CL +    P+ W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 4/103 (3%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLH 114
           Y    F     +  +YP+ PP++      I H N+ + TGEICL+IL+ EDW+P  DL  
Sbjct: 86  YNLGHFRFQFTINENYPIEPPKV-VCLTKIYHPNI-NRTGEICLNILR-EDWSPALDLQS 142

Query: 115 CVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLA 157
            +  +  L  EP    PL+    + +   D + ++ IV+  +A
Sbjct: 143 VIIGLLFLFIEPNPKDPLNKQAADTL-LHDPAVFKHIVQKSMA 184

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 6/90 (6%)

Query: 36  DETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGE 95
           +E+++  W   I GP  TPYEN Q+H  +  PS YP  PP I      +           
Sbjct: 30  NESNILDWHYIITGPPGTPYENGQYHGTLTFPSDYPFQPPAIRM----VTPSGRFQENTR 85

Query: 96  ICLDI--LKPEDWTPVWDLLHCVHAVWRLL 123
           +CL +    P  W P W +   ++ +   +
Sbjct: 86  LCLSMSDYHPTTWNPGWSVSTILNGLLSFM 115

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138
          aa] {ON} highly similar to uniprot|P53152 Saccharomyces
          cerevisiae YGL087C MMS2 Protein involved in error-free
          postreplication DNA repair forms a heteromeric complex
          with Ubc13p that has a ubiquitin-conjugating activity
          cooperates with chromatin-associated RING finger
          proteins Rad18p and Rad5p
          Length = 138

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 3/96 (3%)

Query: 1  MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
          MSR+ + +R +L+ L   +  + P       L   D+  ++ W   I GP H+ +EN  +
Sbjct: 1  MSRVPRSFR-LLEELEKGEKGMGP-ESCSYGLAHSDDITMTHWNGTILGPPHSNHENRIY 58

Query: 61 HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           + I+   +YP  PP+I F     L C V   TGE+
Sbjct: 59 SVAIECGEAYPDQPPKIRFLSKVNLPC-VDQNTGEV 93

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 54/126 (42%), Gaps = 20/126 (15%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + R+TKEY++I++         NP   +    N   E ++  W   I GP  TPYE  Q+
Sbjct: 7   LKRLTKEYKLIVE---------NPPPYVTARPN---EDNILEWHYVITGPPETPYEGGQY 54

Query: 61  HILIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVH 117
           H  +  PS YP  PP I     N     N +     +CL +    P+ W P W +   + 
Sbjct: 55  HGTLTFPSDYPYKPPAIRMVTPNGRFKENTR-----LCLSMSDYHPDLWNPGWSVSTILT 109

Query: 118 AVWRLL 123
            +   +
Sbjct: 110 GLLSFM 115

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 48/112 (42%), Gaps = 18/112 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+ +++         NP   II   N   E ++  W   I GP  TPYE  Q+H 
Sbjct: 9   RLTKEYKSMVE---------NPPPFIIAQPN---EDNILEWHYVITGPPDTPYEGGQYHG 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI--LKPEDWTPVWDL 112
            +  PS YP  PP I      +           +CL +    P+ W P W +
Sbjct: 57  TLVFPSDYPFKPPAIRM----VTPSGRFKEDTRLCLSMSDYHPDTWNPSWSV 104

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+++++         NP   I+   N   E ++  W   I GP+ TPY+  Q+H 
Sbjct: 9   RLTKEYKLMVE---------NPPPYILARPN---EDNILEWHYIITGPADTPYKAGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  PS YP  PP I     N     N +     +CL +    P+ W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMITPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa]
          {ON} Syntenic homolog of Saccharomyces cerevisiae
          YGL087C (MMS2); 1-intron
          Length = 138

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 1  MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
          MS++ + +R +L+ L   +  + P       L   D+  ++ W   I GP H+ +EN  +
Sbjct: 1  MSKVPRSFR-LLEELEKGEKGMGP-ESCSYGLADGDDISMTHWNGTILGPPHSSHENRIY 58

Query: 61 HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           ++I+  + YP  PP++ F     L C V  +TGE+
Sbjct: 59 SVVIECGAEYPDRPPKVRFISRINLPC-VDPSTGEV 93

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 3/112 (2%)

Query: 29  IRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCN 88
           + +L P ++T  S        P    Y   +F   +    SYP+ PP +   Q  I H N
Sbjct: 32  LTTLVPPEDTSRSPLLQITICPDEGFYNGGRFKFNLTTSESYPIDPPSVVCLQK-IYHPN 90

Query: 89  VKSATGEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNII 140
           +    G+ICL+IL+ EDW+P  D+   +  +  L  EP    PL+ D  + +
Sbjct: 91  ID-LNGKICLNILR-EDWSPALDIQSVIVGLLFLFLEPNPRDPLNKDAASTL 140

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 61/127 (48%), Gaps = 11/127 (8%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           MS++ + +R +L+ L   +  + P       L   D+  ++ W   I GP H+ + N  +
Sbjct: 1   MSKVPRSFR-LLEELEKGEKGMGP-ESCSYGLADSDDISMTNWNGTILGPPHSNHSNRIY 58

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPV--WDLLHCVHA 118
            + I+   SYP  PP + F     L+C V SATG     ++KP D+ P+  W   + +  
Sbjct: 59  SLSIECGPSYPDEPPTLKFISKINLNC-VDSATG-----VVKP-DFNPIKNWKRSYTMET 111

Query: 119 VWRLLRE 125
           +   LR+
Sbjct: 112 ILLELRK 118

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 53/113 (46%), Gaps = 4/113 (3%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           MS++ + +R +L+ L   +  + P       L   D+  ++ W   I GP H+ +EN  +
Sbjct: 1   MSKVPRNFR-LLEELEKGEKGLGP-ESCSYGLADSDDITMTNWNGTILGPPHSNHENRIY 58

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKP-EDWTPVWDL 112
            + I+   +YP  PP+I F     + C V S TGE+   +     DW   + +
Sbjct: 59  SVSIECGPNYPDEPPKIKFVSKVNVPC-VDSTTGEVKSSVFHTLRDWKRAYTM 110

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 54/124 (43%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R++KEY++I++         NP   I+   N   E ++  W   I GP  TPY   Q+H 
Sbjct: 9   RLSKEYKLIIE---------NPTPYILARPN---ENNILEWHYIITGPPDTPYVGGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  PS YP  PP I     N     N +     +CL +    P+ W P W +   ++ +
Sbjct: 57  TLTFPSDYPFKPPAIRMITPNGRFKENTR-----LCLSMSDYHPDLWNPGWSVATILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+++++   S  P +         L   +E ++  W   I GP  TPY+  Q+H 
Sbjct: 9   RLTKEYKLLVE---SSPPFI---------LARPNEDNILEWHYIITGPPDTPYDGGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  P+ YP  PP I     N     N +     +CL +    P+ W P W +   ++ +
Sbjct: 57  TLTFPNDYPYKPPAIRMITPNGRFKENTR-----LCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 18/123 (14%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R++KEY++I++          PY   +    P DE  L  W   I GP  TPYE  Q+H 
Sbjct: 9   RLSKEYKMIMENTP-------PYIIAV----PNDENIL-EWHYVITGPPDTPYEGGQYHG 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAVW 120
            +  P  YP  PP I        +   K  T  +CL +    P+ W P W +   ++ + 
Sbjct: 57  TLHFPPEYPFKPPAIRI---STPNGRFKQHT-RLCLSMSDYHPDTWNPSWSVATILNGLL 112

Query: 121 RLL 123
             +
Sbjct: 113 SFM 115

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 43/94 (45%), Gaps = 3/94 (3%)

Query: 47  IYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDW 106
           I  P    Y    F   +     YP+ PP++    N I H N+    G+ICL+IL+ EDW
Sbjct: 67  IVSPDEGFYRKGHFTFEMTFTEKYPIEPPQVRC-MNQIFHPNI-DLQGKICLNILR-EDW 123

Query: 107 TPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNII 140
           +P  DL   +  +  L  E     PL+    +++
Sbjct: 124 SPALDLQSVIIGILFLFLEVSGRDPLNKQAASLL 157

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 54/124 (43%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+++++         NP   I+   N   E ++  W   I GP+ TPY   Q+H 
Sbjct: 9   RLTKEYKLMVE---------NPPPYILARPN---ENNILEWHYIITGPADTPYFEGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  PS YP  PP I     N     N +     +CL +    P  W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRFRENTR-----LCLSMSDYHPNTWNPSWSVSTILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 45.1 bits (105), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 4/107 (3%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           MSR+ + +R +L+ L   +  + P        N  D T ++ W   I GP H+ +EN  +
Sbjct: 1   MSRVPRSFR-LLEELEKGEKGLGPESCSYGLANGEDIT-MTTWNGTILGPPHSNHENRIY 58

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKP-EDW 106
            ++I     YP  PP + F     L C V  ATGE+  ++     DW
Sbjct: 59  SVVIKCGDEYPDKPPTVKFISKINLPC-VDQATGEVETNMFHTLRDW 104

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 52/124 (41%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+ I         I NP + I    N   E ++  W   I GP  TPY + Q+H 
Sbjct: 9   RLTKEYKAI---------IENPPQFINAQPN---EDNILEWHYIITGPPDTPYTDGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  P+ YP  PP I     N     N +     +C+ +    P+ W P W +   +  +
Sbjct: 57  TLVFPADYPFKPPAIRMITPNGRFKENTR-----LCMTMSDYHPDTWNPAWSVATILMGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 57/126 (45%), Gaps = 20/126 (15%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           + R+TKEY+++++         NP   I+   N   E ++  W   I GP  TPY++ Q+
Sbjct: 7   LKRLTKEYKLMVE---------NPPPYILARPN---EDNILEWHYIITGPPDTPYKDGQY 54

Query: 61  HILIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVH 117
           H  +  PS YP  PP I     N     N +     +CL +    P+ W P W +   ++
Sbjct: 55  HGTLTFPSDYPYKPPAIRMITPNGRFKENTR-----LCLSMSDYHPDLWNPGWSVNTILN 109

Query: 118 AVWRLL 123
            +   +
Sbjct: 110 GLLSFM 115

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 45.4 bits (106), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 7/92 (7%)

Query: 53  TPYENY----QFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTP 108
           TP E Y     F        +YP+ PP++    + I H N+    G +CL+IL+ EDW+P
Sbjct: 67  TPDEGYYKCGHFKFCATFKDTYPIEPPKVTL-LSKIFHPNI-DLQGNVCLNILR-EDWSP 123

Query: 109 VWDLLHCVHAVWRLLREPVCDSPLDVDMGNII 140
           V D+   +  +  L  EP    PL+    +++
Sbjct: 124 VLDVQSILIGLLMLFLEPNATDPLNKVAADVL 155

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 46.2 bits (108), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 48/100 (48%), Gaps = 6/100 (6%)

Query: 37  ETDLSRWEAKIY---GPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSAT 93
           ET+    EA +Y    P    Y++  F   +    SYP+ PP +      I H N+    
Sbjct: 134 ETNSITSEATLYLRISPDEGFYKHGHFGFSVSFKDSYPIDPPIVKC-LTTIYHPNI-DYN 191

Query: 94  GEICLDILKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLD 133
           G ICL++L+ EDWTPV DL   V  +  L  EP    PL+
Sbjct: 192 GNICLNVLR-EDWTPVLDLQTIVIGLLFLFLEPNPKDPLN 230

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 42/84 (50%), Gaps = 3/84 (3%)

Query: 50  PSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPV 109
           P    Y+   F   +    +YP+ PP +    N I H N+ +  G +CL+IL+ EDW+PV
Sbjct: 68  PDEGYYKPGYFRFSLFFKDTYPIEPPAVKCV-NKIYHPNIDTQ-GNVCLNILR-EDWSPV 124

Query: 110 WDLLHCVHAVWRLLREPVCDSPLD 133
            DL   V  +  L  EP    PL+
Sbjct: 125 LDLQSVVIGLLFLFLEPNDKDPLN 148

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 40  LSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLD 99
           +++W   I GP H+ +EN  + + I+   +YP +PP + F     L C V   TGE+  +
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTFISKINLPC-VSQTTGEVQTN 59

Query: 100 ILKPEDWTPVWDL 112
                DW   + +
Sbjct: 60  FHTLRDWKRAYTM 72

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 40  LSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLD 99
           +++W   I GP H+ +EN  + + I+   +YP +PP++ F     L C V   TGE+  D
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPC-VNPTTGEVQTD 59

Query: 100 ILKPEDW 106
                 W
Sbjct: 60  FHTLRGW 66

>NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417
          bp, 138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 3/96 (3%)

Query: 1  MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
          MS++ + +R +L+ L   +  + P       L   D+  +++W   I GP H+ +EN  +
Sbjct: 1  MSKVPRNFR-LLEELEKGEKGLGP-ESCSYGLADSDDITMTKWNGTILGPPHSNHENRIY 58

Query: 61 HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           + I     YP  PP I F     L C V   TGE+
Sbjct: 59 SVAIHCGPHYPDAPPTIKFVSKINLPC-VDEKTGEV 93

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 54/124 (43%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R++KEY+++ +         NP   I+ +     E ++  W   I GP  TPYE+ Q+H 
Sbjct: 9   RLSKEYKMMTE---------NPPPYIVAAPK---EDNILVWHYVITGPPETPYEDGQYHG 56

Query: 63  LIDVPSSYPMTPPRIN-FEQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  P+ YP  PP I     N     N +     +CL +    P+ W P W +   +  +
Sbjct: 57  TLVFPNDYPFNPPAIRMLTPNGRFRENTR-----LCLSMSDYHPDTWNPSWSVATILTGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 58  YQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVH 117
           Y F++ I    +YPM PP +    + I H N+    G +CL++L+ EDWTP  D+   + 
Sbjct: 77  YYFNVFIK--DTYPMEPPVVKC-MHRIYHPNI-DIDGNVCLNLLR-EDWTPALDIQSIII 131

Query: 118 AVWRLLREPVCDSPLDVDMGNII 140
            +  L  EP    PL+ D    +
Sbjct: 132 GILFLFHEPNGRDPLNKDAAKTL 154

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 3/91 (3%)

Query: 50  PSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPV 109
           P   PY    F   +     YP+ PP      N I H N+    G+ICL+IL+ EDW+P 
Sbjct: 77  PREGPYLGGAFKFNLKFNEMYPIEPPSA-ICLNKIFHPNI-DLNGKICLNILR-EDWSPA 133

Query: 110 WDLLHCVHAVWRLLREPVCDSPLDVDMGNII 140
            DL   V  +  L  +     PL+     ++
Sbjct: 134 LDLTSIVIGLLYLFLDFTSTDPLNQQAAEVL 164

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 45/93 (48%), Gaps = 6/93 (6%)

Query: 44  EAKIY---GPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI 100
           E K+Y    P    Y    F   +    +YP+ PP +    N I H N+   +G ICL++
Sbjct: 74  ENKVYLRISPEEGVYRGGHFRFSVVFRDTYPIEPPTVKC-LNTIYHPNI-DYSGNICLNV 131

Query: 101 LKPEDWTPVWDLLHCVHAVWRLLREPVCDSPLD 133
           L+ EDW+PV DL   V  +  L  EP    PL+
Sbjct: 132 LR-EDWSPVMDLQTVVLGLLFLFLEPNGSDPLN 163

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 53/124 (42%), Gaps = 20/124 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R+TKEY+++ +         NP   I+   N   E ++  W   I GP  +PY   Q+H 
Sbjct: 9   RLTKEYKMMNE---------NPTPFIMARPN---EANILEWHYIINGPPDSPYFEGQYHG 56

Query: 63  LIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVHAV 119
            +  PS YP  PP I     N     N +     +CL +    P+ W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMITPNGRFKENTR-----LCLSMSDYHPDTWNPGWSVATILNGL 111

Query: 120 WRLL 123
              +
Sbjct: 112 LSFM 115

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
           MS++ + +R +L+ L   +  + P       L   D+  ++ W   I GP H+ +EN  +
Sbjct: 1   MSKVPRSFR-LLEELEKGEKGLGP-ESCSYGLADSDDISMTTWNGTILGPPHSNHENRIY 58

Query: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKP-EDWTPVWDL 112
            + I+   +YP  PP I F     L C V S TG++         DW   +++
Sbjct: 59  SLSIECGPNYPDHPPTIKFISKINLPC-VDSKTGQVTPSTFHTLRDWKRAYNM 110

>Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {ON}
           YGL087C (MMS2) - Similar to ubiquitin conjugating
           protein family [contig 30] FULL
          Length = 101

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 40  LSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLD 99
           ++ W   I GP H+ +EN  + + ++  ++YP  PP+I F     L C V   TGE+  D
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISKINLPC-VNQTTGEVKRD 59

Query: 100 ILKP-EDWTPVWDL 112
                 DW   +++
Sbjct: 60  QFSTLRDWKRSYNM 73

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 47/112 (41%), Gaps = 18/112 (16%)

Query: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62
           R++KEY+ +++         NP   II   N   E ++  W   I GP  TPY   Q+H 
Sbjct: 9   RLSKEYKSMVE---------NPPPFIIAQPN---EDNVLEWHYVITGPPDTPYMGGQYHG 56

Query: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDI--LKPEDWTPVWDL 112
            +  PS YP  PP I      +           +CL +    P+ W P W +
Sbjct: 57  TLVFPSDYPFKPPAIRM----VTPSGRFKEDTRLCLSMSDYHPDTWNPSWSV 104

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140
          aa] {ON} highly similar to uniprot|P53152 Saccharomyces
          cerevisiae YGL087C MMS2 Protein involved in error-free
          postreplication DNA repair forms a heteromeric complex
          with Ubc13p that has a ubiquitin-conjugating activity
          cooperates with chromatin-associated RING finger
          proteins Rad18p and Rad5p
          Length = 140

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 36 DETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGE 95
          D+  ++ W   I GP H+ +EN  + + I+  ++YP  PP I F     L C V   TGE
Sbjct: 36 DDITMTNWNGTILGPPHSNHENRIYSVAIECGANYPDEPPLIKFVSKINLPC-VDQTTGE 94

Query: 96 ICLD 99
          +  D
Sbjct: 95 VKHD 98

>KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417
          bp, 138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 42.0 bits (97), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 3/96 (3%)

Query: 1  MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
          MS+I + +R +L+ L   +    P       L   D+  ++ W   I GP H+ +EN  +
Sbjct: 1  MSKIPRSFR-LLEELEKGEKGFGP-ESCSYGLADSDDITMTNWNGTILGPPHSNHENRIY 58

Query: 61 HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           + I    +YP  PP++ F     L C +   TGEI
Sbjct: 59 SLEIVCGPNYPDEPPKVKFVSKVNLPC-IDDKTGEI 93

>TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420
          bp, 139 aa] {ON} Anc_6.187 YGL087C
          Length = 139

 Score = 42.0 bits (97), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 3/96 (3%)

Query: 1  MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
          MS++ + +R +L+ L   +  + P       L   D+  ++RW   I GP H+ +EN  +
Sbjct: 1  MSKVPRSFR-LLEELEKGEKGMGP-ESCSYGLADGDDITMTRWNGTILGPPHSNHENRIY 58

Query: 61 HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEI 96
           + I+   +YP  PP + F     L C V   TG++
Sbjct: 59 SLSIECGPNYPDAPPVLFFISKINLPC-VSPKTGQV 93

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 53/108 (49%), Gaps = 4/108 (3%)

Query: 50  PSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPV 109
           P    Y+   F   ++   +YP+ PP +    + + H N+    G++CL+IL+ EDW+P 
Sbjct: 73  PDEGFYKGGHFTFKLEFNDAYPIEPPTV-ICTSKLYHPNI-DIDGKVCLNILR-EDWSPA 129

Query: 110 WDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLA 157
            D+   +  +  LL EP    PL+ D   ++   D + +  +V   +A
Sbjct: 130 LDVQSIIIGLLFLLLEPNAKDPLNKDAA-MMLSTDTARFASLVNRSMA 176

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 65/167 (38%), Gaps = 26/167 (15%)

Query: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
             R+TKEY    KTL    P   PY  I+   N   E ++  W   I GP  +PY   Q+
Sbjct: 7   FKRLTKEY----KTLTETPP---PY--ILARPN---EDNILEWHYIITGPPDSPYSEGQY 54

Query: 61  HILIDVPSSYPMTPPRINF-EQNDILHCNVKSATGEICLDI--LKPEDWTPVWDLLHCVH 117
           H  +  P+ YP  PP I     N     N +     +CL +    P+ W P W +   + 
Sbjct: 55  HGTLTFPTDYPYKPPAIRMITPNGRFKENTR-----LCLSMSDYHPDLWNPSWSVSTILT 109

Query: 118 AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSRY 164
            +   +      +  +   G+I+    +     +       R+ +R+
Sbjct: 110 GLLSFM------TGDEATTGSIVTTDSQKRQFAMNSVAFNNRQNTRF 150

>NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa]
           {ON} Anc_6.187 YGL087C
          Length = 157

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 36  DETDLSRWEAKIYGPSHTPYENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGE 95
           D+  ++ W   I GP H+ +EN  + + I    +YP  PP I F     L C V   TGE
Sbjct: 53  DDITMTNWNGTILGPPHSNHENRIYSVAITCGPNYPDVPPTIKFISKINLPC-VDDVTGE 111

Query: 96  I 96
           +
Sbjct: 112 V 112

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 40.0 bits (92), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 49/120 (40%), Gaps = 17/120 (14%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKP----------- 103
           Y    F   +  P  +P +PP+  F    I H NV    G++C+ IL             
Sbjct: 62  YHGGYFQSQMKFPKDFPFSPPQFKFIP-PIYHPNVYR-DGKLCISILHQSGDAMTSEPDN 119

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           E W+PV  +   + ++  LL +P   SP +VD     R      Y    K  L + ERSR
Sbjct: 120 ETWSPVQSVESVLISIVSLLEDPNVSSPANVDAAVEYR----KNYNEYKKKVLQQVERSR 175

>KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.187
          YGL087C
          Length = 138

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 3/99 (3%)

Query: 1  MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60
          MS++ + +R +L+ L   +    P       L   D+  +++W   I GP H+ +EN  +
Sbjct: 1  MSKVPRSFR-LLEELEKGEKGFGP-ESCSYGLADSDDITMTKWNGTILGPPHSNHENRIY 58

Query: 61 HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLD 99
           + I     YP  PP + F     L C V   TG +  +
Sbjct: 59 SLEIVCGDRYPDEPPLVKFISKVNLPC-VDQTTGVVSAE 96

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 50/120 (41%), Gaps = 17/120 (14%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL-----------KP 103
           Y    F   +  P  +P +PP+  F    I H NV    G +C+ IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQGGDPMTDEPDA 112

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           E W+PV  +   + ++  LL +P   SP +VD     R   E  Y+  VK    E ERS+
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNQEQ-YKQRVK---MEVERSK 168

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 50/120 (41%), Gaps = 17/120 (14%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL-----------KP 103
           Y    F   +  P  +P +PP+  F    I H NV    G +C+ IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQGGDPMTDEPDA 112

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           E W+PV  +   + ++  LL +P   SP +VD     R   E  Y+  VK    E ERS+
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQ-YKQRVK---MEVERSK 168

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 50/120 (41%), Gaps = 17/120 (14%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL-----------KP 103
           Y    F   +  P  +P +PP+  F    I H NV    G +C+ IL             
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDEPDA 112

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           E W+PV  +   + ++  LL +P   SP +VD     R   E  Y+  VK    E ERS+
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFRKNPEQ-YKQRVK---MEVERSK 168

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 49/120 (40%), Gaps = 17/120 (14%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL-----------KP 103
           Y    F   +  P  +P +PP+  F    I H NV    G +C+ IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDEPDA 112

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           E W+PV  +   + ++  LL +P   SP +VD     R   +   Q +    L E ERS+
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPDQYRQRV----LMEVERSK 168

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 17/120 (14%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL-----------KP 103
           Y    F   +  P  +P +PP+  F    I H NV    G +C+ IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDEPDA 112

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           E W+PV  +   + ++  LL +P  +SP +VD     R   E  Y+  VK    E ERS+
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQ-YKQRVKM---EVERSK 168

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 17/120 (14%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL-----------KP 103
           Y    F   +  P  +P +PP+  F    I H NV    G +C+ IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDEPDA 112

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           E W+PV  +   + ++  LL +P  +SP +VD     R   E  Y+  VK    E ERS+
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQ-YKQRVKM---EVERSK 168

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 17/120 (14%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL-----------KP 103
           Y    F   +  P  +P +PP+  F    I H NV    G +C+ IL             
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDEPDA 112

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           E W+PV  +   + ++  LL +P  +SP +VD     R   E  Y+  VK    E ERS+
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQ-YKQRVKM---EVERSK 168

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 50/115 (43%), Gaps = 17/115 (14%)

Query: 60  FHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL-----------KPEDWTP 108
           F   +  P  +P +PP+  F    I H NV    G +C+ IL             E W+P
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 109 VWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           V  +   + ++  LL +P  +SP +VD     R   E  Y+  VK    E ERS+
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQ-YKQRVK---MEVERSK 168

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 48/120 (40%), Gaps = 17/120 (14%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL-----------KP 103
           Y    F   +  P  +P +PP+  F    I H NV    G +C+ IL             
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNVY-RDGRLCISILHQSGDPMTDELDA 112

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           E W+PV  +   + ++  LL +P   SP +VD     R   E   Q I      E ERS+
Sbjct: 113 ETWSPVQSVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRI----KMEVERSK 168

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 48/120 (40%), Gaps = 17/120 (14%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL-----------KP 103
           Y    F   +  P  +P +PP   F    I H NV    G +C+ IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPTFRFTPA-IYHPNVYR-DGRLCISILHTSGDPTSEEPDS 112

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           E W+PV  +   + ++  LL +P   SP +VD     R   +   Q +    L E ERS+
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNADQYRQRV----LLEVERSK 168

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 41/94 (43%), Gaps = 13/94 (13%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKP----------- 103
           Y    F   +  PS++P +PP   F    I H NV    G++C+ IL             
Sbjct: 56  YNGGYFKSEMKFPSNFPYSPPHFKFVP-PIYHPNVY-KDGKLCISILHQSGDSMTSEPDN 113

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           E W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 114 ETWSPVQSVESVLISIISLLEDPNISSPANVDAS 147

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 39/94 (41%), Gaps = 13/94 (13%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL-----------KP 103
           Y    F   +  P  +P +PP+  F    I H NV    G +C+ IL             
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDEPDA 112

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMG 137
           E W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 50/120 (41%), Gaps = 17/120 (14%)

Query: 55  YENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDIL-----------KP 103
           Y    F   +  P  +P +PP+  F    I H NV    G +C+ IL             
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDELDA 112

Query: 104 EDWTPVWDLLHCVHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163
           E W+PV  +   + ++  LL +P   SP +VD     R   E  Y+  VK    E ERS+
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQ-YKQRVK---MEVERSK 168

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.140    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,684,163
Number of extensions: 876578
Number of successful extensions: 2099
Number of sequences better than 10.0: 270
Number of HSP's gapped: 1899
Number of HSP's successfully gapped: 270
Length of query: 165
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 64
Effective length of database: 41,900,133
Effective search space: 2681608512
Effective search space used: 2681608512
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)