Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2273.493ON1741747199e-98
YGR131W (FHN1)3.493ON1741746633e-89
Skud_7.4423.493ON1741745862e-77
Suva_7.4193.493ON1741745764e-76
Skud_16.4443.493ON1731744551e-57
NDAI0G009303.493ON1761764542e-57
Smik_16.4023.493ON1731744533e-57
YPR149W (NCE102)3.493ON1731744506e-57
CAGL0I10494g3.493ON1721754506e-57
NCAS0E008003.493ON1741744212e-52
NDAI0B058803.493ON1821824142e-51
CAGL0L08448g3.493ON1731744063e-50
TDEL0D056103.493ON1751754054e-50
Suva_16.4783.493ON1661744021e-49
SAKL0F02750g3.493ON1701743951e-48
KNAG0B008003.493ON1821823917e-48
KAFR0C019703.493ON1791793909e-48
TBLA0D029603.493ON1891433771e-45
KLLA0D16280g3.493ON1691823612e-43
ZYRO0D09966g3.493ON1781783604e-43
Kpol_1017.63.493ON1871873597e-43
TBLA0C044903.493ON1861503527e-42
KNAG0A079503.493ON1821373465e-41
TPHA0D032803.493ON1841843371e-39
NCAS0F035603.493ON1831223274e-38
KAFR0G037003.493ON1861383135e-36
Kwal_55.212383.493ON1701743116e-36
KLTH0F14850g3.493ON1711753064e-35
AFR312W3.493ON1681222812e-31
Ecym_12363.493ON1691742386e-25
ZYRO0B16654g5.717ON142437672.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.227
         (174 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   281   9e-98
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   259   3e-89
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   230   2e-77
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   226   4e-76
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   179   1e-57
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   179   2e-57
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   179   3e-57
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   177   6e-57
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   177   6e-57
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   166   2e-52
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   164   2e-51
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   160   3e-50
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   160   4e-50
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   159   1e-49
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   156   1e-48
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   155   7e-48
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   154   9e-48
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   149   1e-45
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   143   2e-43
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   143   4e-43
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   142   7e-43
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   140   7e-42
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   137   5e-41
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   134   1e-39
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   130   4e-38
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   125   5e-36
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   124   6e-36
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   122   4e-35
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   112   2e-31
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...    96   6e-25
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...    30   2.6  

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  281 bits (719), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 145/174 (83%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLSAADNLIRIINAVF             TQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           QAAVAFFYFSCFLFLIKVTVTAAGTIQN                QLGVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  259 bits (663), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 134/174 (77%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLSAADNL+RIINAVF             TQ KHSSRVNFCMF A YGLVTDSLYGFLAN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           FW+SLTYPAILL LD LNFIFTFVAATALAVGIRCHSCKNKTYLEQNKI Q SSSRCHQS
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           QAAVAFFYFSCFLFLIKVTV   G +QN                Q+G+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  230 bits (586), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 133/174 (76%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLSAADNLIRI++AVF             TQ   SSRVNFCMF AAYGL+TDS YGFLAN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           FWSSLTYPAILL LD LNF+FTF AATALAVGIRCHSCKNKTYLEQN ITQ SSSRCHQS
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           QAAVAFFYFSCFLFLIKVTV+ AG +QN                Q+GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  226 bits (576), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 109/174 (62%), Positives = 124/174 (71%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLS ADN++RIINA+F             +Q KHSSRVNFCMF AAYGL+TDS YG LAN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
            WSSLTYP I+  LD LNF+FTF+A TALAVGIRCHSC NKTYL+ NKITQ S SRCHQ+
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           +AAV FFYFSC LFLIKV V+ A  +QN                Q+G+PTISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  179 bits (455), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 90/174 (51%), Positives = 111/174 (63%), Gaps = 1/174 (0%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           ML+ ADN++RIIN +F             TQ ++SSRVNFCMF AAYG+ TDSLYG  AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           F+  L +P +L  LD LNF+FTF A T LAVGIR HSC N++Y++ N ITQ S +RC Q+
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           QAAVAF YFSC +FL K  ++    I N                Q+GVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISN-GAFGSGSFSKRRRTGQVGVPTISQV 173

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  179 bits (454), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 115/176 (65%), Gaps = 2/176 (1%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLS ADNL+R++NA+F             TQ  H+SR+N+CMFT  Y L+TDS +G LAN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           F+  L++P IL  LD LNF FTFVA T LA GIR HSC N++YL++NKITQ S +RC +S
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXX--XXQLGVPTISQV 174
           QA VAFFYFS F+FLIK+ ++    IQN                  ++GVP+ISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  179 bits (453), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 109/174 (62%), Gaps = 1/174 (0%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           ML+ ADN++RIIN +F             TQ KHSSRVN+CMF  AYG+ TDSLYG  AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           F   L +P +L  LD LNF+FTF A T LAVGIR HSC N +Y++ NKITQ S +RC Q+
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           QAAVAF YFSC +FL K  ++    I N                Q+GVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISN-GAFGSGSFSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  177 bits (450), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 90/174 (51%), Positives = 109/174 (62%), Gaps = 1/174 (0%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           ML+ ADN++RIIN +F             TQ +HSSRVN+CMF  AYG+ TDSLYG  AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           F   L +P +L  LD LNF+FTF A T LAVGIR HSC N +Y++ NKITQ S +RC Q+
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           QAAVAF YFSC +FL K  ++    I N                Q+GVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISN-GAFGSGSFSKRRRTGQVGVPTISQV 173

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  177 bits (450), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 111/175 (63%), Gaps = 4/175 (2%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLS ADNL+RI+NAVF             T+ +HSSRVNFC+F AAYG+ TDSLYG  AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLE-QNKITQASSSRCHQ 119
           F+  L +P +L  LD LNF+FTF A T LAVGIR HSC NK YLE + KI Q S +RC Q
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           +QA VAFFYFS  +FL K+ ++    + N                ++GVP+ISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSN---GAFGAKLRRKHHTEVGVPSISQV 172

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  166 bits (421), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 85/174 (48%), Positives = 107/174 (61%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           ML  ADNL+RI+NAVF             T+  ++SR+N+CMFT AY L TDS+YG  AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           F+  L  PA+   LD LNF FTFVA T LA GIR HSCK++ Y+  NKITQ   +RC +S
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           QA VAFFYFS  +FL K+ ++    IQN                ++GVP+ISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  164 bits (414), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 108/182 (59%), Gaps = 8/182 (4%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLS  DN++R+INA+F             TQ  +SSR+NFCMF AA+GL+TDS +G   N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FWSSL-TYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119
            + +L ++P +L   D LNF+FTF A T LAV IR HSCKN+ Y+  N ITQ S +RC  
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNX-------XXXXXXXXXXXXXXXQLGVPTIS 172
           SQAAVAFFYFSCF+FL K+ ++      N                       ++GVPTIS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 173 QV 174
           QV
Sbjct: 181 QV 182

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  160 bits (406), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 102/174 (58%), Gaps = 1/174 (0%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           ML+  DNL+RI+N VF             T+ +HSSRVN+CMF AAYG+ TDSLYG  AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           F+  L +P IL  LD LNF F   A   LAVGIR HSC N  Y E NKI Q S  RC +S
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           QAAVAFF+FS  +FL K+ ++      N                ++GVP++SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSN-GAFGTKFIRRRRNNAEVGVPSVSQV 173

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  160 bits (405), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 110/175 (62%), Gaps = 1/175 (0%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           ML+  DN +R++N  F             ++  HSSRVNFCMF AA+G+VTDS YG LAN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
            W    +P IL ALD LNF FTF AATALAVGIR HSCKN+ YL+ N ITQ S+ RC  +
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXX-XXXXXXXXXXXXXXQLGVPTISQV 174
           QA+VAFFYFS F+FL K+ ++  G I N                 Q+GVPTISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  159 bits (402), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 105/174 (60%), Gaps = 8/174 (4%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           ML+  DN++RIIN +F             TQ+ +SSR+N+CMF  AY +VTDSLYG  AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           F+  L +P IL +LD LNF+FTF A       IR HSC+N+TYL  N ITQ S +RC ++
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           QAAVAF YFSC +FL K  ++    I N                Q+GVPTISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISN-GAFGSGSFSKRRRTGQVGVPTISQV 166

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  156 bits (395), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 105/174 (60%), Gaps = 4/174 (2%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLS  DN +R++N  F             TQ +HS RVNF +FTAA+ LVTDS Y   AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
            +S+  +P +L+  D LNF+FTF AATALAVGIR HSC N++YL  N ITQ S+ RC ++
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           QA VAF YFS F+FL K+ +    ++ N                 +GVPTISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVL----SVINVFSSGAFGSGSGSRRANVGVPTISQV 170

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  155 bits (391), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 98/182 (53%), Gaps = 8/182 (4%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           ML  ADNL+R++N  F             TQ  H SRVN+CMF AAYG+ TD LYG LAN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           FW  L +P IL  LD LNF FT  A   LAVGIR HSCKN  Y E+N I Q S +RC  S
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQL--------GVPTIS 172
           QAA AFF+FS  +F+ K+ ++      N                          GVP+IS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 173 QV 174
           QV
Sbjct: 181 QV 182

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  154 bits (390), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 104/179 (58%), Gaps = 5/179 (2%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQ-AKHSSRVNFCMFTAAYGLVTDSLYGFLA 59
           ML  ADN++R+INAVF             TQ   H+SRVN+CMF  A+GL  DS+YG  A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119
           NF+  L +P +L  LD LNF FTF AATALAVGIR HSC N++YL+ NKI + S  RC +
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQL----GVPTISQV 174
           +QA VAF YFS  +F+ K+ ++     QN                      GVP ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  149 bits (377), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 88/143 (61%), Gaps = 2/143 (1%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQ-AKHSSRVNFCMFTAAYGLVTDSLYGFLA 59
           ML   DN+ RI N  F             T+   HSSRVN+CMF  A+GLV+DS YG LA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NF-WSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCH 118
           N       +P IL A D LNF+FTF A T LAVGIR HSC NK Y  +N I Q S  RC 
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 QSQAAVAFFYFSCFLFLIKVTVT 141
           ++QA +AFFYFS FLFL+KV +T
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLIT 143

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  143 bits (361), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 104/182 (57%), Gaps = 21/182 (11%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLS  DN +R +N VF             TQ   SSRVNF +F A +G+V DSLY  +AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           F S+L +P IL++LD LN++FTF AATALAVGIR  SC N ++   NKI + S  RC ++
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QAAVAFFYFSCFLFLIK--------VTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTIS 172
           QA+  F YFS  +FL+K        +T  A GT  N                Q+GVPTIS
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSN-------------RKTQVGVPTIS 167

Query: 173 QV 174
           QV
Sbjct: 168 QV 169

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  143 bits (360), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 85/178 (47%), Positives = 109/178 (61%), Gaps = 4/178 (2%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAK-HSSRVNFCMFTAAYGLVTDSLYGFLA 59
           ML+  DN++R +N  F             ++   H+SRVNFCMF AA+G+V DS YG LA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119
           N +    +P IL  LD LNF+FTF AATALAVGIR HSC N+ YL+ NKITQ S+SRC +
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQ---LGVPTISQV 174
           +QA VAFFYF+ F+FL K+ ++    + N                Q   +GVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  142 bits (359), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 107/187 (57%), Gaps = 13/187 (6%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLS ADN++R IN  F             T+  HSSRVN+CMF   + +VTDS YG LAN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  FWSS-LTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119
            W++   +P IL A D LNF FTF A T L+VGIR HSCKN+ Y++ NKI Q S+ RC +
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXX------------XXXXXXXXXXXXQLG 167
           +QA++AFFYFS F+F +KV ++A   + N                            Q+G
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 168 VPTISQV 174
           VP ISQV
Sbjct: 181 VPNISQV 187

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  140 bits (352), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 94/150 (62%), Gaps = 2/150 (1%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAK-HSSRVNFCMFTAAYGLVTDSLYGFLA 59
           MLS   N++RIIN  F             ++ + HS RVN+CMF A + LVTDS Y   A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFWSS-LTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCH 118
           NFW S   +P +L + D LNF FTF A T L+VGIR HSC NK YL  NKITQ S+ RC 
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 QSQAAVAFFYFSCFLFLIKVTVTAAGTIQN 148
            +QA++AF+YFS F++L+++  ++    +N
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWEN 150

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  137 bits (346), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 93/137 (67%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           ML+ AD  +R++N VF             TQ  HSSR+N+CMFTAAYG+ TDS YG +AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           FW  L++P +L ALD LNF+FT  A   LAVGIR HSCKN  Y  +NKI Q S +RC Q+
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QAAVAFFYFSCFLFLIK 137
           QAAVAFF+FS  +FL K
Sbjct: 121 QAAVAFFFFSMAIFLAK 137

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  134 bits (337), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/184 (44%), Positives = 104/184 (56%), Gaps = 10/184 (5%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           ML  ADN++R +N  F             TQ +HSSRVN+C+F   + LVTD+ YG LAN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FWSS-LTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119
            WS+ L +P IL   D LNF FTF A T LAVG R HSC N++YL+ N ITQ S+ RC +
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXX---------XXXXXXXXXQLGVPT 170
           +QAA AFFYFS F+FL K+ +++     N                         Q+GVP 
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 171 ISQV 174
           ISQV
Sbjct: 181 ISQV 184

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  130 bits (327), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 74/122 (60%), Gaps = 1/122 (0%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLS  DN +R  N +F             TQ   SSRVN+CMF AA+GL+TDS +G  AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FWSSLT-YPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119
               L+ +P IL   D LNF+FTF A T LAVGIRCHSC N+ YLE NKI Q S  RC  
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 SQ 121
           SQ
Sbjct: 121 SQ 122

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  125 bits (313), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 89/138 (64%), Gaps = 1/138 (0%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKH-SSRVNFCMFTAAYGLVTDSLYGFLA 59
           ML+ ADN +R++N  F             T+  H S+RVN+CMF  A+G++TDS+YG  A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119
           NF+  L +P IL   D LNF+F F A T LAVGIR H+C N+ Y   NKI + S +RC  
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 SQAAVAFFYFSCFLFLIK 137
           +QAAVAFFYFS  +FL+K
Sbjct: 121 AQAAVAFFYFSMAIFLVK 138

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  124 bits (311), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 104/174 (59%), Gaps = 4/174 (2%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLS  DN +R  N VF             T+  ++ +VNF +F AA+GL+ D+LY   AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           F S+L +P ++   D LNF+FTF AATALAV IR HSC N  Y++ NK+TQ SS RC ++
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           QA+VAF YF+ F+FL+K+ +    ++ N                 +GVPTISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLAL----SLVNVFSVGAFSTSSGRKSANVGVPTISQV 170

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  122 bits (306), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 78/175 (44%), Positives = 104/175 (59%), Gaps = 5/175 (2%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSS-RVNFCMFTAAYGLVTDSLYGFLA 59
           MLS  DN +R +N  F             T   H++ +VNF +FTAA+GL+ DSLY   A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119
           NF S+L +P ++   D LNF+FTF AATALAV IR HSC N+ YL+ N +TQ S+ RC +
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           +QA+VAF YFS F+FL K+ +    ++ N                 +GVPTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGL----SLVNLISVGAFGAGSSRRTGNVGVPTISQV 171

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  112 bits (281), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 73/122 (59%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLS  DN +R +N VF              Q    SRVNF +FTA + LVTDS Y  +AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           F S+  +P I +ALD+LN IFTF AATAL   I  HSC N+ +L+ N I++ S+ RC + 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QA 122
           QA
Sbjct: 121 QA 122

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score = 96.3 bits (238), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 90/174 (51%), Gaps = 5/174 (2%)

Query: 1   MLSAADNLIRIINAVFXXXXXXXXXXXXXTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60
           MLS  DN +R  N +F              Q +  SRVNF +FTA + L+ DSLY  LAN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120
           F S+L +P +L+  D+LN IFTF AATAL   I  HSC N  +L  N I++    RC + 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNXXXXXXXXXXXXXXXXQLGVPTISQV 174
           QA+  F +FS F+FL K  ++    +                    GVPTISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRKTGG-----GVPTISQV 169

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
           {ON} some similarities with uniprot|P40450 Saccharomyces
           cerevisiae YIL159W BNR1 Formin nucleates the formation
           of linear actin filaments involved in cell processes
           such as budding and mitotic spindle orientation which
           require the formation of polarized actin cables
           functionally redundant with BNI1
          Length = 1424

 Score = 30.4 bits (67), Expect = 2.6,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 96  HSCKNKTYLEQNKITQASSSRCHQSQAAVAFFYFSCF 132
           H    KT+L++N IT A +  CH+ Q    F Y  CF
Sbjct: 240 HESFCKTFLDENHIT-ALADCCHRIQPNNQFVYLRCF 275

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,582,375
Number of extensions: 345272
Number of successful extensions: 1121
Number of sequences better than 10.0: 38
Number of HSP's gapped: 1102
Number of HSP's successfully gapped: 38
Length of query: 174
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 72
Effective length of database: 41,785,467
Effective search space: 3008553624
Effective search space used: 3008553624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 62 (28.5 bits)