Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2263.492ON83983934710.0
Skud_7.4413.492ON80784125610.0
YGR130C3.492ON81663119420.0
Suva_7.4183.492ON83162818120.0
NCAS0E008103.492ON6924709581e-117
SAKL0F02772g3.492ON7734698641e-103
CAGL0I10516g3.492ON8134678362e-98
NDAI0G009403.492ON6564867176e-83
KLTH0F14828g3.492ON8364587014e-79
Kwal_55.212293.492ON7874726195e-68
KLLA0D16236g3.492ON8714945988e-65
ZYRO0D09988g3.492ON9943875922e-63
Kpol_480.143.492ON6993175784e-63
TDEL0D056003.492ON7002665643e-61
TPHA0D042503.492ON6292745042e-53
KNAG0B008103.492ON7572723851e-37
Ecym_12373.492ON7273113654e-35
KAFR0C019603.492ON5632712832e-25
AFR310C3.492ON6232632324e-19
TBLA0C044803.492ON8021351942e-14
KNAG0A079403.492ON2751671454e-09
KAFR0G036903.492ON3631571252e-06
NCAS0F035503.492ON4411191226e-06
NDAI0B058603.492ON6811131010.002
NCAS0A149407.488ON1336208771.7
Kwal_26.79022.502ON532133752.9
Ecym_30066.4ON725142744.0
Kpol_1065.363.330ON1219111727.2
Smik_13.3886.258ON29592707.6
YDL058W (USO1)4.238ON179043718.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.226
         (839 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...  1341   0.0  
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   991   0.0  
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   752   0.0  
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   702   0.0  
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   373   e-117
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   337   e-103
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   326   2e-98
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   280   6e-83
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   274   4e-79
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   243   5e-68
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   234   8e-65
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   232   2e-63
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   227   4e-63
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   221   3e-61
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   198   2e-53
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   152   1e-37
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   145   4e-35
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...   113   2e-25
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    94   4e-19
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    79   2e-14
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    60   4e-09
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    53   2e-06
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    52   6e-06
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    44   0.002
NCAS0A14940 Chr1 (2941337..2945347) [4011 bp, 1336 aa] {ON} Anc_...    34   1.7  
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    33   2.9  
Ecym_3006 Chr3 complement(11788..13965) [2178 bp, 725 aa] {ON} s...    33   4.0  
Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON} (76145...    32   7.2  
Smik_13.388 Chr13 complement(611342..612229) [888 bp, 295 aa] {O...    32   7.6  
YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essen...    32   8.9  

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score = 1341 bits (3471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/839 (81%), Positives = 686/839 (81%)

Query: 1   MLFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQD 60
           MLFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQD
Sbjct: 1   MLFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQD 60

Query: 61  ALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT 120
           ALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT
Sbjct: 61  ALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT 120

Query: 121 QNEERQYQXXXXXXXXXXXXQYLKKCQKITDLTKDEKNDNGTAXXXXXXXXXXXXXXXXD 180
           QNEERQYQ            QYLKKCQKITDLTKDEKNDNGTA                D
Sbjct: 121 QNEERQYQLLTELELKEKHLQYLKKCQKITDLTKDEKNDNGTATSSSMSTSSSSSSSSSD 180

Query: 181 DEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXINEHGSDEATSIEEKQGDKAXXXXXXXXX 240
           DEG                            INEHGSDEATSIEEKQGDKA         
Sbjct: 181 DEGIASTTTTENNEAIANTSTTMTTSTSTTSINEHGSDEATSIEEKQGDKASESTSIEES 240

Query: 241 XXKNDNNVREAASLNDEGNVAESSISKTTADSTQMNVPEPAATSQRDTSAQVVTSSNDAS 300
             KNDNNVREAASLNDEGNVAESSISKTTADSTQMNVPEPAATSQRDTSAQVVTSSNDAS
Sbjct: 241 TSKNDNNVREAASLNDEGNVAESSISKTTADSTQMNVPEPAATSQRDTSAQVVTSSNDAS 300

Query: 301 EPHTKSESGISKSDIIPTEELKEETVVAKKISSAVKXXXXXXXXXXXXXXXXXXXXXXXX 360
           EPHTKSESGISKSDIIPTEELKEETVVAKKISSAVK                        
Sbjct: 301 EPHTKSESGISKSDIIPTEELKEETVVAKKISSAVKSTEEEEGEGEETEQSSVEEPGEET 360

Query: 361 XXXXXXXXXXXXDKVPIDPSKAPKVPFQERPRKGKTGIFALWXXXXXXXXXXXXXXXPSN 420
                       DKVPIDPSKAPKVPFQERPRKGKTGIFALW               PSN
Sbjct: 361 STPGTSESESEEDKVPIDPSKAPKVPFQERPRKGKTGIFALWKSSTSSSAQKSNTAAPSN 420

Query: 421 PVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEK 480
           PVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEK
Sbjct: 421 PVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEK 480

Query: 481 LQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKN 540
           LQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKN
Sbjct: 481 LQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKN 540

Query: 541 QKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINL 600
           QKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINL
Sbjct: 541 QKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINL 600

Query: 601 KQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLL 660
           KQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLL
Sbjct: 601 KQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLL 660

Query: 661 NEMTIIKQENANEKTQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 720
           NEMTIIKQENANEKTQLSAITKRLEDERRAH                             
Sbjct: 661 NEMTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQ 720

Query: 721 XXXXXXDHEEQITQVKKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQR 780
                 DHEEQITQVKKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQR
Sbjct: 721 ARQAQLDHEEQITQVKKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQR 780

Query: 781 NADEALKQEILSKQHKQAEGLHAAERYKIPNDHPQKNKNVVPKDDSLYEYHTEEDVMYA 839
           NADEALKQEILSKQHKQAEGLHAAERYKIPNDHPQKNKNVVPKDDSLYEYHTEEDVMYA
Sbjct: 781 NADEALKQEILSKQHKQAEGLHAAERYKIPNDHPQKNKNVVPKDDSLYEYHTEEDVMYA 839

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  991 bits (2561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/841 (62%), Positives = 592/841 (70%), Gaps = 36/841 (4%)

Query: 1   MLFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQD 60
           MLFN NRQ++DPFTQLINQSS N Q+++ QQ+E PYQFLQKVVSNEPKGKEEW+SPFRQD
Sbjct: 1   MLFNTNRQDEDPFTQLINQSSANAQNQREQQEEKPYQFLQKVVSNEPKGKEEWVSPFRQD 60

Query: 61  ALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT 120
           AL S+  NNRLYV DAKN+KFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT
Sbjct: 61  AL-SRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT 119

Query: 121 QNEERQYQXXXXXXXXXXXXQYLKKCQKITDLTKDEKNDNGTAXXXXXXXXXXXXXXXXD 180
           +NEERQYQ            +YLK+CQKITDLT D  +D  T+                 
Sbjct: 120 KNEERQYQLLTELELKEKHLKYLKECQKITDLTSDGNDDAATSADSSLSSSDKEDSTTS- 178

Query: 181 DEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXINEHGSDEATSIEEKQGDKAXXXXXXXXX 240
                                          + + G DEATSIEE+Q DKA         
Sbjct: 179 ----KGNEIAGEAAAADMTKITTTTAPTSSAVGDSG-DEATSIEEEQDDKASETTSVEKA 233

Query: 241 XXKNDNNVREAASLNDEGNVAESSISKTTADSTQMNVPEPAATSQRDTSAQVVTSSNDAS 300
              N    +E  +L +EG+VAE      TA +TQ++VPEPA TSQ               
Sbjct: 234 AAGNGEGAQEPVALKNEGSVAEP-----TAVTTQVDVPEPAVTSQ--------------- 273

Query: 301 EPHTKSESGISKSDIIPTEELKEETVVAKKI--SSAVKXXXXXXXXXXXXXXXXXXXXXX 358
                  S + +S ++PTEE K ET V K++  +   +                      
Sbjct: 274 -------SNVPESAVLPTEESKSETSVVKEVNPTEEGQTEEVHDEEDEKSEQSSVEEHGE 326

Query: 359 XXXXXXXXXXXXXXDKVPIDPSKAPKVPFQERPRKGKTGIFALWXXXXXXXXXXXXXXXP 418
                         DK PIDPSKAPKVPF+ERP+K +TGIFALW               P
Sbjct: 327 ETSTPETSEAESVEDKAPIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAP 386

Query: 419 SNPVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYE 478
           SNPVATPE PELIVKTKEHGYLSKAVYDKINYDEKVHQAWL DL+A+EKAKYDA +  Y 
Sbjct: 387 SNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYS 446

Query: 479 EKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENM 538
           E+LQDLQNQIDE+E+SMKAMRKETSEKIEVSKNRLVKQIIDVN AHNNKKLMIFKDTENM
Sbjct: 447 ERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENM 506

Query: 539 KNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQI 598
           KNQKL+EK+ VL KQT VKS+IDELNS KTNVQK+FNDWTTNLSNLSQQLDAQIFKINQI
Sbjct: 507 KNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQI 566

Query: 599 NLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQIST 658
           NLKQSKVQ+EID+L++KK  L+ QT+EN+KLHE+NVQ LESVEN+EYLPQINDIDNQ+ST
Sbjct: 567 NLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVST 626

Query: 659 LLNEMTIIKQENANEKTQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXX 718
           LLN+MTII+QENANEKT+LSAITKRLEDERRAH                           
Sbjct: 627 LLNKMTIIRQENANEKTELSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELE 686

Query: 719 XXXXXXXXDHEEQITQVKKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTR 778
                   DHE+QITQVK+TYNDQLTELQDKLAAEEKELE VKRE+TRLQGEKAIEEQTR
Sbjct: 687 EQAHQAQLDHEQQITQVKQTYNDQLTELQDKLAAEEKELEAVKRERTRLQGEKAIEEQTR 746

Query: 779 QRNADEALKQEILSKQHKQAEGLHAAERYKIPNDHPQKNKNVVPKDDSLYEYHTEEDVMY 838
           Q+++DEALKQEIL KQHKQAEGLHAAE++ IPN H  KN+ +VPKDDSLYEYHTEEDVMY
Sbjct: 747 QKSSDEALKQEILGKQHKQAEGLHAAEKHNIPNSHSPKNEILVPKDDSLYEYHTEEDVMY 806

Query: 839 A 839
           A
Sbjct: 807 A 807

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/631 (64%), Positives = 455/631 (72%), Gaps = 46/631 (7%)

Query: 214 EHGSDEATSIEEKQGDKAXXXXXXXXXXXKNDNNVREAASLNDEGNVAES-SISKTTADS 272
           E+ +DEATS+EE+  DK                             V+ES SI K TADS
Sbjct: 227 ENSADEATSVEEEHEDK-----------------------------VSESTSIGKGTADS 257

Query: 273 TQMNVPEPAATSQRDTSAQVVTSSNDASEPHTKSESGISKSDIIPTEELKEETVVAKKIS 332
            Q+NV EP            ++S N   EP T  +SG SKS ++PT+E KEE    KK++
Sbjct: 258 AQINVAEP------------ISSENGVLEPRTTDQSGGSKSGVVPTDEQKEEKSDVKKVN 305

Query: 333 SAV----KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKVPIDPSKAPKVPFQ 388
                  K                                    D+ PIDPSKAPKVPFQ
Sbjct: 306 PPSGEEKKEVEAEGDAEEETEQSSAEESAERTSTPETSEPESEEDESPIDPSKAPKVPFQ 365

Query: 389 ERPRKGKTGIFALWXXXXXXXXXXXXXXXPSNPVATPEKPELIVKTKEHGYLSKAVYDKI 448
           E  RK +TGIFALW               PSNPVATPE PELIVKTKEHGYLSKAVYDKI
Sbjct: 366 EPSRKERTGIFALWKSPTSSSTQKSKTAAPSNPVATPENPELIVKTKEHGYLSKAVYDKI 425

Query: 449 NYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEV 508
           NYDEK+HQAWL DLRA+EK KYDAKNKEY+EKLQDLQNQIDE+E+SMKAMR+ETSEKIEV
Sbjct: 426 NYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREETSEKIEV 485

Query: 509 SKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTNVKSQIDELNSEKT 568
           SKNRLVK+IIDVNA HNNKKLMI KDTENMKNQKL+EKN VL+KQTNVKS+ID+LN+EKT
Sbjct: 486 SKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKT 545

Query: 569 NVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQTQENEK 628
           NVQK+FNDWTTNLSNLSQQLDAQIFKINQINLKQ KVQ+EID+LE+KK  LVTQT+EN+K
Sbjct: 546 NVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTEENKK 605

Query: 629 LHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKTQLSAITKRLEDER 688
           LHEKNVQVLESVEN+EYLPQINDIDNQIS+LLNE+TIIKQENANEKTQLSAITKRLEDER
Sbjct: 606 LHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAITKRLEDER 665

Query: 689 RAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEEQITQVKKTYNDQLTELQD 748
           RAH                                   DHE+QITQVK+TYNDQLTELQD
Sbjct: 666 RAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQLTELQD 725

Query: 749 KLAAEEKELETVKREKTRLQGEKAIEEQTRQRNADEALKQEILSKQHKQAEGLHAAERYK 808
           KLA EEKELE VKRE+TRLQ EKAIEEQTRQ+NADEALKQEILS+QHKQAEG+HAAE +K
Sbjct: 726 KLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEALKQEILSRQHKQAEGIHAAENHK 785

Query: 809 IPNDHPQKNKNVVPKDDSLYEYHTEEDVMYA 839
           IPND  QKN +V+PKDDSLYEYHTEEDVMYA
Sbjct: 786 IPNDRSQKNTSVLPKDDSLYEYHTEEDVMYA 816

 Score =  273 bits (698), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 130/157 (82%), Positives = 138/157 (87%), Gaps = 1/157 (0%)

Query: 1   MLFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQD 60
           MLFNINRQ DDPFTQLINQSS N Q++QA Q+E+PYQFLQKVVSNEPKGKEEW+SPFRQD
Sbjct: 1   MLFNINRQEDDPFTQLINQSSANTQNQQAHQQESPYQFLQKVVSNEPKGKEEWVSPFRQD 60

Query: 61  ALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT 120
           ALA++QNN R Y EDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT
Sbjct: 61  ALANRQNN-RAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT 119

Query: 121 QNEERQYQXXXXXXXXXXXXQYLKKCQKITDLTKDEK 157
           QNEERQYQ            +YLKKCQKITDLTKDEK
Sbjct: 120 QNEERQYQLLTELELKEKHLKYLKKCQKITDLTKDEK 156

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/628 (60%), Positives = 446/628 (71%), Gaps = 4/628 (0%)

Query: 216 GSDEATSIEEKQGDKAXXXXXXXXXXXKNDNNVREAASLNDEGNVAESSISKTTADSTQM 275
            +DEATSIEE+Q + A            N+  ++E  +  DE N+AE ++++ T  + + 
Sbjct: 204 SADEATSIEEEQKENAGETTPTVETTADNEKEIQEPETFKDEQNLAEPAVAEITPVTARS 263

Query: 276 NVPEPAATSQRDTSAQVVTSSNDASEPHTKSESG---ISKSDIIPTEELKEETVVAKKIS 332
           ++PE A  +  D   +V  ++   + P     +    + +  + P EE  E+T V K  +
Sbjct: 264 DIPESAVAAASDDVPEVAVANTSDNVPEVTVAAASDEVPEEAVAPIEEQTEKTSVVKTDT 323

Query: 333 SAVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKVPIDPSKAPKVPFQERPR 392
              +                                    D  PIDPSKAPKVPFQERP+
Sbjct: 324 VTKEGKGEVADVEEETEQSSADEHGEETSTPETSEAESDGDITPIDPSKAPKVPFQERPQ 383

Query: 393 KGKTGIFALWXXXXXXXXXXXXXXXPSNPVATPEKPELIVKTKEHGYLSKAVYDKINYDE 452
           K +TG FALW               P NPVATPE PELIVKTKEHGYLSKAVYDKINYDE
Sbjct: 384 KERTGFFALWKSPTSSSAKKGAATAPLNPVATPENPELIVKTKEHGYLSKAVYDKINYDE 443

Query: 453 KVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNR 512
           K+HQAWL DLRAREKAKYDAKN EY+EKLQDLQNQIDE+E+SMK +R+ETS+KIEV+KNR
Sbjct: 444 KIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNR 503

Query: 513 LVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQK 572
           LVKQIID+N  HNNKKLMIFKDTENMK QKLEEKN VLNKQTNVKS+IDELNSEK+NVQK
Sbjct: 504 LVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQK 563

Query: 573 DFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEK 632
           +FNDWTTNLS+LSQQLDAQIFKINQINLKQSK Q+EID+LE++K  L+TQT+EN+KLHEK
Sbjct: 564 EFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEK 623

Query: 633 NVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKTQLSAITKRLEDERRAHX 692
           NV+VLESVEN+EYLPQINDID QISTLLN+MTII+QENANE+T LSAITK+LEDERRAH 
Sbjct: 624 NVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERTHLSAITKKLEDERRAHE 683

Query: 693 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEEQITQVKKTYNDQLTELQDKLAA 752
                                             +HEEQITQVKKTYNDQLTELQDKLAA
Sbjct: 684 EQLKLEAEERKRKEENLLEKQRQELEEQAHQAELEHEEQITQVKKTYNDQLTELQDKLAA 743

Query: 753 EEKELETVKREKTRLQGEKAIEEQTRQRNADEALKQEILSKQHKQAEGLHAAE-RYKIPN 811
           EE+ELE VKRE+T+LQGEKAIEEQTRQ+NADE LKQ IL KQHKQA GLHAAE R   P+
Sbjct: 744 EEEELEAVKRERTKLQGEKAIEEQTRQKNADEILKQTILDKQHKQATGLHAAENRVNTPS 803

Query: 812 DHPQKNKNVVPKDDSLYEYHTEEDVMYA 839
            + Q++K  VPK+DSLYEYHTEEDVMYA
Sbjct: 804 SNLQESKRAVPKNDSLYEYHTEEDVMYA 831

 Score =  231 bits (589), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 116/155 (74%), Positives = 126/155 (81%), Gaps = 3/155 (1%)

Query: 1   MLFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQD 60
           MLFN +RQ DDPFTQLINQSS   Q  Q Q+K  PYQFLQKVVSNEPKGKE+W+SPFRQD
Sbjct: 1   MLFNTSRQEDDPFTQLINQSSAQNQQVQQQEK--PYQFLQKVVSNEPKGKEDWVSPFRQD 58

Query: 61  ALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT 120
           AL+  QNN RLYV DAKNRKFPTVSATS YSKQQP+DLGYKNIPK+ KRAKDI+FPTYLT
Sbjct: 59  ALSGNQNN-RLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLT 117

Query: 121 QNEERQYQXXXXXXXXXXXXQYLKKCQKITDLTKD 155
           +NEERQYQ            +YLKKCQKITDLT D
Sbjct: 118 KNEERQYQLLTELELKEKHLKYLKKCQKITDLTGD 152

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  373 bits (958), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/470 (43%), Positives = 295/470 (62%), Gaps = 18/470 (3%)

Query: 376 PIDPSKAPKVPFQERPRKGKTGIFALWXXXXXXXXXXXXXXXPSNPVATPEKPELIVKTK 435
           PIDP+ AP VPF            +L                PSNPVA+P   E IVKT 
Sbjct: 235 PIDPALAPMVPF------------SLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTA 282

Query: 436 EHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSM 495
           + GYLSKAVYDKI YDE+ H+ WL D   ++  KY+AK +EY++ LQD+ NQ+ E+ D +
Sbjct: 283 QFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLI 342

Query: 496 KAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTN 555
           +    +T EKI+V   +LVK++ D      N K+ IF +T+ +K +KL EK  VLN  T 
Sbjct: 343 EKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTE 402

Query: 556 VKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQK 615
           VK  IDEL +EK  V+ ++++WTTN++N+  +LDA++FKI+QIN+ Q  +Q++ID+L  +
Sbjct: 403 VKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQ 462

Query: 616 KNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKT 675
           KN L  +  +N+ +H+ NV+++ESV+N+EYLP++NDIDN+I+ LLN+MTI+KQENANEK 
Sbjct: 463 KNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKV 522

Query: 676 QLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEEQITQV 735
           QL+ ITK+LEDERRAH                                   +H+++I  +
Sbjct: 523 QLAEITKKLEDERRAHEEQLQLEAEERKRQEENLLGKQRDELEAKANTMQVNHQQEIDAL 582

Query: 736 KKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQRNADEALKQEILSKQH 795
           K  Y  +L E +++L  E+ +L+ VKR+KTRL+GEKA++EQ RQ++AD+ LK EI  KQH
Sbjct: 583 KNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQH 642

Query: 796 KQAEGLHAAE----RYKIPNDHPQKNKNVVP--KDDSLYEYHTEEDVMYA 839
           KQAE   AA+    ++ +     +      P  KD+SLY+Y TEEDVMY 
Sbjct: 643 KQAEAFSAAQLKGRKHPLAALAREITGEAKPSSKDNSLYDYETEEDVMYV 692

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 79/166 (47%), Gaps = 25/166 (15%)

Query: 7   RQNDDPFTQLINQSSENGQSKQ--AQQKENPYQFLQKVVS----------------NEPK 48
           ++ DDPF  L  ++     +K   +        FLQ+VVS                +E K
Sbjct: 9   KRRDDPFDHLFEEAEAAEAAKHNTSMAPRTTSSFLQRVVSTTSSTTQKQPKKKIAASEAK 68

Query: 49  GKEEWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAK 108
              ++ SPFR    A   N N   V++ K R+FPTVSATS Y+ + PK  G+  I K   
Sbjct: 69  AMSDYASPFR----AEYSNVN---VQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQN 121

Query: 109 RAKDIRFPTYLTQNEERQYQXXXXXXXXXXXXQYLKKCQKITDLTK 154
            AKDI FP YLT+NE+RQ              +YL+  Q I DLTK
Sbjct: 122 FAKDIYFPNYLTENEQRQQAELLILEKKEKDLKYLQDSQNIIDLTK 167

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  337 bits (864), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 201/469 (42%), Positives = 300/469 (63%), Gaps = 26/469 (5%)

Query: 376 PIDPSKAPKVPFQERPRKGKTGIFALWXXXXXXXXXXXXXXXPSNPVATPEKPELIVKTK 435
           PIDP+KAP+VPF     K KTG+FALW                  P+ATP+ PE IV+T 
Sbjct: 320 PIDPNKAPRVPF-----KAKTGVFALWTRSDKQ----------DQPLATPQDPEYIVRT- 363

Query: 436 EHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSM 495
           + GY+SKA+YDK+ YDE+VHQ  L      +  KYDA  KEY +KL  LQ+QIDE++ +M
Sbjct: 364 DKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATM 423

Query: 496 KAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTN 555
           + +R +T EKI+VS++ L K+++D+NA H + K +IFK+TEN+K QK+ E++ +  K   
Sbjct: 424 EQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEE 483

Query: 556 VKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQK 615
           VK++I+ELN  K  V  +FN++   L +L+ QLD+++ KI ++N KQ ++   I  L QK
Sbjct: 484 VKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQK 543

Query: 616 KNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKT 675
           K  + T+T++ E+LH+++  +LES++N+EYLP+IN ID+Q++TLL  +T+IKQENAN+KT
Sbjct: 544 KLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKT 603

Query: 676 QLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEEQITQV 735
           + +AITKRLE+ER+AH                                    HEE++ Q+
Sbjct: 604 EFAAITKRLEEERKAHEEKLRREEEERKRLEEERLQKQREELEAKAEDARLKHEEELRQI 663

Query: 736 KKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQRNADEALKQEILSKQH 795
           K+ +   L +   +LA E++E E V+REKTRL GEKAI+EQ R + AD ALKQE++ K+ 
Sbjct: 664 KEEHEKALNDANVQLAKEKEEREVVEREKTRLAGEKAIQEQERAQEADLALKQELMEKRR 723

Query: 796 KQAEGLHAAERY-KIPN------DHPQKNKNVVPKDDSLYEYHTEEDVM 837
           KQAE + AAE+  KI         +P +N   + ++ SLY+Y T E+++
Sbjct: 724 KQAEAVDAAEQARKISTQKKSVLSNPSQN---LTRESSLYDYETVEEII 769

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 81/152 (53%), Gaps = 25/152 (16%)

Query: 7   RQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKE--EWISPFR--QDAL 62
           +Q  DPF  L+       Q +Q Q++ N   FL+KVV+N+ K +E  ++ SPFR  Q+ +
Sbjct: 7   KQQVDPFAHLL-------QPEQPQEQPN---FLRKVVTNKKKEEEEKDYSSPFRSQQELI 56

Query: 63  ASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQN 122
           A+K         + K +KFPTVSATS  +     DLGYK I    +RAKDI  P YL   
Sbjct: 57  AAK---------NVKAKKFPTVSATSGTAS--AADLGYKVIDSAKRRAKDISVPRYLKNT 105

Query: 123 EERQYQXXXXXXXXXXXXQYLKKCQKITDLTK 154
           +E+Q +            QYLK  QKI D+ K
Sbjct: 106 DEKQRKKLDKLEFKENHLQYLKDSQKIVDVRK 137

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  326 bits (836), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 198/467 (42%), Positives = 279/467 (59%), Gaps = 33/467 (7%)

Query: 381 KAPKVPFQERPRKGKTGIFALWXXXXXXXXXXXXXXXP--------SNPVATPEKPELIV 432
           K P++P+ E+P  GK   F+ +               P          P+ATPE PELI 
Sbjct: 372 KVPRIPYTEQPESGKK--FSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPENPELIA 429

Query: 433 KTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVE 492
           KT+E+GY+SK +YDK+ YDE  H+ WL   +  EKAKYD K +EY  +L++LQ +ID + 
Sbjct: 430 KTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDMIN 489

Query: 493 DSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNK 552
           +SM+ ++KET++KIEVS+N LVK+I + N  HN +K  IFK+TEN+KNQK+++K  +L+K
Sbjct: 490 ESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQKIQQKKEILDK 549

Query: 553 QTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSL 612
              V+ +I +LN  K  V+++F+ WTTN++ L QQLDA+I K+ QI +KQ + Q EI+ L
Sbjct: 550 HAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKEIEKL 609

Query: 613 EQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENAN 672
           E +K     Q    +K HE+  +V+ES EN+EYLP+I+ IDNQIS LLNE+ IIKQENAN
Sbjct: 610 ETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIKQENAN 669

Query: 673 EKTQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEEQI 732
           E+T+LS ITK LE+ERRAH                                   +HEEQ+
Sbjct: 670 EQTELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEEKAEQQKREHEEQV 729

Query: 733 TQVKKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQRNADEALKQEILS 792
            ++K+ Y              E EL  VK++K  L+ EK +EE  R  N    +K+E+L 
Sbjct: 730 RKMKEQY--------------ENELNNVKKQKESLETEKLVEEHNRNEN----IKKEVLD 771

Query: 793 KQHKQAEGLHAAERYKIPNDHPQKNKNVVPKDDSLYEYHTEEDVMYA 839
           KQ KQAE  HAA+   I       N     +D+SLYE+ TEE++MY 
Sbjct: 772 KQRKQAEAQHAAQTKSIAT-----NAANDMQDNSLYEFKTEEEIMYV 813

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 55/86 (63%)

Query: 68  NNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQY 127
           N   Y ++AK  KFPTVSATSA + Q PK+LG+K + K+ KRAKDI+FP YLT+NE RQ 
Sbjct: 110 NKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQ 169

Query: 128 QXXXXXXXXXXXXQYLKKCQKITDLT 153
                        QYLK  QKI DLT
Sbjct: 170 TILKELELKEGKLQYLKDSQKIIDLT 195

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  280 bits (717), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 179/486 (36%), Positives = 276/486 (56%), Gaps = 41/486 (8%)

Query: 376 PIDPSKAPKVPFQ-ERP----RKGKTGIFALWXXXXXXXXXXXXXXXPSNPVATPEKPEL 430
           PIDP   P V FQ   P    +  KT +                     NP ATP   E 
Sbjct: 190 PIDPKLTPMVSFQLSTPPVNNKNKKTQVVP------------EEEEKERNPKATPNSKEE 237

Query: 431 IVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDE 490
           IVKTK+ G LSK++YD++ YD++ H+ +L   +A  + KYD K +EYE +L+ L  +I  
Sbjct: 238 IVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIVA 297

Query: 491 VEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVL 550
             + ++  +K+T  K+++    LVK++ D  +   + K+ IF +T+ +K +K++EK  V 
Sbjct: 298 SNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVE 357

Query: 551 NKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEID 610
                V  +ID+LN EK  V  +FN+WT N++N+++QLDA++FKI QIN+ Q  +Q++ID
Sbjct: 358 ELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKID 417

Query: 611 SLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQEN 670
            L  +K  L  + + N+  H  NV+ +E+V+N++YLP++N+ID+QI+ LLN++T+IKQEN
Sbjct: 418 GLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQEN 477

Query: 671 ANEKTQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEE 730
           ANEK QLS +T++LE ER  H                                   +HE 
Sbjct: 478 ANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHET 537

Query: 731 QITQVKKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQRNADEALKQEI 790
           ++T +K +Y  QL + + KL  ++ +++ +K +K+RL+G KAIE+Q RQ+ +D  LK EI
Sbjct: 538 EMTNLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEI 597

Query: 791 LSKQHKQAEGLHAAERYKIPNDHPQKNKNVVP-----------------KDDSLYEYHTE 833
           LSKQH+QAE  +A +         QK KN  P                 KDDSL+EY TE
Sbjct: 598 LSKQHQQAEAYNAVQL-------AQKKKNASPVAEDLMKESHIPALSKAKDDSLFEYETE 650

Query: 834 EDVMYA 839
           E++MY 
Sbjct: 651 EEIMYV 656

 Score =  103 bits (257), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 90/169 (53%), Gaps = 19/169 (11%)

Query: 1   MLFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSN--------------- 45
           M   +  + +DPF  L+N   +   S  + +  +   FLQ+V+S+               
Sbjct: 1   MSLKLGSKKNDPFEHLLNPQPKTTGSSDSSRPRSSSLFLQRVISSTSSIQKTPTTSSSSK 60

Query: 46  EPKGKEEWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPK 105
           +    EE++SPFR + +     NN+ Y+++ K ++FPTVSATS Y+ +  K++G+K IPK
Sbjct: 61  KKVSTEEYLSPFRSNLVT----NNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPK 116

Query: 106 NAKRAKDIRFPTYLTQNEERQYQXXXXXXXXXXXXQYLKKCQKITDLTK 154
           +   AKDI FP+YLTQNE+RQ              QY K  Q I DLTK
Sbjct: 117 DKNFAKDIFFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTK 165

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  274 bits (701), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 166/458 (36%), Positives = 256/458 (55%), Gaps = 78/458 (17%)

Query: 376 PIDPSKAPKVPFQERPRKGKTGIFALWXXXXXXXXXXXXXXXPSNPVATPEKPELIVKTK 435
           P D  + P+VPF        TGIFALW                  PVA+P  PE IVK  
Sbjct: 348 PKDIKETPRVPF-------ATGIFALWTRSDKR----------GQPVASPNDPEFIVKF- 389

Query: 436 EHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSM 495
           + GY+SKA+YD + Y+E +H+  + D      AKY+AK  EYE++L  L++QI E+E +M
Sbjct: 390 DKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATM 449

Query: 496 KAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTN 555
           + ++K+T+EKIE+S+ +L  Q+ID+NA H++ K +IFK+TENMK  K+EEK  V  KQ +
Sbjct: 450 ETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAAKVEEKEGVEAKQED 509

Query: 556 VKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQK 615
           VK++++EL   +  +  +  +    +  L+ +LDA++  I ++N +Q+++Q  ID L+Q+
Sbjct: 510 VKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQ 569

Query: 616 KNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKT 675
           K+AL+++    ++ H  NV VLES+EN+EYLP++N ID +IS LL  +T++KQE AN KT
Sbjct: 570 KDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKT 629

Query: 676 QLSAIT---------------------KRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXX 714
           + +A++                     KRLE ER                          
Sbjct: 630 EFAAVSKRLEEEDEERKEKLRQEEENRKRLEAER-------------------------- 663

Query: 715 XXXXXXXXXXXXDHEEQITQVKKTYNDQLTELQDKLAAEEKEL-------ETVKREKTRL 767
                       +H++QI  +++ +  QL E   K A  E+ L       E V+RE+ +L
Sbjct: 664 ------LQKQREEHDQQILLLQQEHERQLAEASQKAAEHEQALLKEREQRELVERERVKL 717

Query: 768 QGEKAIEEQTRQRNADEALKQEILSKQHKQAEGLHAAE 805
           QGEKAI EQ   + AD+AL++EI  + H +A  L  AE
Sbjct: 718 QGEKAIREQEEAKAADKALEEEIKQRNHSRALALDGAE 755

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 70/154 (45%), Gaps = 19/154 (12%)

Query: 11  DPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQD-ALASKQNNN 69
           DP   L  QS       + Q  +    FL KVVS E + +  + SPFR   +LA+ Q   
Sbjct: 7   DPLEHLFQQS-------EPQTGDADKGFLHKVVSKE-QEQSAYNSPFRTSQSLAAAQKR- 57

Query: 70  RLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQX 129
                  K +KFPTVSA+ +       D+GYK I    +RAKDI  P YL  N+ERQ + 
Sbjct: 58  -------KMQKFPTVSASVSAHSS--SDMGYKVIDAARRRAKDIAVPRYLQGNDERQRRR 108

Query: 130 XXXXXXXXXXXQYLKKCQKITDLTKDEKNDNGTA 163
                      +Y K  Q+I D+   +    G A
Sbjct: 109 LDKLERKEDALKYKKDSQRIVDVRGGQDRAAGAA 142

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  243 bits (619), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 163/472 (34%), Positives = 260/472 (55%), Gaps = 38/472 (8%)

Query: 383 PKVPFQERPRKGKTGIFALWXXXXXXXXXXXXXXXPSNPVATPEKPELIVKTKEHGYLSK 442
           P+VPF        TGIFALW                  PVA+P+ PE IVK  + GY+SK
Sbjct: 327 PRVPF-------ATGIFALWTRSDKR----------GQPVASPDDPEFIVKF-DKGYMSK 368

Query: 443 AVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSMKAMRKET 502
           A+YD + Y+E VH+  +         KYDAK +EYE+ L  L++QI E+E +M+ ++ +T
Sbjct: 369 ALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDT 428

Query: 503 SEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTNVKSQIDE 562
           ++KI +S   L  ++I+ NA H+N K +IFK+TEN K  K++EK  V+ KQ  VK++ +E
Sbjct: 429 TDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEE 488

Query: 563 LNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQ 622
           L +++        +  + +  L+ QLD++   I ++N +Q+++Q  ID+LEQ+K+ LV  
Sbjct: 489 LEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVAD 548

Query: 623 TQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKTQLSAITK 682
               ++LH  N+ +LE + N++YLP+IN +D+QIS LL+ + ++KQE AN+ T+ +A++K
Sbjct: 549 ATAADELHNSNIAILEGISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAAVSK 608

Query: 683 RLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEEQITQVKKTYNDQ 742
           RLE+E                                       +HE Q+ +  +   D 
Sbjct: 609 RLEEENEERKEKLRLEEENRKRLEAERFQKQRDEHDQHVLTLQQEHERQLAEASQKAAD- 667

Query: 743 LTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQRNADEALKQEILSKQHKQAEGLH 802
            TEL  +   E++EL  V+RE+ RLQGEKAI+EQ + + AD+AL+ E+  + H +A+ + 
Sbjct: 668 -TELLLQQEREKREL--VERERVRLQGEKAIQEQEQAKLADKALEDEVKERNHNRAQAID 724

Query: 803 A----------------AERYKIPNDHPQKNKNVVPKDDSLYEYHTEEDVMY 838
           A                A     P +  + N      D+SLYEY TE++V Y
Sbjct: 725 AAEAARARNAKSISNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRY 776

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 66/140 (47%), Gaps = 18/140 (12%)

Query: 11  DPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQDALASKQNNNR 70
           DPF  L  Q           +KE    FL+KVV+ E +    + SPFR        + ++
Sbjct: 7   DPFEHLFQQDQ--------PKKETSKGFLRKVVTKEQEDAT-YSSPFRT-------SQSQ 50

Query: 71  LYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQXX 130
           +  +  K ++FPTVSA+S  +     ++G+K I    KRAKDI  P YL  N+ERQ +  
Sbjct: 51  VEAQKRKVQRFPTVSASSGGNSS--AEMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRL 108

Query: 131 XXXXXXXXXXQYLKKCQKIT 150
                     QY K  QKI 
Sbjct: 109 DKLERKEDSLQYKKDSQKIV 128

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  234 bits (598), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 168/494 (34%), Positives = 264/494 (53%), Gaps = 36/494 (7%)

Query: 376 PIDPSKAPKVPFQERPRK-----------GKTGIFALWXXXXXXXXXXXXXX-------X 417
           P D + AP+VPF                   +G+FAL+                      
Sbjct: 379 PPDINSAPRVPFTPSGANKAGTAAATSGIAASGLFALFKRSKKPESSTKVAANAAAGTVV 438

Query: 418 PSN--PVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNK 475
           P +  PVATPE PELIV+T+E GY+SK+VYDK+ YDE  HQA L      +  +Y+ K +
Sbjct: 439 PGDDAPVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQ 497

Query: 476 EYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDT 535
           EYEEK+Q +Q +I E++  M+ +R E  EK+++ +    + +++ N  H N K  ++K T
Sbjct: 498 EYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQT 557

Query: 536 ENMKNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKI 595
           E +KNQ + +K         V+S+IDEL   K  V K+  +  + +  L+ +LD +   +
Sbjct: 558 EEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSAL 617

Query: 596 NQINLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQ 655
           N+   K+ +   EI +LE++K  L  + +E ++LH++NV  +ES++N+EYLP++N+I+ +
Sbjct: 618 NESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTE 677

Query: 656 ISTLLNEMTIIKQENANEKTQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXX 715
           IS+LL  + +I+QE AN+K + S++T+RLE+ER+ H                        
Sbjct: 678 ISSLLASLGLIQQEIANQKVEFSSVTRRLEEERKQHEEQLLKEKEERERLEKERLEKQRT 737

Query: 716 XXXXXXXXXXXDHEEQITQVKKTYNDQLTELQDKLAAEEKEL-------ETVKREKTRLQ 768
                       HEE++  +K+T+++ L E Q +  A  K+L       E V+RE+TRLQ
Sbjct: 738 EYEKQAEEARLKHEEELANLKQTHDEALKEAQLQREAAAKQLEEEQQRREQVERERTRLQ 797

Query: 769 GEKAIEEQTRQRNADEALKQEILSKQHKQAEGLHAAE-RYKIPNDHPQKNKNVVPK---- 823
           GEKAIE Q R    D+ L+ E   K  +QAE   A E   K  N   +K K  VP     
Sbjct: 798 GEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALKSSN---KKTKAAVPPANTT 854

Query: 824 DDSLYEYHTEEDVM 837
           + SLY+Y T E+V+
Sbjct: 855 NSSLYDYETVEEVI 868

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 71/159 (44%), Gaps = 16/159 (10%)

Query: 2   LFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKE-----EWISP 56
           LF   R   DPF  L++ +    + +Q     N    L++V + + + +E     E+ SP
Sbjct: 6   LFR-KRNEIDPFAGLLDDADHAAEQQQQHDLTNSNSILKRVTTKQQQHQEELDDNEYHSP 64

Query: 57  FRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIP-KNAKRAKDIRF 115
           FR     + +   R      +  KFPT+S  +   +  P+ +GY  +  K+ K+AKDI  
Sbjct: 65  FR-----TAEETQR--ARQVRQEKFPTLSQGAV--QLDPEQMGYSVVTDKSVKKAKDIII 115

Query: 116 PTYLTQNEERQYQXXXXXXXXXXXXQYLKKCQKITDLTK 154
           P+ L   E  Q              +Y +K QKI DLTK
Sbjct: 116 PSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLTK 154

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  232 bits (592), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/387 (33%), Positives = 224/387 (57%), Gaps = 9/387 (2%)

Query: 376 PIDPSKAPKV-PFQERPRKGKTGIFALWXXXXXXXXXXXXXXXPSNPVATPEKPELIVKT 434
           P+D +  P+V  F E  +K    IF+++                 NP+ATPE PE++VKT
Sbjct: 450 PVDYAAVPRVVTFPEVEKK--RSIFSIFGRKKKSQNRA------PNPLATPENPEILVKT 501

Query: 435 KEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDS 494
              G+LSKAVYDK+ Y+   H  WLT+  + EK +Y+ K  +Y+ +L++L+ +++++E+S
Sbjct: 502 DREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEKLEES 561

Query: 495 MKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQT 554
           M+ ++ + +E IE+   RL K+ ++    +  KK  IF +T+ +++QK +E + + ++Q 
Sbjct: 562 MQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQE 621

Query: 555 NVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQ 614
            V+ +I  LN+EK N+ ++F  WT  L++ S  LDA+++ ++ +  K +K Q +ID L  
Sbjct: 622 EVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSH 681

Query: 615 KKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEK 674
           KK  L  +   +++ H KN + +E   N+EYLP++++ID++IS LL E+++IKQE+ANEK
Sbjct: 682 KKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEK 741

Query: 675 TQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEEQITQ 734
            +L +ITK+LE ER+AH                                    HEE++ +
Sbjct: 742 LKLGSITKKLESERQAHEEQLKLEAEERERKEKDLLGKQREEHEAVAAGLKKQHEEELRK 801

Query: 735 VKKTYNDQLTELQDKLAAEEKELETVK 761
           +K+ Y  +L EL++  + +  E E  K
Sbjct: 802 MKQDYEKRLQELKEHQSKQTAEAEATK 828

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 52  EWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAK 111
           E+ SPFR ++        RL       ++FPTVS  S +SK  PK+LGY+ + + ++RAK
Sbjct: 68  EFASPFRLESNEKDAEKRRL-------QRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAK 120

Query: 112 DIRFPTYLTQNEERQYQXXXXXXXXXXXXQYLKKCQKITDLT 153
           DI+FP YL +NE RQ Q             Y+K  Q + D T
Sbjct: 121 DIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  227 bits (578), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 128/317 (40%), Positives = 202/317 (63%), Gaps = 6/317 (1%)

Query: 376 PIDPSKAPKVPFQE-RPRKGKTGIFALWXXXXXXXXXXXXXXXPSNPVATPEKPELIVKT 434
           PI+P +AP +     +P+   TGI A++                 NP+++PE PE ++KT
Sbjct: 314 PINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSK----NPMSSPENPEYVIKT 369

Query: 435 KEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDS 494
           K+HGYLSKAVYDK+ YD+ VHQ WL +L   E+ KY  K  EYE+ L D+Q++ID + D 
Sbjct: 370 KQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDL 429

Query: 495 MKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQT 554
           M  ++ +TS+KIEV + +LVK I+D+   HN+ K  IFK+TE MK +KL  K   ++KQ 
Sbjct: 430 MDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQA 489

Query: 555 NVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQ 614
            ++ +I+ L+ E+T V  DFN+W + L+ ++ QLDA+I  I   N ++  ++ E+  L  
Sbjct: 490 EIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNI 549

Query: 615 KKNALVTQTQENEKLHEKNVQVLESVENRE-YLPQINDIDNQISTLLNEMTIIKQENANE 673
            K  L  + ++NE++H+ N ++L  +  R+ YLP+IN+IDN+I+  L +++ IK+E   E
Sbjct: 550 SKMELEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEE 609

Query: 674 KTQLSAITKRLEDERRA 690
             +L+ +TK+LEDER A
Sbjct: 610 NNRLTILTKKLEDERIA 626

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 69/128 (53%), Gaps = 13/128 (10%)

Query: 36  YQFLQKVVSNEPKGKEEWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQP 95
           +  L+KVVS +     E++SPFR  +     N    Y +  K  +FPTVSA+S +S+  P
Sbjct: 23  HSMLKKVVSRDHNV--EYVSPFRDPSNVQAAN----YAKAKKMERFPTVSASSHFSRMSP 76

Query: 96  KDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQXXXXXXXXXXXXQYLKKCQKITDLTKD 155
            +LGYKNI K+ KRAKDI FP++L  NE RQ              +YL+  Q +      
Sbjct: 77  NELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILL----- 131

Query: 156 EKNDNGTA 163
             N+NGT+
Sbjct: 132 --NENGTS 137

 Score = 35.0 bits (79), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 64/123 (52%), Gaps = 22/123 (17%)

Query: 735 VKKTYNDQLTELQDKLAAEEKELETVKREKT-----------RLQGEK-AIEEQTRQRNA 782
           V+K Y  ++ E+ +++A   ++L T+K+E             +L+ E+ A E + R +N 
Sbjct: 577 VRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENEIRLKN- 635

Query: 783 DEALKQE---ILSKQHKQAEGLHAAERYKIPNDH----PQKNKNV-VPKDDSLYEYHTEE 834
            E LK+E    L KQ  + +  H  E  +I   +     Q+ K V +P D+SLYEY TEE
Sbjct: 636 -EKLKREQEQKLQKQLAELKAKHNEELLEIQKKYEKKMAQQPKAVELPTDNSLYEYVTEE 694

Query: 835 DVM 837
           +V 
Sbjct: 695 EVF 697

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  221 bits (564), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 114/266 (42%), Positives = 180/266 (67%), Gaps = 1/266 (0%)

Query: 426 EKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQ 485
           E PE +VKTK+ GYL+K +YDKI   ++ H  W+   +  E+ K+D K  E   K+  L+
Sbjct: 346 ENPEHVVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLR 404

Query: 486 NQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEE 545
            QI E+++ M  +R +T  KIEVS+N L ++  ++   H  KK  +FKDTE +K+QKL E
Sbjct: 405 AQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSE 464

Query: 546 KNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKV 605
           K+ VL+KQ  V+ +IDELN EK  V+++   WT ++  LS ++DA++  + ++N+KQ   
Sbjct: 465 KDSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNT 524

Query: 606 QDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTI 665
           Q+EI+ L+Q+K  ++ Q ++N   H +N +V+E  +N+ YLP++N++DNQIS LL ++T 
Sbjct: 525 QEEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTT 584

Query: 666 IKQENANEKTQLSAITKRLEDERRAH 691
           I+Q  ANE+T+LSAITK+L+ ER  H
Sbjct: 585 IRQHCANERTELSAITKKLDKERLEH 610

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 58/101 (57%), Gaps = 11/101 (10%)

Query: 49  GKEEWISPFR--QDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKN 106
           G+ +++SPFR  Q+ L++++          + ++FPT SA SAY   +P++LGYK I   
Sbjct: 36  GERDYVSPFRDEQEVLSAQRR---------RTQRFPTTSAASAYVNARPEELGYKKIGAG 86

Query: 107 AKRAKDIRFPTYLTQNEERQYQXXXXXXXXXXXXQYLKKCQ 147
            KRAKDI FP YL + E++Q +            +YLK CQ
Sbjct: 87  EKRAKDISFPVYLEEIEKKQLELLRELEVKEAHLRYLKDCQ 127

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 28/121 (23%)

Query: 742 QLTELQDKLAAEEKELETV--KREKTRLQGEKAIEEQTRQRNADEALKQEILSKQHKQAE 799
           QLT ++   A E  EL  +  K +K RL+ E+ ++ +   R   E   +++L KQ K+ E
Sbjct: 581 QLTTIRQHCANERTELSAITKKLDKERLEHEEKLKLEAENRRRKE---EDLLGKQRKELE 637

Query: 800 GL-------HAAERYKIPNDHPQ----------KNKNVVP------KDDSLYEYHTEEDV 836
                    H  E  K+  D+ Q          + K+ +       KDDSLYEY TEE++
Sbjct: 638 AKAQEAREKHEQEMQKLKTDYTQLEGKFKREQQQKKDALAFAHEPTKDDSLYEYGTEEEI 697

Query: 837 M 837
           +
Sbjct: 698 L 698

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  198 bits (504), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 112/274 (40%), Positives = 183/274 (66%), Gaps = 1/274 (0%)

Query: 419 SNPVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYE 478
           ++ VA+PE PE +V+T E+  +SKAVYD++NY++K+H  WL +  A E  KY+ K +EYE
Sbjct: 312 THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE 371

Query: 479 EKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENM 538
           +KL +LQ Q+D++E+  K    +  +KIE+ + +LVK ++DV + +N  K  + K+TE M
Sbjct: 372 DKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELM 431

Query: 539 KNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQI 598
           K QK+  K  +L KQ +VK++I++LN+EK  +  ++N W  NL NL+  LD +I KI  I
Sbjct: 432 KLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAI 491

Query: 599 NLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVE-NREYLPQINDIDNQIS 657
           N    ++Q +I+ L+ KK  L  + +++E+  + N  VL+ +   ++YLP++N+ID QI+
Sbjct: 492 NENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIA 551

Query: 658 TLLNEMTIIKQENANEKTQLSAITKRLEDERRAH 691
              +++ IIK E  +E  QLS +TK+LE+ER AH
Sbjct: 552 AKFDKLAIIKNETISENNQLSILTKKLEEERIAH 585

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 67/120 (55%), Gaps = 9/120 (7%)

Query: 38  FLQKVVSNEPKGKEEWISPFR--QDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQP 95
           FL + +S + +  E +ISPFR  QD + S       Y +  K +KFPT SATS ++K  P
Sbjct: 23  FLTRHISRKSENTE-YISPFRNPQDTVRSN------YAKSLKEKKFPTTSATSNFNKMVP 75

Query: 96  KDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQXXXXXXXXXXXXQYLKKCQKITDLTKD 155
            ++GY ++ KN KRAKDI+FP YL  NE+RQ Q              L+K  ++  L +D
Sbjct: 76  GEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVLDED 135

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score =  152 bits (385), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 168/272 (61%), Gaps = 2/272 (0%)

Query: 419 SNPVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYE 478
           +NP AT + PEL++K  ++G++S AV++K+ YD+KVH+A + D +  +++K+  K +EYE
Sbjct: 296 TNPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYE 355

Query: 479 EKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENM 538
           +KL  + ++   V   M   + +   K EV +N+ +KQ+ D NA  N+ K+ +  + + +
Sbjct: 356 QKLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLV 415

Query: 539 KNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQI 598
           K QKL++   +  K+T ++ ++++L  EK++ +KD++ WTTNL+N++++LDAQ+FK++Q 
Sbjct: 416 KLQKLQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQF 475

Query: 599 NLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLP--QINDIDNQI 656
           N KQ K+  +I  L Q+K  L  +   N+       + L  +E  ++L   ++  + + I
Sbjct: 476 NHKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSI 535

Query: 657 STLLNEMTIIKQENANEKTQLSAITKRLEDER 688
              L+ + ++KQE + E+ +L  IT  +E  R
Sbjct: 536 QGKLDSLAVVKQEISGERLKLIGITNEMERAR 567

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 61/103 (59%), Gaps = 3/103 (2%)

Query: 51  EEWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRA 110
           EE++SPFR   L +K +  +L ++  + +KFPTVSATS Y+    ++LG+  +  + +RA
Sbjct: 46  EEYVSPFRGGQL-TKASKKQLQLQ--RTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRA 102

Query: 111 KDIRFPTYLTQNEERQYQXXXXXXXXXXXXQYLKKCQKITDLT 153
           +DI FP YL +NE+RQ               +L++CQ + D T
Sbjct: 103 RDIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRT 145

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score =  145 bits (365), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 93/311 (29%), Positives = 171/311 (54%), Gaps = 18/311 (5%)

Query: 375 VPIDPSKAPKVPFQERPRKGKTGIFALWXXXXXXXXXXXXXXXPSNPVATPEKPELIVKT 434
           VP    K  + PF    +  K GIFALW               P    ATPE PE IV T
Sbjct: 289 VPPTKQKGHRGPF----KFSKKGIFALWKRSEK----------PEKLNATPEDPEFIVLT 334

Query: 435 KEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDS 494
            E GY+SK +YD++ Y+E++HQ  L  L     AKY+   + YEEKL  L N+I EV  +
Sbjct: 335 -EKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAA 393

Query: 495 MKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQT 554
           M  ++ +T  +++  +  L + ++D+ A H+ +K  + K+ EN KN K+ EKN +  K T
Sbjct: 394 MDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLT 453

Query: 555 NVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQ 614
            V+ +++ L   +   + +   + + +  L+ +LDA++ ++  ++ +Q++V   + +LE+
Sbjct: 454 QVEPELEALKRLELERKVELQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEE 513

Query: 615 KKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEK 674
           ++  +     E+  +   N ++L+++EN    P I  +DNQ+S +   ++ ++QE+A +K
Sbjct: 514 RRVQIEKDISESNAVVANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQK 570

Query: 675 TQLSAITKRLE 685
            +L+ ++ + E
Sbjct: 571 DELTELSTKKE 581

 Score = 38.5 bits (88), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 66/166 (39%), Gaps = 41/166 (24%)

Query: 2   LFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPK------------G 49
           +F  N+Q  DPF +L++           + K    +   K V+N  K            G
Sbjct: 4   IFKKNKQ-PDPFKELLDNE---------EDKHGTTELFVKKVTNHRKASEDDGTQGNVEG 53

Query: 50  KEEWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKR 109
             E++SPFR D   ++        E  ++ KFPT   T  +S  + KD        N KR
Sbjct: 54  GGEYVSPFRDDKAVAE-------AERIRDLKFPT---TGHHSTVRVKD--------NVKR 95

Query: 110 -AKDIRFPTYLTQNEERQYQXXXXXXXXXXXXQYLKKCQKITDLTK 154
            A+DI  P      + +Q +            +YL+  QKI D+ K
Sbjct: 96  KAQDIAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDVRK 141

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score =  113 bits (283), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/271 (29%), Positives = 152/271 (56%), Gaps = 21/271 (7%)

Query: 421 PVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEK 480
           PVA+PE  E +VK      +SK VYDKI +D KV+  ++   +  +  K +    EY EK
Sbjct: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306

Query: 481 LQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKN 540
           ++ +Q +  +  + ++ +  E+    EV +N+LVK ++D  A  ++ K+ I + T  +K 
Sbjct: 307 IKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366

Query: 541 QKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINL 600
           QKL E   +  K+  ++ + + +N EK + + +FN    +L+ + Q+LDA++FK++Q N+
Sbjct: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426

Query: 601 KQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLP-------QINDID 653
           +   ++ EI+ L+ KK  L+ +              ++S+E ++  P       ++N++D
Sbjct: 427 RNENLEHEINKLQSKKQTLLDE--------------IDSIEYKKLHPDDDSKQLELNEMD 472

Query: 654 NQISTLLNEMTIIKQENANEKTQLSAITKRL 684
            QI++ L+ + +IKQE  NEK ++S +T  L
Sbjct: 473 EQINSKLSNLNLIKQEIINEKLKISKLTNDL 503

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 72/122 (59%), Gaps = 12/122 (9%)

Query: 10  DDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEE---WISPFRQDALASKQ 66
           D+ F +L+++++    +  A++    +QFL KV +N+ K  ++   + SPFR +A + +Q
Sbjct: 9   DEAFDKLLSETTSVKTTDTAKK----HQFLSKVNTNKSKENDDENKYNSPFRNNAPSREQ 64

Query: 67  NNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQ 126
              +  ++D K  KFP VSATS Y+    KD+ YK++      A+DI+FP+ L  NE RQ
Sbjct: 65  ---KKQLQDLKTAKFPLVSATSTYN-TDTKDV-YKDLDPKKNFARDIKFPSRLIDNENRQ 119

Query: 127 YQ 128
            Q
Sbjct: 120 NQ 121

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 94.0 bits (232), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 146/263 (55%), Gaps = 1/263 (0%)

Query: 421 PVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEK 480
           P  TPE+PE+++ T   GY+SKAVYD++N +EK H   L +        Y   ++ YE++
Sbjct: 279 PNGTPEEPEVVLLTN-RGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337

Query: 481 LQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKN 540
           + DL  +I ++   + A++ ET  +I+  +  L K I D+ A + +K+ ++ +  E  + 
Sbjct: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHEQAEAQRA 397

Query: 541 QKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINL 600
           ++L +K  ++++   ++ +ID L   K N   +  +    +  L QQLDAQ  ++  +  
Sbjct: 398 EQLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTD 457

Query: 601 KQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLL 660
           +Q++V   + +L+++K  L  +  ++ +  ++N + LE +   +Y   + +ID + S +L
Sbjct: 458 QQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEIL 517

Query: 661 NEMTIIKQENANEKTQLSAITKR 683
            E+  I+QE   ++ +L A+ +R
Sbjct: 518 TEIAKIRQEIEFQRKELVALKER 540

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 69/135 (51%), Gaps = 12/135 (8%)

Query: 18  NQSSENGQSKQAQQKENPYQFLQKVVSNEP---KGKEEWISPFRQDALASKQNNNRLYVE 74
           N+  +NG +   +    P   LQ  +++     KGK+ + SPFR     S  N       
Sbjct: 23  NKKRKNGNTDSVE----PSDVLQTAINSHTLHGKGKQ-YKSPFRDTQTPSNMN----VAL 73

Query: 75  DAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQXXXXXX 134
             KN ++PT+SATS YS   P+DLGYKNI  + KRAKDI FP  L +NE RQ +      
Sbjct: 74  KKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQDKLFAQLT 133

Query: 135 XXXXXXQYLKKCQKI 149
                  YL+K QK+
Sbjct: 134 EKESQLDYLQKSQKL 148

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 109/207 (52%), Gaps = 26/207 (12%)

Query: 420 NPVATPEKPELIVKTKEHG---YLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKE 476
           NP ATP+ PEL+VKT+ +     LSK+VYD +NY+ KVH   + D       KY  KN+E
Sbjct: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEE 435

Query: 477 YEEKLQDLQNQIDEVEDSMKAMRKETSE---KIEVSKNRLV-KQIIDVNAAHNNKKLMIF 532
           +        N I+E++  +K++ K+  +   KI+   N  V K  ID+   H  +K++I 
Sbjct: 436 F-------NNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIENYH--EKMLIK 486

Query: 533 KDTENMKNQKLEEKNVVLNKQTNVKSQIDELN-----SEKTNVQKDFNDWTTNLSNLSQQ 587
           K+    KN   +E   +L  Q++  +    L+     +++++      DW +  S L++Q
Sbjct: 487 KNQIIKKN---DEITYIL--QSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQ 541

Query: 588 LDAQIFKINQINLKQSKVQDEIDSLEQ 614
           +D+++  I Q+N   + V+ +I  L +
Sbjct: 542 IDSKVNVIKQLNKNLADVKQKITELSE 568

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 75/167 (44%), Gaps = 24/167 (14%)

Query: 376 PIDPSKAPKVPFQERPRKGKTGIFALWXXXXXXXXXXXXXXXPSNPVATPEKPELIVKTK 435
           P+D  K PK+P+ E  +  +                        NPVATPE PE +V  K
Sbjct: 96  PVDIQKVPKIPYSEYGQCNEAEF--------------------RNPVATPETPEEVVIYK 135

Query: 436 E----HGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEV 491
                +   SK ++D I  D   H AWL     +   +   K +EY ++L  L +QI   
Sbjct: 136 HLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSE 195

Query: 492 EDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENM 538
           + +M  +R++    I++++NRL K  +        +K  I+K+TE +
Sbjct: 196 KAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKETERL 242

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 77  KNRKFPTVSATSAYSKQQPKDLGYKN-IPKNAKRAKDIRFPTYLTQNEERQYQXXXXXXX 135
           K +  P  +  S+Y+  +P++LGYK   PK  K A++I FP  LT+NE RQ         
Sbjct: 9   KRKSSPISNPHSSYNTLKPEELGYKQKFPK--KYAREIHFPAELTENEMRQRAILQDLDE 66

Query: 136 XXXXXQYLKKCQKITDLTK 154
                 +LKK Q++  + K
Sbjct: 67  KEQHLDHLKKSQRVVYIDK 85

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 78/157 (49%), Gaps = 23/157 (14%)

Query: 5   INRQNDDPFTQLINQSSENGQSKQAQQKENPYQ-FLQKVVSNEPKGKEEWISPFRQDALA 63
           +N   DD F +++         K+ ++ +NP++ FL+  ++++ K    + SPFR++   
Sbjct: 3   VNYYADDRFIEVL---------KEQERAKNPHRNFLKDTIAHDAK----YQSPFRRNI-- 47

Query: 64  SKQNNNRL-YVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIP---KNAKRAKDIRFPTYL 119
              N N L Y+ + KN K+   +  S ++K     +GYK IP   K+ K AKDI FP  L
Sbjct: 48  ---NPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSL 104

Query: 120 TQNEERQYQXXXXXXXXXXXXQYLKKCQKITDLTKDE 156
            +NEE Q              ++LK  Q +  + +D+
Sbjct: 105 RENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDEDD 141

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 68/127 (53%), Gaps = 4/127 (3%)

Query: 420 NPVATPE-KPELIVKTKEHG---YLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNK 475
           N +ATP+ K ++IV  K+ G   Y SK V+D I Y+ K+H   L  L A+   ++ +K  
Sbjct: 183 NSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKIN 242

Query: 476 EYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDT 535
           EY+ ++ +L  +ID   + ++ +  + S   + S  +  K  +     +NN K  ++ + 
Sbjct: 243 EYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEI 302

Query: 536 ENMKNQK 542
           E +KNQ+
Sbjct: 303 EAIKNQR 309

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 63/119 (52%), Gaps = 2/119 (1%)

Query: 418 PSNPVATPEKPELIVKTKEH--GYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNK 475
           P  P+ATP+ PE++V+  E+    +SK  YD++   +  H AWL    A   A Y+ +++
Sbjct: 177 PKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQ 236

Query: 476 EYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKD 534
            Y++++  L  +I   ++    +  +     E++KN+ + +   +N     +K+++ K+
Sbjct: 237 WYQKQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQINKLIGEEKILLMKN 295

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 57/113 (50%), Gaps = 1/113 (0%)

Query: 420 NPVATPEKPELIVKTKE-HGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYE 478
           NP+AT   PE+++K  +    ++K  YDK+    + H  W+ +        Y+ K K Y+
Sbjct: 383 NPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQ 442

Query: 479 EKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMI 531
           EKL  L  QI+     +  ++K+T +  E++   L  +   + +  N++K ++
Sbjct: 443 EKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQLFSLLNHEKYVL 495

>NCAS0A14940 Chr1 (2941337..2945347) [4011 bp, 1336 aa] {ON}
           Anc_7.488 YBL047C
          Length = 1336

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 91/208 (43%), Gaps = 23/208 (11%)

Query: 429 ELIVKTKEHGYLSKAVYDKINYDEKVH----QAWLT-DLRAR---EKAKYDAKNKEYEEK 480
           +L   ++    LS A  +  N   +V+    QA +T D +AR   E  + +      E K
Sbjct: 557 DLFADSQASAQLSSATTELANLSNQVNSLSKQATITNDKKARAAQELKRVNDMKASIENK 616

Query: 481 LQDLQNQIDEVEDSMKAMRKETSEKIEVSK-NRLVKQIIDVNAAHNNKKLMIFKDTENMK 539
           L  L+   D   D+MK      S+ +E +K    +KQ + V  A+       +   E+  
Sbjct: 617 LSTLRKTHD---DNMKQTEVLESQLLESNKQTETLKQQLGVTEAN-------YHAIESKL 666

Query: 540 NQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLD--AQIFKINQ 597
           N+   E        TN+K QI  LNS    +Q   N+   N+      +D  ++  ++ Q
Sbjct: 667 NELTTELTTAQESNTNLKDQIANLNSMTATLQTQLNEKQQNVRQQRSMVDVNSKQLEVGQ 726

Query: 598 INLKQSKVQDEIDSLEQKKNALVTQTQE 625
           INLK   +Q EID L++K    +T+  E
Sbjct: 727 INLK--SMQTEIDGLDEKLQVYLTKQNE 752

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 66/133 (49%), Gaps = 15/133 (11%)

Query: 561 DELNSEKTNV----QKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQKK 616
           DEL+  K +V    ++ + DW       S +    IF +N +     K  +EI + ++++
Sbjct: 241 DELSFRKGDVIRVMEQVYRDWWRG----SLRGKIGIFPLNYVTPVTDKTLEEICAEKRQE 296

Query: 617 NALVTQTQENEKLHEKNVQVLESVENREYL---PQINDIDNQISTLLNEMTIIKQENANE 673
           +A+++Q  +  +LH    Q + +  N   L   PQ+ND+ + ++ L  ++T +    A +
Sbjct: 297 DAILSQYNKVNELH----QTMRAGSNDVNLTQDPQVNDLYSTVTPLRPQLTKMIGTCAQK 352

Query: 674 KTQLSAITKRLED 686
           +   S++ K L D
Sbjct: 353 REDYSSLRKVLAD 365

>Ecym_3006 Chr3 complement(11788..13965) [2178 bp, 725 aa] {ON}
           similar to Ashbya gossypii ACR023W
          Length = 725

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 68/142 (47%), Gaps = 6/142 (4%)

Query: 477 YEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTE 536
           YE+  + L + I+ +E S+K + K    +IEV KNR +  +  +    N+K   I +  +
Sbjct: 223 YEDYCR-LYDTIEPIETSLKEILKG---RIEVFKNRDIINLDYLMRLLNHKYNNILEKYD 278

Query: 537 NMKNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKIN 596
               Q +  K  +++K+ +V  +   LN+E  ++  D  D   +LSN S  +D +   + 
Sbjct: 279 YFYAQLMNLKANIIDKRWDVLFK--NLNAELLSIITDVTDLLDDLSNTSISVDTRDIILQ 336

Query: 597 QINLKQSKVQDEIDSLEQKKNA 618
           Q+  K   +    D + Q  +A
Sbjct: 337 QVAQKSETISKTFDVIYQAIDA 358

>Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON}
           (76145..79804) [3660 nt, 1220 aa]
          Length = 1219

 Score = 32.3 bits (72), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 4/111 (3%)

Query: 578 TTNLSNLSQ-QLDAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQV 636
           TTNL  LS  ++D   F+I QI+     +++ I+SL+  +N L     + E L+  NV+ 
Sbjct: 141 TTNLGWLSALEIDMHYFQI-QISDTLDYIKNIIESLKICQNYLELYCYDVENLYNSNVKF 199

Query: 637 LESVENREYLPQ-INDIDNQISTLLNEMTIIKQENANEKTQLSAITKRLED 686
           L  + N E L   +N  DN I T L+++   K  +   K +L +I+ ++E+
Sbjct: 200 LNQLANNEILKNWLNYYDN-ILTKLSDINGNKLSSYLNKNELVSISSKIEE 249

>Smik_13.388 Chr13 complement(611342..612229) [888 bp, 295 aa] {ON}
           YMR183C (REAL)
          Length = 295

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 49/92 (53%), Gaps = 7/92 (7%)

Query: 565 SEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQTQ 624
           +E   +Q+D N+  T  S+ S    A + KIN IN   S+ +  I+S++ +   L+TQ  
Sbjct: 14  AENYEMQEDLNNVPTGHSDGSDDFVAFMNKINSINANLSRYESIINSIDAQHKDLLTQVS 73

Query: 625 ENEKLHEKNVQVLESVENREYLPQINDIDNQI 656
           E     E+ +++  S++  +Y+ Q  D+  Q+
Sbjct: 74  E-----EQEMELRRSLD--DYISQATDLQYQL 98

>YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essential
            protein involved in the vesicle-mediated ER to Golgi
            transport step of secretion; binds membranes and
            functions during vesicle docking to the Golgi; required
            for assembly of the ER-to-Golgi SNARE complex
          Length = 1790

 Score = 32.0 bits (71), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 32/43 (74%)

Query: 728  HEEQITQVKKTYNDQLTELQDKLAAEEKELETVKREKTRLQGE 770
            +EEQI   ++ YN+++++L D++ + ++E E++K++   L+GE
Sbjct: 1164 YEEQIANKERQYNEEISQLNDEITSTQQENESIKKKNDELEGE 1206

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.122    0.324 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,557,456
Number of extensions: 3249898
Number of successful extensions: 26015
Number of sequences better than 10.0: 1861
Number of HSP's gapped: 25691
Number of HSP's successfully gapped: 3058
Length of query: 839
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 721
Effective length of database: 39,950,811
Effective search space: 28804534731
Effective search space used: 28804534731
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 70 (31.6 bits)