Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2253.490ON2131969941e-138
YGR129W (SYF2)3.490ON2151987331e-98
Skud_7.4403.490ON2131956766e-90
Suva_7.4173.490ON2121966627e-88
NCAS0E008203.490ON2021962942e-32
TDEL0D055803.490ON1931962915e-32
Kpol_480.153.490ON2071932778e-30
ZYRO0D10032g3.490ON2091952664e-28
NDAI0G009503.490ON2132062648e-28
SAKL0F02816g3.490ON1921912393e-24
CAGL0I10538g3.490ON2001902323e-23
KLTH0F14784g3.490ON1951962132e-20
Ecym_12393.490ON1931931983e-18
Kwal_55.212263.490ON1962011958e-18
KLLA0E04643g3.490ON2211911923e-17
AFR308W3.490ON1921951773e-15
TBLA0C044703.490ON2222041643e-13
TPHA0D042403.490ON2091981521e-11
KNAG0B008203.490ON207781081e-05
KAFR0A042608.748ON306198850.018
ZYRO0G14652g5.696ON67183850.023
Kpol_1060.365.145ON743159850.024
KAFR0C019503.490ON157102810.032
KAFR0A031007.528ON317147810.059
Kpol_1048.162.146ON505140790.12
KLLA0E09549g5.228ON308157780.14
SAKL0H24200g4.46ON963197780.18
ZYRO0D01254g7.528ON33289770.19
KAFR0B056508.306ON73358770.24
TPHA0C044407.186ON1170108770.25
YGR238C (KEL2)5.88ON882177760.32
KNAG0K010103.144ON15845730.37
TDEL0B022605.696ON66288750.41
SAKL0E14740g5.696ON67980750.42
Skud_9.245.696ON69097750.42
Kpol_480.143.492ON699107750.42
TPHA0B028408.617ON70287750.42
TPHA0D017505.296ON881162750.43
Ecym_83744.46ON914165750.43
KAFR0H002105.702ON1454218750.45
KLTH0E13200g8.568ON482109740.52
TPHA0C003405.629ON66796730.74
TPHA0H014205.696ON703127730.74
Kpol_489.85.696ON70592730.74
KAFR0C011303.144ON14545700.82
KNAG0J026401.227ON664219720.98
NDAI0A061403.58ON68489720.99
Smik_7.3341.357ON611125711.3
Kpol_520.354.327ON971186711.4
Smik_9.255.696ON69297701.8
YBR156C (SLI15)8.507ON698107701.8
Skud_6.228.4ON71481701.8
TBLA0J006905.587ON1809171701.9
Kpol_1032.253.144ON20145682.1
Suva_2.4515.296ON87790692.4
Smik_4.6225.414ON94490692.4
TBLA0E026703.144ON17641672.5
Smik_4.4038.340ON1303126692.5
CAGL0H00308g7.528ON320133682.6
YNL110C (NOP15)2.167ON220160672.9
TPHA0M004603.144ON15445662.9
Suva_14.2292.167ON222190672.9
KLTH0E07480g4.97ON53394683.0
TDEL0E015804.215ON60275683.0
AER200C3.144ON16050663.1
TDEL0D047903.144ON16345663.1
Smik_2.2968.507ON699107683.1
NDAI0B025903.144ON16450663.1
Kwal_56.226183.106ON740153683.1
NDAI0J029204.364ON759150683.1
SAKL0E00770g6.7ON1047164683.3
KLLA0C02915g1.110ON1296100683.3
CAGL0L03520g1.271ON1447149683.3
ZYRO0B12144g4.238ON2005188683.4
Kwal_14.2111singletonOFF5849613.7
TPHA0F019402.129ON506123673.9
CAGL0I08085g3.144ON15345653.9
Kpol_1029.32.167ON22476664.0
KLLA0B02981g4.268ON66396674.1
KAFR0D022705.696ON70998674.1
NCAS0I011803.343ON76457674.2
CAGL0E03454g4.46ON867121674.2
TDEL0B027805.645ON1030118674.3
TBLA0B099704.46ON1065200674.3
NDAI0A046303.460ON145293674.4
KLTH0D09262g2.167ON223181655.3
KLLA0C16401g7.330ON612143665.4
SAKL0D07612g1.373ON79731665.6
YGR130C3.492ON816176665.6
NCAS0A115403.432ON86996665.7
TPHA0B013807.462ON1155125665.8
Suva_9.395.702ON1682108665.9
NDAI0K009508.753ON173080665.9
Skud_4.5215.619ON379170656.5
TPHA0K020704.37ON38194656.5
KAFR0J025106.320ON424107656.7
NCAS0B087301.71ON22987647.2
TDEL0A011002.69ON661175657.3
Kpol_1004.545.577ON66553657.3
NCAS0D036706.188ON687163657.3
Smik_15.873.144ON15850637.4
NDAI0A033004.100ON91584657.6
YOL071W (EMI5)3.144ON16276637.6
NCAS0E011303.433ON102198657.6
NCAS0A148007.463ON1072137657.7
KNAG0G033308.824ON112878657.7
Smik_4.7891.52ON1136159657.7
TPHA0H009202.44ON42948649.0
TBLA0G003802.45ON470112649.1
AGR196W8.568ON48034649.2
SAKL0H09372g8.568ON48232649.2
Suva_13.2942.433ON50569649.3
Skud_13.2742.433ON50568649.3
ZYRO0D06886g8.274ON54074649.4
KLLA0F19602g8.283ON60361649.5
Skud_6.1071.357ON61165649.6
KLTH0F17908g5.680ON621105649.6
SAKL0H05852g8.704ON869806410.0
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Smik_6.225
         (642 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...   387   e-138
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...   286   1e-98
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...   265   6e-90
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...   259   7e-88
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...   117   2e-32
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....   116   5e-32
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...   111   8e-30
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...   107   4e-28
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...   106   8e-28
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...    97   3e-24
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    94   3e-23
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    87   2e-20
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    81   3e-18
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    80   8e-18
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    79   3e-17
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    73   3e-15
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    68   3e-13
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    63   1e-11
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    46   1e-05
KAFR0A04260 Chr1 complement(848354..849274) [921 bp, 306 aa] {ON...    37   0.018
ZYRO0G14652g Chr7 complement(1172048..1174063) [2016 bp, 671 aa]...    37   0.023
Kpol_1060.36 s1060 (86412..88643) [2232 bp, 743 aa] {ON} (86412....    37   0.024
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    36   0.032
KAFR0A03100 Chr1 complement(634622..635575) [954 bp, 317 aa] {ON...    36   0.059
Kpol_1048.16 s1048 (53728..55245) [1518 bp, 505 aa] {ON} (53728....    35   0.12 
KLLA0E09549g Chr5 complement(845298..846224) [927 bp, 308 aa] {O...    35   0.14 
SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa]...    35   0.18 
ZYRO0D01254g Chr4 complement(95493..96491) [999 bp, 332 aa] {ON}...    34   0.19 
KAFR0B05650 Chr2 (1163855..1166056) [2202 bp, 733 aa] {ON} Anc_8...    34   0.24 
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    34   0.25 
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    34   0.32 
KNAG0K01010 Chr11 (197551..198027) [477 bp, 158 aa] {ON} Anc_3.1...    33   0.37 
TDEL0B02260 Chr2 (408913..410901) [1989 bp, 662 aa] {ON} Anc_5.6...    33   0.41 
SAKL0E14740g Chr5 complement(1216985..1219024) [2040 bp, 679 aa]...    33   0.42 
Skud_9.24 Chr9 (55176..57248) [2073 bp, 690 aa] {ON} YIL144W (REAL)    33   0.42 
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...    33   0.42 
TPHA0B02840 Chr2 complement(647976..650084) [2109 bp, 702 aa] {O...    33   0.42 
TPHA0D01750 Chr4 complement(359929..362574) [2646 bp, 881 aa] {O...    33   0.43 
Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}...    33   0.43 
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...    33   0.45 
KLTH0E13200g Chr5 complement(1171972..1173420) [1449 bp, 482 aa]...    33   0.52 
TPHA0C00340 Chr3 (56190..58193) [2004 bp, 667 aa] {ON} Anc_5.629...    33   0.74 
TPHA0H01420 Chr8 complement(318539..320650) [2112 bp, 703 aa] {O...    33   0.74 
Kpol_489.8 s489 (26766..28883) [2118 bp, 705 aa] {ON} (26766..28...    33   0.74 
KAFR0C01130 Chr3 complement(229329..229766) [438 bp, 145 aa] {ON...    32   0.82 
KNAG0J02640 Chr10 (491289..493283) [1995 bp, 664 aa] {ON} Anc_1....    32   0.98 
NDAI0A06140 Chr1 complement(1394748..1396802) [2055 bp, 684 aa] ...    32   0.99 
Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W ...    32   1.3  
Kpol_520.35 s520 (87263..90178) [2916 bp, 971 aa] {ON} (87263..9...    32   1.4  
Smik_9.25 Chr9 (55776..57854) [2079 bp, 692 aa] {ON} YIL144W (REAL)    32   1.8  
YBR156C Chr2 complement(551104..553200) [2097 bp, 698 aa] {ON}  ...    32   1.8  
Skud_6.22 Chr6 (43649..45793) [2145 bp, 714 aa] {ON} YFL047W (REAL)    32   1.8  
TBLA0J00690 Chr10 (157822..163251) [5430 bp, 1809 aa] {ON} Anc_5...    32   1.9  
Kpol_1032.25 s1032 complement(53514..54119) [606 bp, 201 aa] {ON...    31   2.1  
Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W ...    31   2.4  
Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356...    31   2.4  
TBLA0E02670 Chr5 complement(674590..675120) [531 bp, 176 aa] {ON...    30   2.5  
Smik_4.403 Chr4 (729902..733813) [3912 bp, 1303 aa] {ON} YDR159W...    31   2.5  
CAGL0H00308g Chr8 complement(22157..23119) [963 bp, 320 aa] {ON}...    31   2.6  
YNL110C Chr14 complement(417826..418488) [663 bp, 220 aa] {ON}  ...    30   2.9  
TPHA0M00460 Chr13 complement(87266..87730) [465 bp, 154 aa] {ON}...    30   2.9  
Suva_14.229 Chr14 complement(414648..415316) [669 bp, 222 aa] {O...    30   2.9  
KLTH0E07480g Chr5 complement(687623..689224) [1602 bp, 533 aa] {...    31   3.0  
TDEL0E01580 Chr5 (310526..312334) [1809 bp, 602 aa] {ON} Anc_4.2...    31   3.0  
AER200C Chr5 complement(1012538..1013020) [483 bp, 160 aa] {ON} ...    30   3.1  
TDEL0D04790 Chr4 complement(876408..876899) [492 bp, 163 aa] {ON...    30   3.1  
Smik_2.296 Chr2 complement(537111..539210) [2100 bp, 699 aa] {ON...    31   3.1  
NDAI0B02590 Chr2 complement(647421..647915) [495 bp, 164 aa] {ON...    30   3.1  
Kwal_56.22618 s56 complement(207409..209631) [2223 bp, 740 aa] {...    31   3.1  
NDAI0J02920 Chr10 complement(730198..732477) [2280 bp, 759 aa] {...    31   3.1  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...    31   3.3  
KLLA0C02915g Chr3 (261280..265170) [3891 bp, 1296 aa] {ON} simil...    31   3.3  
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    31   3.3  
ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] ...    31   3.4  
Kwal_14.2111 s14 (610460..610636) [177 bp, 58 aa] {OFF} [contig ...    28   3.7  
TPHA0F01940 Chr6 (437533..439053) [1521 bp, 506 aa] {ON} Anc_2.1...    30   3.9  
CAGL0I08085g Chr9 (790086..790547) [462 bp, 153 aa] {ON} similar...    30   3.9  
Kpol_1029.3 s1029 complement(3577..4251) [675 bp, 224 aa] {ON} c...    30   4.0  
KLLA0B02981g Chr2 complement(267798..269789) [1992 bp, 663 aa] {...    30   4.1  
KAFR0D02270 Chr4 (459308..461437) [2130 bp, 709 aa] {ON} Anc_5.6...    30   4.1  
NCAS0I01180 Chr9 (212245..214539) [2295 bp, 764 aa] {ON} Anc_3.3...    30   4.2  
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    30   4.2  
TDEL0B02780 Chr2 (495985..499077) [3093 bp, 1030 aa] {ON} Anc_5....    30   4.3  
TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa]...    30   4.3  
NDAI0A04630 Chr1 complement(1039623..1043981) [4359 bp, 1452 aa]...    30   4.4  
KLTH0D09262g Chr4 (769384..770055) [672 bp, 223 aa] {ON} similar...    30   5.3  
KLLA0C16401g Chr3 (1435065..1436903) [1839 bp, 612 aa] {ON} simi...    30   5.4  
SAKL0D07612g Chr4 (624385..626778) [2394 bp, 797 aa] {ON} simila...    30   5.6  
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...    30   5.6  
NCAS0A11540 Chr1 complement(2283352..2285961) [2610 bp, 869 aa] ...    30   5.7  
TPHA0B01380 Chr2 (309332..312799) [3468 bp, 1155 aa] {ON} Anc_7....    30   5.8  
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...    30   5.9  
NDAI0K00950 Chr11 (215066..220258) [5193 bp, 1730 aa] {ON} Anc_8...    30   5.9  
Skud_4.521 Chr4 complement(929170..930309) [1140 bp, 379 aa] {ON...    30   6.5  
TPHA0K02070 Chr11 (442519..443664) [1146 bp, 381 aa] {ON} Anc_4....    30   6.5  
KAFR0J02510 Chr10 (477429..478703) [1275 bp, 424 aa] {ON} Anc_6....    30   6.7  
NCAS0B08730 Chr2 (1682303..1682992) [690 bp, 229 aa] {ON} Anc_1....    29   7.2  
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    30   7.3  
Kpol_1004.54 s1004 complement(117670..118272,118275..118310,1183...    30   7.3  
NCAS0D03670 Chr4 (684291..686354) [2064 bp, 687 aa] {ON} Anc_6.1...    30   7.3  
Smik_15.87 Chr15 (160826..161302) [477 bp, 158 aa] {ON} YOL071W ...    29   7.4  
NDAI0A03300 Chr1 (747732..750479) [2748 bp, 915 aa] {ON}               30   7.6  
YOL071W Chr15 (196507..196995) [489 bp, 162 aa] {ON}  EMI5Subuni...    29   7.6  
NCAS0E01130 Chr5 complement(212422..215487) [3066 bp, 1021 aa] {...    30   7.6  
NCAS0A14800 Chr1 (2918211..2921429) [3219 bp, 1072 aa] {ON} Anc_...    30   7.7  
KNAG0G03330 Chr7 (717383..720769) [3387 bp, 1128 aa] {ON} Anc_8....    30   7.7  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    30   7.7  
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    29   9.0  
TBLA0G00380 Chr7 complement(73663..75075) [1413 bp, 470 aa] {ON}...    29   9.1  
AGR196W Chr7 (1122726..1124168) [1443 bp, 480 aa] {ON} Syntenic ...    29   9.2  
SAKL0H09372g Chr8 (796939..798387) [1449 bp, 482 aa] {ON} highly...    29   9.2  
Suva_13.294 Chr13 (478757..480274) [1518 bp, 505 aa] {ON} YMR115...    29   9.3  
Skud_13.274 Chr13 (473000..474517) [1518 bp, 505 aa] {ON} YMR115...    29   9.3  
ZYRO0D06886g Chr4 (592600..594222) [1623 bp, 540 aa] {ON} simila...    29   9.4  
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    29   9.5  
Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W ...    29   9.6  
KLTH0F17908g Chr6 complement(1445723..1447320,1448299..1448566) ...    29   9.6  
SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly...    29   10.0 

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  387 bits (994), Expect = e-138
 Identities = 196/196 (100%), Positives = 196/196 (100%)
 Frame = +1

Query: 52  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 231
           VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA
Sbjct: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77

Query: 232 WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR
Sbjct: 78  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 137

Query: 412 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 591
           IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK
Sbjct: 138 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 197

Query: 592 NKQFNEKLSRESRNSE 639
           NKQFNEKLSRESRNSE
Sbjct: 198 NKQFNEKLSRESRNSE 213

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score =  286 bits (733), Expect = 1e-98
 Identities = 147/198 (74%), Positives = 170/198 (85%), Gaps = 2/198 (1%)
 Frame = +1

Query: 52  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 231
           V+VSIK+RKLADREIQE + NRKPRVY+MED+ND DESVG TES +K++AFHYT QEY A
Sbjct: 18  VDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDA 77

Query: 232 WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLA--TQDLSEYDNFVNEKDHKNISKI 405
           WE+RH Q K GQS+R GISYDQLAKLSYEKTLRNLA  TQ+ S+ D+  +E+D+KN+ K 
Sbjct: 78  WERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKK 137

Query: 406 SRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFIN 585
            RI ++QKDTKTGKI IADD KLVNKLAVSL+SESKKRYEARKRQM++A    GVESFIN
Sbjct: 138 GRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFIN 197

Query: 586 DKNKQFNEKLSRESRNSE 639
           DKNKQFNEKLSRES+ SE
Sbjct: 198 DKNKQFNEKLSRESKGSE 215

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  265 bits (676), Expect = 6e-90
 Identities = 134/195 (68%), Positives = 160/195 (82%)
 Frame = +1

Query: 52  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 231
           VNVSIKNRKLADREIQEA +NRKP+VY+MED+ND  E V   E+SDKD+AFHYT QEY A
Sbjct: 18  VNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYNA 77

Query: 232 WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           W+Q+ +QRK GQ +RSG SYDQ+AKLSYEKTLRNL TQ+ ++ +N VN+ D  +  K   
Sbjct: 78  WKQKQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNLVTQNSNKNENSVNKNDSNSSPKNGA 137

Query: 412 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 591
           I +IQ++ KTGKI I DD KLVNKLA +LESESKKRYEAR++QME+A  PS VESFINDK
Sbjct: 138 IHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFINDK 197

Query: 592 NKQFNEKLSRESRNS 636
           NKQFNEKLSRE ++S
Sbjct: 198 NKQFNEKLSREPKDS 212

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score =  259 bits (662), Expect = 7e-88
 Identities = 134/196 (68%), Positives = 161/196 (82%)
 Frame = +1

Query: 52  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 231
           V+ S+K RKLADREIQEA+ NRKPRVY+MED +D DE V  T+S DKDRAFHYT QEY A
Sbjct: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASD-DELVRETKSDDKDRAFHYTVQEYNA 76

Query: 232 WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           WEQ+  QRK G+++ +G SYDQLAKLSY+KTLRNL TQ+  ++++ VNEKD K     SR
Sbjct: 77  WEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSR 136

Query: 412 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 591
           I++IQK++ TGKIRI DD +LVNKLA +LES+SKKR++ARKRQME+   PSGVESFINDK
Sbjct: 137 IEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFINDK 196

Query: 592 NKQFNEKLSRESRNSE 639
           NKQFNEKL RESR SE
Sbjct: 197 NKQFNEKLGRESRGSE 212

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score =  117 bits (294), Expect = 2e-32
 Identities = 72/196 (36%), Positives = 108/196 (55%), Gaps = 1/196 (0%)
 Frame = +1

Query: 55  NVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDK-DRAFHYTAQEYIA 231
           + +I+NR L DRE ++   + KPRVYNM+D  D        ++ DK  +  +YT ++Y  
Sbjct: 20  DATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKLMNYTLRQYEE 79

Query: 232 WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           WE++   +KI   K       QLA  SY+K + NL        + F  +K     +   R
Sbjct: 80  WEKKQKDKKI---KDDSSDMKQLAMFSYDKGVSNL--------NRFRTDK-----TTTER 123

Query: 412 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 591
             +IQ ++KTGK+ I D+ KLVN LA +L   + KRY   K+++++    S  E +IN++
Sbjct: 124 EVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYINER 183

Query: 592 NKQFNEKLSRESRNSE 639
           NK FNEKL RESR  E
Sbjct: 184 NKHFNEKLDRESRYGE 199

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score =  116 bits (291), Expect = 5e-32
 Identities = 67/196 (34%), Positives = 118/196 (60%)
 Frame = +1

Query: 52  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 231
           V+V+I+ RK+A+RE ++ ++  KP++Y+MED N++      +    + +  +Y+ +EY  
Sbjct: 18  VDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSSERRRLKLMNYSMREYEE 77

Query: 232 WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           W+++   +++   KR G +  +LAK SYEK        DLS      +++++ N     R
Sbjct: 78  WDKKQKGKEV---KRGGANVQELAKYSYEK--------DLSR-----SKQNNGN-----R 116

Query: 412 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 591
           + +I  D KT ++++ DD KLVNKLA  L+  +++R+ ARK+ ME A   +    +IN+K
Sbjct: 117 VVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEK 176

Query: 592 NKQFNEKLSRESRNSE 639
           NKQFN KL R+ + +E
Sbjct: 177 NKQFNLKLDRQMKETE 192

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score =  111 bits (277), Expect = 8e-30
 Identities = 65/193 (33%), Positives = 110/193 (56%), Gaps = 2/193 (1%)
 Frame = +1

Query: 52  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 231
           V++ I+NRKL D   +E   N KP+ Y+ME++ + D++V      + DR  +Y+ +EY  
Sbjct: 20  VDILIENRKLLDANTRELKKNSKPKTYSMEELAE-DDTVNTGTVDEADRLLNYSIREYEE 78

Query: 232 WEQRH--HQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKI 405
           WE++   H+  +  +K S  S  Q+AK +Y+K ++ L  Q          +  + N  KI
Sbjct: 79  WEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQ----------KSTNDNRGKI 128

Query: 406 SRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFIN 585
           S+I   +KD KTGKI + D  +L+ +LA  L   +K+RY+   ++ +     +   S+IN
Sbjct: 129 SKI---RKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENYSYIN 185

Query: 586 DKNKQFNEKLSRE 624
           +KNK+FN+KL R+
Sbjct: 186 EKNKEFNDKLERQ 198

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score =  107 bits (266), Expect = 4e-28
 Identities = 66/195 (33%), Positives = 105/195 (53%), Gaps = 2/195 (1%)
 Frame = +1

Query: 58  VSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWE 237
           +S++NRKL + E +E    RKPRVY +E     + S+   +    ++  +YT Q+Y  W 
Sbjct: 30  ISVENRKLVNAESKELAAGRKPRVYQLEA---PEPSLPTQDDKHGNQLMNYTIQQYEEWN 86

Query: 238 QRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRID 417
            R   +    +KR   +   +AK +Y+K L  L  +D    + + N            I 
Sbjct: 87  SRQRDQT---NKRDSGNLQDMAKYTYDKELNKLH-KDTMLQNRYTNG---------GSIQ 133

Query: 418 RIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVI--PSGVESFINDK 591
           ++ ++ KTGK+ I DD +LV KLA  ++  + +RYEAR+R+ME + +   S    +IN+K
Sbjct: 134 KMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQNASSGGGYINEK 193

Query: 592 NKQFNEKLSRESRNS 636
           NKQFNEKL R+   S
Sbjct: 194 NKQFNEKLDRQMPQS 208

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score =  106 bits (264), Expect = 8e-28
 Identities = 66/206 (32%), Positives = 114/206 (55%), Gaps = 10/206 (4%)
 Frame = +1

Query: 52  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVD------ESVGYTESSDKDRAF--- 204
           +++  +NRK AD+E++E + + KP+VY+++ + D D      + +G   + ++ R F   
Sbjct: 21  LDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEEEKRKFKLM 80

Query: 205 HYTAQEYIAWEQRHHQRKIGQSKR-SGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEK 381
           +YT +EY  W++   Q+K  Q KR  G    +LA  +YEK L  L     S+ +N  +E+
Sbjct: 81  NYTIREYEEWDK---QQKDKQRKRVDGSDLTELATFTYEKELSKLN----SKLENISHEQ 133

Query: 382 DHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIP 561
            H+          I  +T+ GK+ + D+ +L+N L  +L   +KKRY  RK++++S    
Sbjct: 134 KHQ----------IGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASS 183

Query: 562 SGVESFINDKNKQFNEKLSRESRNSE 639
               ++  DKNKQFNEKL RE +  +
Sbjct: 184 DIAGNYFKDKNKQFNEKLERELKERD 209

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score = 96.7 bits (239), Expect = 3e-24
 Identities = 65/191 (34%), Positives = 104/191 (54%)
 Frame = +1

Query: 52  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 231
           V+VS+KNRK A++E ++A  + KP+VY+M   N+ +      E   + +  +Y+ ++Y  
Sbjct: 18  VDVSVKNRKEAEKEEKQAKQSGKPKVYSM---NEDETFKDQKEEDTRGKLLNYSIKDYEK 74

Query: 232 WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           W+ +   R        G S   LAK +Y+K +R +      E D  +N           +
Sbjct: 75  WQLK---RTAKLKNSDGSSQQDLAKYTYDKEIREM------EKDGSLNR---------GK 116

Query: 412 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 591
           + + + + K G+I+I DD K + +LA +L   +K+RY  RK+Q E  +  S    FINDK
Sbjct: 117 VTKARLNGK-GRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEK-LDSSTTGGFINDK 174

Query: 592 NKQFNEKLSRE 624
           NKQFNEKLSR+
Sbjct: 175 NKQFNEKLSRQ 185

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 94.0 bits (232), Expect = 3e-23
 Identities = 64/190 (33%), Positives = 106/190 (55%), Gaps = 3/190 (1%)
 Frame = +1

Query: 55  NVSIKNRKLADREIQEANVNRKPRVYNM-EDINDVDESVGYTESSD-KDRAFHYTAQEYI 228
           ++ I+NR L  +E +E     KPRVY+M +D +D DE     E SD +   F YT Q++I
Sbjct: 19  DIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSDEQSDMRTNLFQYTVQDFI 78

Query: 229 AWEQRHHQRKIGQ-SKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKI 405
            WE+R  ++K  +   +SG+    LAK +Y+K L+NL               + K  +K 
Sbjct: 79  DWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLP------------RPEFKMKAKE 126

Query: 406 SRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFIN 585
           ++  RI KD  +GK+ I D+ +LV +L+ +L+  +K+RY++  R++ +    + +   IN
Sbjct: 127 TQF-RINKD--SGKVNIKDNKELVQRLSQNLKETAKQRYDS-NRKIANDKEHTSLSGSIN 182

Query: 586 DKNKQFNEKL 615
            KN QFN+ L
Sbjct: 183 AKNLQFNKSL 192

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 86.7 bits (213), Expect = 2e-20
 Identities = 55/196 (28%), Positives = 99/196 (50%)
 Frame = +1

Query: 52  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 231
           V++S+KN++   +E ++ +   KP VY+M+   +   S   TE S + +   Y+ +++  
Sbjct: 18  VSLSVKNKQQILQEEKQTSARAKPAVYSMK--TEEAPSSETTEESKEAKLLQYSMKDFEQ 75

Query: 232 WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           W+ +  +R+  Q       Y  LAK +Y+K ++ L       Y N V +    +I+K   
Sbjct: 76  WQDK--ERRKSQKSSDVAKYQDLAKFTYDKEVQQLR----KNYTNKVEKPKKVSINK--- 126

Query: 412 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 591
                     GKI + DD  LV  LA SL   + +RY   ++++   ++      FIN+K
Sbjct: 127 ---------KGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEK 177

Query: 592 NKQFNEKLSRESRNSE 639
           NKQFN+K+ R+++  E
Sbjct: 178 NKQFNDKIERQTKKRE 193

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 80.9 bits (198), Expect = 3e-18
 Identities = 53/193 (27%), Positives = 102/193 (52%), Gaps = 2/193 (1%)
 Frame = +1

Query: 52  VNVSIKNRK-LADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYI 228
           V++SIKNRK +   E+ +     KP VY++ D       V  T ++++ +  +Y+  +Y 
Sbjct: 18  VDISIKNRKEIVSEEVLQVG-RSKPEVYSINDEGAAVNEVQSTSNTERRKLLNYSLIDYE 76

Query: 229 AWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKIS 408
            W+++  Q     +    I+Y      +Y+  ++ L    L++              KI+
Sbjct: 77  KWDEKEKQANFDGTYSGDIAYS-----TYKNEIKQLRKGGLTK-------------GKIT 118

Query: 409 RIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMES-AVIPSGVESFIN 585
           +     + +++GK+ I D+ +LVNKLA +LE  S++R+   K++++      S + +F+N
Sbjct: 119 K----GRISESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVN 174

Query: 586 DKNKQFNEKLSRE 624
           +KN+ FNEKLSR+
Sbjct: 175 EKNRHFNEKLSRQ 187

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 79.7 bits (195), Expect = 8e-18
 Identities = 55/201 (27%), Positives = 101/201 (50%), Gaps = 5/201 (2%)
 Frame = +1

Query: 52  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 231
           +++S+KN+    RE +  + +RKP VY+M +    +E +   + ++ ++   Y+  EY  
Sbjct: 18  IDLSVKNKNEVIREEKMVSASRKPAVYSM-NAEGAEEEIA-KDVTEANKLLKYSMLEYEQ 75

Query: 232 WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           W+ +   +K       G S+  LAK +Y+K +     Q LS+ D                
Sbjct: 76  WQDK--VKKNSHRLEGGASFQDLAKSTYDKEV-----QQLSKIDG--------------- 113

Query: 412 IDRIQKDTK-----TGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVES 576
            +R+ K+TK      GKI + DD +LV  L  +L   + +RY   ++++   +  +    
Sbjct: 114 -NRVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGG 172

Query: 577 FINDKNKQFNEKLSRESRNSE 639
           +IN+KNKQFN+KL R+++  E
Sbjct: 173 YINEKNKQFNDKLERQTKKRE 193

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 78.6 bits (192), Expect = 3e-17
 Identities = 58/191 (30%), Positives = 90/191 (47%)
 Frame = +1

Query: 52  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 231
           V VSI+N+K     I E   N + RVY+M D  +       +E  D  +  +Y+ +EY  
Sbjct: 54  VEVSIRNKKAI---IAEEKKNSERRVYSMADDGEDKARSNKSEPEDPIKLANYSIREYEK 110

Query: 232 WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           WE +    +  +S      +  +AK SY+K           E D    +  H     I  
Sbjct: 111 WEAKTQNSRHNKSVMG--DFQTIAKNSYKK-----------EVDALPKDISHPLKGGI-- 155

Query: 412 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 591
                  T+ GK+++ D+ +LV K+   L   SKKRY  RK++++     +  + FINDK
Sbjct: 156 -------TEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDK 208

Query: 592 NKQFNEKLSRE 624
           NK+FN KL+ E
Sbjct: 209 NKRFNAKLNSE 219

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 72.8 bits (177), Expect = 3e-15
 Identities = 56/195 (28%), Positives = 92/195 (47%), Gaps = 2/195 (1%)
 Frame = +1

Query: 52  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 231
           V+ SI+NRK A  E +      KPRVY+M +    DE+      S++ +  +Y   +Y  
Sbjct: 18  VDASIRNRKEAASEERARLAEGKPRVYSMAE-EPADEAEADDTQSEQLKLLNYRIADYEK 76

Query: 232 WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           W+++  + K       G    +LA  +Y   L  L  + +         K      +IS 
Sbjct: 77  WDEKQKRHK---QPSDGADLGELANSTYRSELHQLHRRGVV--------KGRATNGRISA 125

Query: 412 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSG--VESFIN 585
                    +GK+ + D+ +LV KLA +++  +K+R+E R+++   A    G      +N
Sbjct: 126 ---------SGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKK---AAKDGGRATAGSLN 173

Query: 586 DKNKQFNEKLSRESR 630
           DKN+ FNEKL RE R
Sbjct: 174 DKNRHFNEKLDREFR 188

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 67.8 bits (164), Expect = 3e-13
 Identities = 58/204 (28%), Positives = 93/204 (45%), Gaps = 14/204 (6%)
 Frame = +1

Query: 55  NVSIKNRKLADREIQEANVNRKPRVYNMED--------INDVDESVGYTESSDKDRAFHY 210
           N  I N+        ++  N KP+VY+M D        IND +    ++E     +  +Y
Sbjct: 20  NTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDENARKNHSEEERISKLMNY 79

Query: 211 TAQEYIAWEQRHHQ---RKIGQSKRSGI-SYDQLAKLSYEKTLRNLATQDLSEYDNFVNE 378
           T +EY  WE + ++        SK   I S D LAK +Y+K +R L     +      + 
Sbjct: 80  TLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDIRKLNKALRATNSGNKSN 139

Query: 379 KDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYE--ARKRQMESA 552
           K  K I             ++ KI I DD  LV +L  +L+++S + Y+    +R+  S 
Sbjct: 140 KPGKIIKN--------HRNESNKIVIKDDKFLVEELVNNLKTKSDRLYKHLGERRKNYST 191

Query: 553 VIPSGVESFINDKNKQFNEKLSRE 624
            +       +N KN++FNEKL+RE
Sbjct: 192 TL----SGHVNTKNQEFNEKLTRE 211

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 63.2 bits (152), Expect = 1e-11
 Identities = 53/198 (26%), Positives = 87/198 (43%), Gaps = 14/198 (7%)
 Frame = +1

Query: 64  IKNRKLADREIQEANVNRKPRVY--NMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWE 237
           I++RK  + + +E     KP+VY  NM+D  D D       ++ +     YT ++Y  WE
Sbjct: 22  IEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDLLTNNSERALLTYTIRDYEEWE 81

Query: 238 Q--RHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           +  +   + +  +  S  S  Q AK +Y+K +  +  +       F  +++      I+R
Sbjct: 82  ESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMKKRQ----GKFATDEE------ITR 131

Query: 412 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAV----------IP 561
              +++    GK+ I DD  LVN     +   S  RY   KR   +AV            
Sbjct: 132 GSAMKEVLDDGKLLIKDDKHLVNGFISDINKVSNDRY--IKRMKLNAVNNDATGSKVSHD 189

Query: 562 SGVESFINDKNKQFNEKL 615
            G  S+ N KNK FN+KL
Sbjct: 190 KGKTSYNNAKNKDFNDKL 207

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 46.2 bits (108), Expect = 1e-05
 Identities = 29/78 (37%), Positives = 41/78 (52%), Gaps = 9/78 (11%)
 Frame = +1

Query: 415 DRIQKDTKTGKIRIADDHKL-------VNKLAVSLESESKKRYEARKRQM--ESAVIPSG 567
           DR+ KDT   ++ +             V +L   L   SKKRY  RK +M  + A   S 
Sbjct: 125 DRVAKDTYKKELALLGRKSTRGTYRDNVERLVTHLNDVSKKRYLVRKNKMKRQGARGGSS 184

Query: 568 VESFINDKNKQFNEKLSR 621
           ++ +IN+KNKQFN+KL R
Sbjct: 185 LDGYINEKNKQFNKKLQR 202

>KAFR0A04260 Chr1 complement(848354..849274) [921 bp, 306 aa] {ON}
           Anc_8.748 YOR287C
          Length = 306

 Score = 37.4 bits (85), Expect = 0.018
 Identities = 37/198 (18%), Positives = 83/198 (41%), Gaps = 9/198 (4%)
 Frame = +1

Query: 67  KNRKLADREIQEANVNRK--PRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQ 240
           + +K      ++A + RK   + +  E  +D D+S      S+ D    +  +E     Q
Sbjct: 66  RGKKKVKNSERDAKIVRKGEAKTFREEAFSDSDDSNDDQSDSEGDSDGAFFEEEN---GQ 122

Query: 241 RHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEK---DHKNISKISR 411
           +H QRK+G+ K +        ++S  + +  +  Q  + Y +   ++   D  +++KI R
Sbjct: 123 KHQQRKMGKHKHAPAEQSSKKRVSKIRQIPGIKNQSSNLYQDIRFDRSLGDEADVAKIRR 182

Query: 412 IDRIQKDTKTGKIR----IADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESF 579
             +   + +  +I     +  D K ++K+      E + R  + K ++++          
Sbjct: 183 RYKFLDEYREKEIEELQGMLHDRKFMSKITDKDRDEMQNRLVSMKSKLQTI--------- 233

Query: 580 INDKNKQFNEKLSRESRN 633
              KNK   +++ +E  N
Sbjct: 234 ---KNKDLEQQIVKEYEN 248

>ZYRO0G14652g Chr7 complement(1172048..1174063) [2016 bp, 671 aa]
           {ON} similar to uniprot|P40460 Saccharomyces cerevisiae
           YIL144W TID3 Component of the evolutionarily conserved
           kinetochore-associated Ndc80 complex
           (Ndc80p-Nuf2p-Spc24p- Spc25p) conserved coiled-coil
           protein involved in chromosome segregation spindle
           checkpoint activity kinetochore assembly and clustering
          Length = 671

 Score = 37.4 bits (85), Expect = 0.023
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 11/83 (13%)
 Frame = +1

Query: 403 ISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLE------SESKKRYEARKRQMESAVIPS 564
           +S+I+R Q D  T ++ I+D    +++   ++E      S+ K +Y+  K++ ES ++  
Sbjct: 523 LSKIERAQNDNNTLEMEISDLRDQISEKTRAIERLELELSDVKSKYKLGKQENESHLLSQ 582

Query: 565 GVE-----SFINDKNKQFNEKLS 618
            +E       IND NK   EK+S
Sbjct: 583 KIELEKLERKINDSNKLLQEKIS 605

>Kpol_1060.36 s1060 (86412..88643) [2232 bp, 743 aa] {ON}
           (86412..88643) [2232 nt, 744 aa]
          Length = 743

 Score = 37.4 bits (85), Expect = 0.024
 Identities = 34/159 (21%), Positives = 71/159 (44%), Gaps = 1/159 (0%)
 Frame = +1

Query: 76  KLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQRHHQR 255
           +++D+E+   + N  PR Y  + +   DES+GY+E  D++        +    +    + 
Sbjct: 134 RVSDKELDNESDNHVPREYFQKSMGYFDESLGYSEGDDENTNKDQNDDDMAMDQDEEEEF 193

Query: 256 KIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRI-DRIQKD 432
           K+  SK    S      +  E   +N  T++  E D+ V+    +++S  S    ++QK 
Sbjct: 194 KV--SKNGYFS----KFIENENESKN--TENKQEIDSEVDVPKAESVSSNSESRSQLQKQ 245

Query: 433 TKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMES 549
               K+ + D++  +       E+E+K+ +      +ES
Sbjct: 246 DNESKLSLIDNYSDIPDSIP--ENETKEEHPVEMEAVES 282

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score = 35.8 bits (81), Expect = 0.032
 Identities = 26/102 (25%), Positives = 48/102 (47%)
 Frame = +1

Query: 334 LATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESK 513
           L T+ L E++   +  ++K    I R+   ++    GK    D   LV+++    +   K
Sbjct: 63  LLTKPLREFETEAHVAENKE--DIDRLTYNKEVMSLGKREKRDVESLVSEMNRISDERYK 120

Query: 514 KRYEARKRQMESAVIPSGVESFINDKNKQFNEKLSRESRNSE 639
           K  + R+R  ++         FIN++NK FN +L +E  N +
Sbjct: 121 KGAQKRRRLKDTE------RGFINEQNKAFNLRLEKEKENGK 156

>KAFR0A03100 Chr1 complement(634622..635575) [954 bp, 317 aa] {ON}
           Anc_7.528 YLR455W
          Length = 317

 Score = 35.8 bits (81), Expect = 0.059
 Identities = 33/147 (22%), Positives = 65/147 (44%), Gaps = 24/147 (16%)
 Frame = +1

Query: 136 MEDINDVDESVGYTESSDKDR---------AFHYTAQEYIAWEQRHHQRKIGQSKRSGIS 288
           ++ IND++ ++ + ++   DR         +  Y  ++  + +    +R  G  KR+ I 
Sbjct: 115 LDHINDLENNIIFGKNPFSDRKDDRKNAKDSAAYKQEDSSSSKNNESRRSSGTRKRTNI- 173

Query: 289 YDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDR---------------I 423
            DQ  +   E+T+ N+ +    E D     K+ K  +K+ R  R               I
Sbjct: 174 -DQNNENYIEQTVNNIKSDKYKELDK--KRKERKVRNKLDRSRRVEIAMLFRRRIQKNLI 230

Query: 424 QKDTKTGKIRIADDHKLVNKLAVSLES 504
           Q+++K     I + HKL+NK+  +L +
Sbjct: 231 QRESKPTINEINESHKLLNKIVENLSN 257

>Kpol_1048.16 s1048 (53728..55245) [1518 bp, 505 aa] {ON}
           (53728..55245) [1518 nt, 506 aa]
          Length = 505

 Score = 35.0 bits (79), Expect = 0.12
 Identities = 30/140 (21%), Positives = 58/140 (41%), Gaps = 1/140 (0%)
 Frame = +1

Query: 130 YNMEDINDVDESVGYTES-SDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAK 306
           + ++ +   D S GY E   ++++ F    +E +  + +  Q+K   S RS  + + +  
Sbjct: 225 FELKKVKGTDASNGYDEELPEEEQEFSDDEKESMFKKMKKKQKKNKNSTRSSDNSENVTN 284

Query: 307 LSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKL 486
             +++ L+N +T  + +Y +     +    S  SR  R Q ++ T               
Sbjct: 285 RVHKQPLKNNSTHKIKQYPSMKFPNETPQSSYRSRDQRQQVNSNTTN----------KSR 334

Query: 487 AVSLESESKKRYEARKRQME 546
            V  ES S  R E  +  ME
Sbjct: 335 PVQSESNSYNRQEPARNNME 354

>KLLA0E09549g Chr5 complement(845298..846224) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07897 Saccharomyces cerevisiae
           YLR003C CMS1 Hypothetical ORF
          Length = 308

 Score = 34.7 bits (78), Expect = 0.14
 Identities = 43/157 (27%), Positives = 71/157 (45%), Gaps = 26/157 (16%)
 Frame = +1

Query: 247 HQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQ------DLS----------EYDNFVNE 378
           HQ+K+ +        + L K S +K +  LAT       DLS          + D    E
Sbjct: 82  HQKKLERMAYEKAQKENLPKASVDKIIEYLATSIRDKNPDLSALELDELYFKKQDFLSTE 141

Query: 379 KDHKNISKISRIDRIQKDTKT--------GKIRIADDHKLVN--KLAVSLESESKKRYEA 528
           K  K+ S  +  D I   +K+          IR+AD ++ VN  + AV L S++K + + 
Sbjct: 142 KYEKDRSLNNFQDFIHTFSKSPRSIILSQSNIRVADVYRSVNGHQTAVKLFSKNKLKDDI 201

Query: 529 RKRQMESAVIPSGVESFINDKNKQFNEKLSRESRNSE 639
            K +    ++ S  ES    KNK+ N+K+  ++ +SE
Sbjct: 202 TKVE---ELLGSKKESKPEKKNKKSNKKMKGKNFSSE 235

>SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa] {ON}
            similar to uniprot|Q06704 Saccharomyces cerevisiae
            YLR309C IMH1 Protein involved in vesicular transport
            mediates transport between an endosomal compartment and
            the Golgi contains a Golgi-localization (GRIP) domain
            that interacts with activated Arl1p-GTP to localize Imh1p
            to the Golgi
          Length = 963

 Score = 34.7 bits (78), Expect = 0.18
 Identities = 43/197 (21%), Positives = 89/197 (45%), Gaps = 15/197 (7%)
 Frame = +1

Query: 88   REIQEANVNRKP---RVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQRHHQRK 258
            R+ +E NV  K    R+ ++ED  +++ES    +   ++     T +  +A  +     K
Sbjct: 671  RQCEELNVKLKESNKRILSLED--ELNESTSILQERTRETN---TMRRLLADSENDRGIK 725

Query: 259  IGQ-SKRSGISYDQLAKLSYEKTL----RNLATQDLSEYD-------NFVNEKDHKNISK 402
            + +  ++  I+ ++ +KL  E TL    +    Q+L E +       + +N K  +  S+
Sbjct: 726  LKELQEKFAITLEEKSKLQSELTLQTSRKTREIQELRELNMELKSEIHTLNLKIKQQQSE 785

Query: 403  ISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFI 582
            I  +  + ++ +      A+    ++ +  SL+ E+  R E + R  E+      +   +
Sbjct: 786  IEHLSSVNRNMQRKSSASAESSGELDNVVSSLK-EALSRSEKKIRDTEN------INEEL 838

Query: 583  NDKNKQFNEKLSRESRN 633
             D NK  N+KL R S+N
Sbjct: 839  KDLNKDLNKKLDRLSKN 855

>ZYRO0D01254g Chr4 complement(95493..96491) [999 bp, 332 aa] {ON}
           similar to uniprot|Q06188 Saccharomyces cerevisiae
           YLR455W Hypothetical ORF
          Length = 332

 Score = 34.3 bits (77), Expect = 0.19
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = +1

Query: 235 EQRHHQRKIGQSKRS-GISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           EQ    R I  ++ S     D  AKLS      N   +  S+ D     +    I +  +
Sbjct: 164 EQEQENRNINDTQSSVADDKDDSAKLSRSNNTNNNKKRKRSKLDRSRKVEISLLIRRRLQ 223

Query: 412 IDRIQKDTKTGKIRIADDHKLVNKLAVSL 498
            + +Q+D+   K  I D HKL+NK++ +L
Sbjct: 224 QNLVQRDSPPSKQEILDSHKLLNKISENL 252

>KAFR0B05650 Chr2 (1163855..1166056) [2202 bp, 733 aa] {ON}
           Anc_8.306 YDR138W
          Length = 733

 Score = 34.3 bits (77), Expect = 0.24
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
 Frame = +1

Query: 70  NRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTE-SSDKDRAFHYTAQEYIAWEQ 240
           N + A   I+E   N+K R   ME+ ND+ E+VG  +  S+KD AF    +  I+ E+
Sbjct: 635 NLRKAREYIKEREQNKKRRNEEMENSNDIQEAVGAKKMKSEKDLAFEGGQESAISGEE 692

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 34.3 bits (77), Expect = 0.25
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 3/108 (2%)
 Frame = +1

Query: 295 QLAKLSYEKT--LRNLATQ-DLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADD 465
           +L KL  EK   L    TQ DL E D  VN  D+  +     + +    +K  KI+  D 
Sbjct: 206 KLEKLRLEKRTFLDFQETQTDLEETDRVVNAYDYHRLKSQKELFKETLSSKENKIK--DL 263

Query: 466 HKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDKNKQFNE 609
           +  ++KLA  LES ++   E RK++       S +     ++N+  NE
Sbjct: 264 NSQISKLAEELESLNEDFEEIRKKKNAEMDKNSNLSKLEEEENEIINE 311

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 33.9 bits (76), Expect = 0.32
 Identities = 47/177 (26%), Positives = 80/177 (45%), Gaps = 16/177 (9%)
 Frame = +1

Query: 148 NDVDESVGYTESSDKDRAFHYTAQEYIAWEQRHHQRKIGQS--KRSGISYDQLAKLSYEK 321
           ND+DE  G   S+  D+AF   +      E++    K+  S  K S  +  +++K ++  
Sbjct: 467 NDIDEGAGSYSSALDDKAFERKSDRE---EKKPQSSKVDSSINKESPGTGIKVSKKNF-P 522

Query: 322 TLRNLATQDLSEY--DNFVNEKDHKNISK-----------ISRIDRIQKDTKTGKIRIAD 462
            LR L T D  EY   ++ +    K I K             R++  QK+ +T +  I+ 
Sbjct: 523 VLRGL-TVDSEEYGSSSYKDTSCQKGIPKNLFDDLNLNLQTLRLEAQQKELETAR-HISQ 580

Query: 463 DHKLVNKLAVSLESESKKRYE-ARKRQMESAVIPSGVESFINDKNKQFNEKLSRESR 630
             K V +L V  E+     ++ AR + +E  +  + +ES IND       KLS+ S+
Sbjct: 581 LEKEVQRLMVIKEASKDSNFQTARLKNLE--IQKTFLESRINDLKNLLMVKLSQASK 635

>KNAG0K01010 Chr11 (197551..198027) [477 bp, 158 aa] {ON} Anc_3.144
           YOL071W
          Length = 158

 Score = 32.7 bits (73), Expect = 0.37
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = +1

Query: 253 RKIGQSKRSGISYDQLAKLSYE-KTLRNLATQDLSEYDNFVNEKD 384
           R I QS++ GI    L   S+  K L+N++ + L EYD  +NE D
Sbjct: 65  RLIYQSRKRGILETDLLLSSFAAKNLKNMSKEQLEEYDELLNELD 109

>TDEL0B02260 Chr2 (408913..410901) [1989 bp, 662 aa] {ON} Anc_5.696
           YIL144W
          Length = 662

 Score = 33.5 bits (75), Expect = 0.41
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 11/88 (12%)
 Frame = +1

Query: 271 KRSGISYDQLAKLSYEKTLRN----LATQ-------DLSEYDNFVNEKDHKNISKISRID 417
           KR G + D++      K  R+    LA Q       DL+++ N+VN  DHK+     +++
Sbjct: 305 KRMGDNNDEIMVRCENKAKRSKNLALAVQKCKALKSDLTKFQNYVNTMDHKSNEWPKKLE 364

Query: 418 RIQKDTKTGKIRIADDHKLVNKLAVSLE 501
           +++ ++     +I+D  K V +L  SL+
Sbjct: 365 KMRFESSAKMQQISDLEKKVKELQESLK 392

>SAKL0E14740g Chr5 complement(1216985..1219024) [2040 bp, 679 aa]
           {ON} similar to uniprot|P40460 Saccharomyces cerevisiae
           YIL144W TID3 Component of the evolutionarily conserved
           kinetochore-associated Ndc80 complex
           (Ndc80p-Nuf2p-Spc24p- Spc25p) conserved coiled-coil
           protein involved in chromosome segregation spindle
           checkpoint activity kinetochore assembly and clustering
          Length = 679

 Score = 33.5 bits (75), Expect = 0.42
 Identities = 17/80 (21%), Positives = 39/80 (48%)
 Frame = +1

Query: 346 DLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYE 525
           DL+++ N+VN  +HK+     ++ +I+ +  T + +I D    ++ L  SL  ++    E
Sbjct: 355 DLTKFQNYVNAMEHKSHEWPRKLQQIEAEISTRRQQIKDTEMEISNLRQSLREKNVSIDE 414

Query: 526 ARKRQMESAVIPSGVESFIN 585
              +  E   +   +++  N
Sbjct: 415 IDSKNNERDALSKSLDAAAN 434

>Skud_9.24 Chr9 (55176..57248) [2073 bp, 690 aa] {ON} YIL144W (REAL)
          Length = 690

 Score = 33.5 bits (75), Expect = 0.42
 Identities = 24/97 (24%), Positives = 47/97 (48%), Gaps = 11/97 (11%)
 Frame = +1

Query: 289 YDQLAKLSYE-KTLRN---LATQDLSEYDNFVNEKDHKNISKISRIDRI-------QKDT 435
           Y ++ K+S + KT R        D ++Y+N+VN    K+    S+++++       ++D 
Sbjct: 332 YQEVLKISQKIKTTREKWKALKSDSNKYENYVNAMKQKSQEWPSKLEKMKSECSVKEEDI 391

Query: 436 KTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQME 546
           K  +  I + HK++ K  +S E    + +E  K   E
Sbjct: 392 KALQTNIDELHKILRKKGISTEKFELENHEREKLTKE 428

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score = 33.5 bits (75), Expect = 0.42
 Identities = 21/107 (19%), Positives = 55/107 (51%), Gaps = 9/107 (8%)
 Frame = +1

Query: 346 DLSEYDNF---VNEKDHKNISKISRIDRIQKDTKTGKIRIA------DDHKLVNKLAVSL 498
           DL+   N+   +NE D++   ++ ++  I+K+T     R+       +D ++  +  + L
Sbjct: 574 DLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENEIRL 633

Query: 499 ESESKKRYEARKRQMESAVIPSGVESFINDKNKQFNEKLSRESRNSE 639
           ++E  KR + +K Q + A + +     + +  K++ +K++++ +  E
Sbjct: 634 KNEKLKREQEQKLQKQLAELKAKHNEELLEIQKKYEKKMAQQPKAVE 680

>TPHA0B02840 Chr2 complement(647976..650084) [2109 bp, 702 aa] {ON}
           Anc_8.617 YOR206W
          Length = 702

 Score = 33.5 bits (75), Expect = 0.42
 Identities = 22/87 (25%), Positives = 46/87 (52%), Gaps = 5/87 (5%)
 Frame = +1

Query: 379 KDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVI 558
           + +K+  K  ++ + Q+D +T K+   +  ++V  +   +E +SKK  +++K +   AV 
Sbjct: 18  RSNKSKPKPEKVQKFQEDKETSKLTEVEISEVVGAMPEKVEKQSKKSQKSKKSKKSKAV- 76

Query: 559 PSGVESFINDKN-----KQFNEKLSRE 624
            S  ES  +D++     K   E LS++
Sbjct: 77  -SDEESSSDDEDDAQTMKDTMEALSKD 102

>TPHA0D01750 Chr4 complement(359929..362574) [2646 bp, 881 aa] {ON}
            Anc_5.296 YDR285W
          Length = 881

 Score = 33.5 bits (75), Expect = 0.43
 Identities = 35/162 (21%), Positives = 67/162 (41%), Gaps = 1/162 (0%)
 Frame = +1

Query: 52   VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 231
            +N+ + + K  + E++E N   K  + N +          + E+S   + F     E  +
Sbjct: 637  LNIELVHLKAGELELKEENYTLKKTIENNKS--------NFEENSSSVKRFQQKIIELES 688

Query: 232  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
             +Q +   K+    +     +++ KL+ E  +    T  L  Y N  +     N +  S+
Sbjct: 689  DKQEYMSEKLDLLDKIEEKENRILKLANEVKVLEKETNQLKNYKNAQSNMSRPN-ATTSK 747

Query: 412  IDRIQK-DTKTGKIRIADDHKLVNKLAVSLESESKKRYEARK 534
             + IQK DTKT  +    D  L+++L  +   + KK     K
Sbjct: 748  PNNIQKRDTKT--LEGEKDSLLLSQLENTTNKKRKKTIAKEK 787

>Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}
           similar to Ashbya gossypii ADL037W
          Length = 914

 Score = 33.5 bits (75), Expect = 0.43
 Identities = 33/165 (20%), Positives = 71/165 (43%), Gaps = 4/165 (2%)
 Frame = +1

Query: 136 MEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSY 315
           +  +N+ D+  G+ E  +   +      + +++E     +++ + K+  +        + 
Sbjct: 102 VSSLNEADQLKGFFEDLNMKNSLLNDEVKRLSYEAISRDKELEELKQLAVEQYSKVSANE 161

Query: 316 EKTLRNLA-TQDLS---EYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNK 483
           +K L  L  TQ L    +YD  V EKD +     S + ++ +  +T ++ +A+    ++ 
Sbjct: 162 DKDLDALLETQKLKLEQKYDEIVREKDGEIEELKSTLQKVDQKIETLELLVAEKENALSG 221

Query: 484 LAVSLESESKKRYEARKRQMESAVIPSGVESFINDKNKQFNEKLS 618
           L   L+ + +K       QME  +      S   D  K+F+E  S
Sbjct: 222 LDGQLKDQDEK-----LNQMEKLL------SLYKDVIKEFDEPKS 255

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score = 33.5 bits (75), Expect = 0.45
 Identities = 45/218 (20%), Positives = 100/218 (45%), Gaps = 22/218 (10%)
 Frame = +1

Query: 52   VNVSIKNRKLADR------EIQEANVN--RKPRVYNMEDINDVDESVGYTESSDKDRAFH 207
            VN+S+   K A +       + E NV+  +  +    E++N + +++      DK++ F 
Sbjct: 610  VNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNI-----LDKEKQFS 664

Query: 208  YTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDH 387
            Y++++YI+ + +       +++ + +  +    +  + TLR      L+E +N       
Sbjct: 665  YSSRDYISCKSK---LSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQ 721

Query: 388  KNISKISRIDRIQKDTKTG---KIRIA--------DDHKLVNKLAVSLESESK---KRYE 525
             N S  + +  + K+TK+G   K++I+        +  +LV +    L+S++    K Y+
Sbjct: 722  MN-SLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQNDSEIKWYK 780

Query: 526  ARKRQMESAVIPSGVESFINDKNKQFNEKLSRESRNSE 639
            A    +++ V        +N++ KQ  EK+   S+  E
Sbjct: 781  ATIDDLKANVFE------LNEELKQKEEKIEEFSKTLE 812

>KLTH0E13200g Chr5 complement(1171972..1173420) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|P41921 Saccharomyces
           cerevisiae YPL091W GLR1 Cytosolic and mitochondrial
           glutathione oxidoreductase converts oxidized glutathione
           to reduced glutathione
          Length = 482

 Score = 33.1 bits (74), Expect = 0.52
 Identities = 30/109 (27%), Positives = 47/109 (43%), Gaps = 9/109 (8%)
 Frame = +1

Query: 169 GYTESSDKDRAFHYTAQE---------YIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEK 321
           GY    D D  F  T Q          YI  E       +G      I  + L +  +++
Sbjct: 179 GYEHGIDSDDFFKLTEQPKKVVVSGAGYIGVELAGVFHGLGSETHMVIRGETLLR-KFDE 237

Query: 322 TLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDH 468
            ++N  T      D++VNE    NI K ++ID++ KD  TGK+ +  D+
Sbjct: 238 CIQNTIT------DHYVNEGI--NIHKTAKIDKVHKDEGTGKLSVHLDN 278

>TPHA0C00340 Chr3 (56190..58193) [2004 bp, 667 aa] {ON} Anc_5.629
           YDR266C
          Length = 667

 Score = 32.7 bits (73), Expect = 0.74
 Identities = 23/96 (23%), Positives = 44/96 (45%), Gaps = 6/96 (6%)
 Frame = +1

Query: 295 QLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKL 474
           +L++   E+  ++    DLS++  F N  +     KI+  D +   T     + AD + L
Sbjct: 368 ELSRARLEERAKHYLGNDLSKFATFTNINEKYEKKKINSNDVLTSYTSLFTEKEADVYLL 427

Query: 475 VNKLAVSLESESKKR------YEARKRQMESAVIPS 564
           +N LA +    S K       Y+A ++++    +PS
Sbjct: 428 INNLASTFPKNSTKYKELNAIYDAHEQKLARDSLPS 463

>TPHA0H01420 Chr8 complement(318539..320650) [2112 bp, 703 aa] {ON}
           Anc_5.696 YIL144W
          Length = 703

 Score = 32.7 bits (73), Expect = 0.74
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 19/127 (14%)
 Frame = +1

Query: 292 DQLAKLSYEKTLRNLATQDLSE-YDNFVNE-KDHKNISKIS-----RIDRIQKDTK---- 438
           D   K +Y   L N    D ++ + N +N  K   NI K++     RI+ ++K+      
Sbjct: 515 DDSIKQNYNSYLNNGKAIDFNKMFKNDLNTMKIKNNIIKLNNEIQERIEGVEKNNSVLEQ 574

Query: 439 ---TGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVE-----SFINDKN 594
              + K  + D +K+   + + L SE+   YE  K++ ++ ++   +E       IND N
Sbjct: 575 KLISLKQEVMDKNKMTENVELKL-SEANSTYELNKQESDNKLLKQKIEIEKLERKINDAN 633

Query: 595 KQFNEKL 615
           K   EKL
Sbjct: 634 KILKEKL 640

>Kpol_489.8 s489 (26766..28883) [2118 bp, 705 aa] {ON}
           (26766..28883) [2118 nt, 706 aa]
          Length = 705

 Score = 32.7 bits (73), Expect = 0.74
 Identities = 23/92 (25%), Positives = 46/92 (50%), Gaps = 9/92 (9%)
 Frame = +1

Query: 370 VNEKDHKNISKISRIDR----IQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKR 537
           +N  +++ I +I  I++    ++    + K  + D ++ + K+ + L SE    YE  K+
Sbjct: 550 INSLNNEIIERIREIEKNNGELEHQLISLKEEVMDKNRTIEKIELQL-SEVNSEYELNKQ 608

Query: 538 QMESAVIPSGVE-----SFINDKNKQFNEKLS 618
           + +S ++   +E       IND N+   EKLS
Sbjct: 609 ESDSKLLSQEIEIEKIERKINDSNRITKEKLS 640

>KAFR0C01130 Chr3 complement(229329..229766) [438 bp, 145 aa] {ON}
           Anc_3.144 YOL071W
          Length = 145

 Score = 31.6 bits (70), Expect = 0.82
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%)
 Frame = +1

Query: 253 RKIGQSKRSGISYDQLAKLSYE-KTLRNLATQDLSEYDNFVNEKD 384
           R I QS++ GI    L    +  K L+N+    L EYD F+NE D
Sbjct: 53  RLIYQSRKRGILETDLLLSGFAAKNLKNMGMDQLKEYDAFLNELD 97

>KNAG0J02640 Chr10 (491289..493283) [1995 bp, 664 aa] {ON} Anc_1.227
            YJL127C
          Length = 664

 Score = 32.3 bits (72), Expect = 0.98
 Identities = 36/219 (16%), Positives = 86/219 (39%), Gaps = 28/219 (12%)
 Frame = +1

Query: 67   KNRKLADREIQEANVNRKPRVYNMEDINDVDES------VGYTESSDKDRAFHYTAQEYI 228
            K   L + +I   ++ R  +  N    +DV+ S      VG  ++     A +   +EY+
Sbjct: 406  KAHMLPNHKIDTRDLRRLAKPDNTVMNSDVNLSEMAEAVVGSLQNQMNSEATYSNKREYL 465

Query: 229  AWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISK-- 402
            + +  +  R  G S R+G S+      S   T+ +     ++ +D FV +   +  SK  
Sbjct: 466  SGDNHYDHRNNGDSNRTG-SFPPTVNTSNSGTVEDTT---MNSFDKFVQQTQSRKKSKHS 521

Query: 403  --------------------ISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRY 522
                                ++ ++ +    K+G  ++ DDH L  + A+     +    
Sbjct: 522  LPANNNNIINDTILSLEDNVMAALEMVHDGGKSGS-KVGDDHSLYQQPAIDNNVNAVSDR 580

Query: 523  EARKRQMESAVIPSGVESFINDKNKQFNEKLSRESRNSE 639
            +  +      +   G + ++ ++++ + E  +   +N++
Sbjct: 581  DVNQISNIPLIFDFG-DDYLEEEDEDYEEPTNGAGKNAD 618

>NDAI0A06140 Chr1 complement(1394748..1396802) [2055 bp, 684 aa]
           {ON} Anc_3.58 YNL299W
          Length = 684

 Score = 32.3 bits (72), Expect = 0.99
 Identities = 23/89 (25%), Positives = 40/89 (44%)
 Frame = +1

Query: 373 NEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESA 552
           NEK HK  S+I   D     +      + DD K   ++    + E KKR +  K+Q    
Sbjct: 529 NEKYHKKRSRIVHDDIFLNPSDDD---LEDDIKEQEEMYRFEQPEMKKRKKNLKKQDGKK 585

Query: 553 VIPSGVESFINDKNKQFNEKLSRESRNSE 639
           ++ + +++  N+K K+  EK   +    E
Sbjct: 586 LVENSLQTIENEKKKEKREKKKEKKEKKE 614

>Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 32.0 bits (71), Expect = 1.3
 Identities = 26/125 (20%), Positives = 53/125 (42%), Gaps = 11/125 (8%)
 Frame = +1

Query: 283 ISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIAD 462
           +  +Q  K+S+   +  +  +D  E  +  +   H +  +  RI   + + K GK+++ +
Sbjct: 27  VKTEQEKKISFNSVVTPIRAEDYHEKTSRSSSSSHSDSPEFLRISNNKSNHKNGKLKVFE 86

Query: 463 DHKLVNKLAVSLE--------SESKKRYE---ARKRQMESAVIPSGVESFINDKNKQFNE 609
             KLV      L+         E  K+Y    + K  ++S    S    ++N ++K+  E
Sbjct: 87  SKKLVPLFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAE 146

Query: 610 KLSRE 624
           K   E
Sbjct: 147 KAMEE 151

>Kpol_520.35 s520 (87263..90178) [2916 bp, 971 aa] {ON}
           (87263..90178) [2916 nt, 972 aa]
          Length = 971

 Score = 32.0 bits (71), Expect = 1.4
 Identities = 44/186 (23%), Positives = 75/186 (40%), Gaps = 9/186 (4%)
 Frame = +1

Query: 91  EIQEANVN--RKPRVYNMEDINDVDESVGYTESSDKDRAFH--YTAQEYIAWEQRHHQRK 258
           EI   N+    KPR     +IN   E+    E+ +     H   TA+         +  K
Sbjct: 260 EINTKNITTGNKPR----SEINSKSENYSNAEAKNDKNDSHPNKTAKTKPTLPLIFNTSK 315

Query: 259 IGQSKRSGISY--DQLAKLSYEKTL---RNLATQDLSEYDNFVNEKDHKNISKISRIDRI 423
           IG S RS      +++ +   + TL   +N A +D       V E   K  +K   +DR+
Sbjct: 316 IGISPRSSPKRINEKIEQEIVDLTLSRNKNEAQEDTEGIPTSVKEITAKLGTKTIEVDRL 375

Query: 424 QKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDKNKQF 603
           Q+D  T  I    DH        + E ++K      K+++E  + P+     I+D+ +  
Sbjct: 376 QRDEDTAPIYSTKDH-----FVDASEKQNKNNIADEKKEIEE-LSPTSRRKRISDELEAS 429

Query: 604 NEKLSR 621
             K+ +
Sbjct: 430 KHKIMK 435

>Smik_9.25 Chr9 (55776..57854) [2079 bp, 692 aa] {ON} YIL144W (REAL)
          Length = 692

 Score = 31.6 bits (70), Expect = 1.8
 Identities = 24/97 (24%), Positives = 47/97 (48%), Gaps = 11/97 (11%)
 Frame = +1

Query: 289 YDQLAKLSYE-KTLRN---LATQDLSEYDNFVNEKDHKNISKISRIDRIQK--DTKTGKI 450
           Y ++ K+S + KT R        D ++Y+N+VN    K+    S++++++   D K  +I
Sbjct: 333 YQEVMKISQKIKTTREKWKALRSDSNKYENYVNAMKQKSQEWPSKLEKMKSECDVKKEEI 392

Query: 451 RIADD-----HKLVNKLAVSLESESKKRYEARKRQME 546
              ++     HK++ K  +S E    + +E  K   E
Sbjct: 393 NALENNIDELHKILRKKGISTEQFELQNHEREKLTKE 429

>YBR156C Chr2 complement(551104..553200) [2097 bp, 698 aa] {ON}
           SLI15Subunit of the conserved chromosomal passenger
           complex (CPC; Ipl1p-Sli15p-Bir1p-Nbl1p), which regulates
           kinetochore-microtubule attachments, activation of the
           spindle tension checkpoint, and mitotic spindle
           disassembly
          Length = 698

 Score = 31.6 bits (70), Expect = 1.8
 Identities = 24/107 (22%), Positives = 50/107 (46%), Gaps = 2/107 (1%)
 Frame = +1

Query: 79  LADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQRHHQRK 258
           +AD    E+  ++  R+ N++ +   +      E  D  + F       +  +Q HH+RK
Sbjct: 492 IADISKPESRKSKNYRLTNLQLLPPAE-----AERDDLKKKFDKRLSGIMRSQQEHHRRK 546

Query: 259 IGQSKR-SGISYDQLAKLSYEKTLRNLATQD-LSEYDNFVNEKDHKN 393
             + KR S +  D   + S+    +++  ++ L+ +DN V +  +KN
Sbjct: 547 QEKQKRMSHLEQDLKKQTSFSNDYKDIRLKESLAPFDNHVRDTINKN 593

>Skud_6.22 Chr6 (43649..45793) [2145 bp, 714 aa] {ON} YFL047W (REAL)
          Length = 714

 Score = 31.6 bits (70), Expect = 1.8
 Identities = 28/81 (34%), Positives = 41/81 (50%)
 Frame = +1

Query: 253 RKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKD 432
           R++ + KRS  + D+L        +++L  Q+  E D    EKDH+  SKI+ ID    D
Sbjct: 152 RQLEEFKRSNFNEDELTN-----AMKSLEVQNKYEED-VAREKDHRFFSKIAGID---FD 202

Query: 433 TKTGKIRIADDHKLVNKLAVS 495
            KT K  +   H L+ KL  S
Sbjct: 203 YKTMKETL---HLLLTKLPKS 220

>TBLA0J00690 Chr10 (157822..163251) [5430 bp, 1809 aa] {ON} Anc_5.587
            YDR464W
          Length = 1809

 Score = 31.6 bits (70), Expect = 1.9
 Identities = 40/171 (23%), Positives = 68/171 (39%), Gaps = 9/171 (5%)
 Frame = +1

Query: 64   IKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQR 243
            + N K  +  I   N N      N+ D N V + +  ++ S K   FH            
Sbjct: 630  MNNNKNNNSNIINDNSNNNRLEPNLGDFN-VKDILLPSKVSPKLSKFH------------ 676

Query: 244  HHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKI------ 405
             H+ K  +SKRS  S D+  KLS EK       +    +     E++H+   KI      
Sbjct: 677  EHKSKSKKSKRSSSSKDK--KLSREKRKEKQREKSRERHKEREKEREHERNKKILKALNE 734

Query: 406  -SRIDRIQKDTKTGKIRIADDH--KLVNKLAVSLESESKKRYEARKRQMES 549
             S +  ++    T    +  DH  K   K+A  +   +KKR   +++ +++
Sbjct: 735  SSSLSLMEPLKATSTHLLTQDHFKKRYKKIASQVAEVAKKRNRDKRKAIKA 785

>Kpol_1032.25 s1032 complement(53514..54119) [606 bp, 201 aa] {ON}
           complement(53514..54119) [606 nt, 202 aa]
          Length = 201

 Score = 30.8 bits (68), Expect = 2.1
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = +1

Query: 253 RKIGQSKRSGISYDQLAKLSYE-KTLRNLATQDLSEYDNFVNEKD 384
           R I QS++ GI    L    +  K L+ +  ++L EYDN +NE D
Sbjct: 107 RLIYQSRKRGILETDLLLSGFAAKYLKEMTPEELDEYDNLLNELD 151

>Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W
           (REAL)
          Length = 877

 Score = 31.2 bits (69), Expect = 2.4
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 1/90 (1%)
 Frame = +1

Query: 295 QLAKLSYEKTLRNLATQDLSEYDNFVN-EKDHKNISKISRIDRIQKDTKTGKIRIADDHK 471
           Q+  L  EK  +++  + L   DN  N E+  KN+ +  ++ R + + KT +  +  +HK
Sbjct: 689 QVIVLKSEK--QDITAEKLELQDNLENLEEVTKNLQQKVQLQRRELEEKTKQFELIKNHK 746

Query: 472 LVNKLAVSLESESKKRYEARKRQMESAVIP 561
            V      +++ +K     +K    S  IP
Sbjct: 747 RVESKQRGIQNSTKPLGSPKKNDTRSEFIP 776

>Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356W
           (REAL)
          Length = 944

 Score = 31.2 bits (69), Expect = 2.4
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 2/90 (2%)
 Frame = +1

Query: 355 EYDNFVNEKDHKNISKI--SRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEA 528
           E D FV +K H     +  S ++  +K  KT          L N L V+ E  SK   E 
Sbjct: 447 ENDLFVMKKTHSESKSLASSELESKEKLIKT----------LENDLKVAQEKYSKTEKEL 496

Query: 529 RKRQMESAVIPSGVESFINDKNKQFNEKLS 618
           ++R+ +  +  S +E    D+N + N+K+S
Sbjct: 497 KEREFKYKISESNLE----DENTKLNKKIS 522

>TBLA0E02670 Chr5 complement(674590..675120) [531 bp, 176 aa] {ON}
           Anc_3.144 YOL071W
          Length = 176

 Score = 30.4 bits (67), Expect = 2.5
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +1

Query: 265 QSKRSGI-SYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKD 384
           QS++ GI   D L     +K L+ + T++L+EYD  +NE D
Sbjct: 90  QSRKRGILETDLLLSRFAKKYLKTMTTEELNEYDALLNELD 130

>Smik_4.403 Chr4 (729902..733813) [3912 bp, 1303 aa] {ON} YDR159W
            (REAL)
          Length = 1303

 Score = 31.2 bits (69), Expect = 2.5
 Identities = 30/126 (23%), Positives = 57/126 (45%), Gaps = 19/126 (15%)
 Frame = +1

Query: 61   SIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQ-----EY 225
            S  N  L + E+Q +   R P       IND D+    ++S ++D  +    Q     E 
Sbjct: 660  SFSNGSLPNPEVQASEPFRIPTT-----INDTDDEKSKSKSLEQDDKWSKEKQRIEKEEI 714

Query: 226  IAWEQRHHQ--------------RKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYD 363
            +  +++ ++              RK+  S  + I  D+++++++ K L    TQ+L  Y+
Sbjct: 715  LLKKKQENENKKEITEQIANELIRKVVNSNVTNIVKDEISEVNHRKKLIETMTQEL--YN 772

Query: 364  NFVNEK 381
             FV+EK
Sbjct: 773  AFVHEK 778

>CAGL0H00308g Chr8 complement(22157..23119) [963 bp, 320 aa] {ON}
           similar to uniprot|Q06188 Saccharomyces cerevisiae
           YLR455w
          Length = 320

 Score = 30.8 bits (68), Expect = 2.6
 Identities = 30/133 (22%), Positives = 63/133 (47%), Gaps = 9/133 (6%)
 Frame = +1

Query: 136 MEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQRHHQR---KIGQSKRSGISYD--QL 300
           +ED+   +E  G  +S +     H T  +  + +++   +   K+  SK+   S D   +
Sbjct: 115 IEDLEKDEELYGKLKSGEDP---HITDPDTNSRKRKSSSKDDGKVSSSKKIKASKDITSM 171

Query: 301 AKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKI--SRIDR--IQKDTKTGKIRIADDH 468
           AK S  + + + +     +  N ++    + IS +   RI R  IQ+DT    + + + H
Sbjct: 172 AKSSDNQLIIDNSVDKEKKKSNKLDRSRREEISLLLRRRIQRNLIQRDTPPTDVELQESH 231

Query: 469 KLVNKLAVSLESE 507
           KL++K+  +L+ +
Sbjct: 232 KLLSKIKENLDDQ 244

>YNL110C Chr14 complement(417826..418488) [663 bp, 220 aa] {ON}
           NOP15Constituent of 66S pre-ribosomal particles,
           involved in 60S ribosomal subunit biogenesis; localizes
           to both nucleolus and cytoplasm
          Length = 220

 Score = 30.4 bits (67), Expect = 2.9
 Identities = 37/160 (23%), Positives = 61/160 (38%), Gaps = 2/160 (1%)
 Frame = +1

Query: 139 EDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYE 318
           ED  D DE  G   S D+    H   +      ++    K  + K++   Y  +  +S  
Sbjct: 42  EDEKDEDEIEGLAASDDEQSGTHKIKRLN---PKKQANEKKSKDKKTLEEYSGIIYVS-- 96

Query: 319 KTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSL 498
           +       ++LS+Y  F    D K +       R+ ++ KTG  R     + VNK    +
Sbjct: 97  RLPHGFHEKELSKY--FAQFGDLKEV-------RLARNKKTGNSRHYGFLEFVNKEDAMI 147

Query: 499 ESESKKRYEARKRQMESAVIPSG--VESFINDKNKQFNEK 612
             ES   Y      ++  V+P G  +E     K +   EK
Sbjct: 148 AQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEK 187

>TPHA0M00460 Chr13 complement(87266..87730) [465 bp, 154 aa] {ON}
           Anc_3.144 YOL071W
          Length = 154

 Score = 30.0 bits (66), Expect = 2.9
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%)
 Frame = +1

Query: 253 RKIGQSKRSGI-SYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKD 384
           R I QS++ GI   D L      K L+ +  Q L EYD+ +NE D
Sbjct: 61  RLIYQSRKRGILETDLLLSRFAAKYLKTMTPQQLDEYDSLLNELD 105

>Suva_14.229 Chr14 complement(414648..415316) [669 bp, 222 aa] {ON}
           YNL110C (REAL)
          Length = 222

 Score = 30.4 bits (67), Expect = 2.9
 Identities = 41/190 (21%), Positives = 73/190 (38%), Gaps = 3/190 (1%)
 Frame = +1

Query: 52  VNVSIKNRK-LADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYI 228
           VN   K  K +  +E +E  +       + ED  D D+  G   S D+    H   +   
Sbjct: 14  VNQKTKEEKPVQKKEEEELQLESSSTSSDEEDKKDEDKIEGLAVSDDEQDGTHKIKKLN- 72

Query: 229 AWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKIS 408
              ++   +KI + K+    Y  +  +S  +       ++LS+Y  F    D + +    
Sbjct: 73  --PKKQVDQKISKDKKKLDEYSAIIYVS--RLPHGFHEKELSKY--FAQFGDLREV---- 122

Query: 409 RIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSG--VESFI 582
              R+ ++ KTG  R     + VNK    +  ES   Y      ++  ++P G  +E   
Sbjct: 123 ---RLARNKKTGNSRHYGFLEFVNKEDALVAQESMNNYLLMGHLLQVRLLPKGAKIEKLY 179

Query: 583 NDKNKQFNEK 612
             K +   EK
Sbjct: 180 KYKKRVLVEK 189

>KLTH0E07480g Chr5 complement(687623..689224) [1602 bp, 533 aa] {ON}
           weakly similar to uniprot|P53191 Saccharomyces
           cerevisiae YGL023C
          Length = 533

 Score = 30.8 bits (68), Expect = 3.0
 Identities = 24/94 (25%), Positives = 36/94 (38%), Gaps = 9/94 (9%)
 Frame = +1

Query: 181 SSDKDRAFHYTAQEYIAWEQRHHQRKIG-----QSKRSGISYDQLAKL----SYEKTLRN 333
           S  K  A HY  + +  WE++HH R  G     Q  R  +  D+ A+     +    L  
Sbjct: 399 SDSKRHACHYCHKIFTFWERKHHCRHCGDIFCSQHVRHWLYLDKDARFVIGGAGVGALSK 458

Query: 334 LATQDLSEYDNFVNEKDHKNISKISRIDRIQKDT 435
           +    L EYD  V E    + +     +   K T
Sbjct: 459 ICDGCLQEYDKLVREGPSSSAANAQTTNETPKST 492

>TDEL0E01580 Chr5 (310526..312334) [1809 bp, 602 aa] {ON} Anc_4.215
           YGR068C
          Length = 602

 Score = 30.8 bits (68), Expect = 3.0
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 9/75 (12%)
 Frame = +1

Query: 334 LATQDLSEYDNFVNEKDH--KNISKISRI----DRIQKDTKTGKIR---IADDHKLVNKL 486
           +  Q L+E+D F+N  D    ++++I+ I    D ++K T+   +R   I   HKL  K+
Sbjct: 348 MTKQSLTEFDEFLNNPDRLLTDVTEINSIFQTPDNLKKITQDCDLRGDLIQVRHKLAIKI 407

Query: 487 AVSLESESKKRYEAR 531
            ++   ++ KR E +
Sbjct: 408 VLTRAEDTTKRLEIK 422

>AER200C Chr5 complement(1012538..1013020) [483 bp, 160 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL071W
           (EMI5)
          Length = 160

 Score = 30.0 bits (66), Expect = 3.1
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 238 QRHHQRKIGQSKRSGISYDQLAKLSYE-KTLRNLATQDLSEYDNFVNEKD 384
           ++   R + QS++ GI    L    +  K L+++  ++L+EYD  +NE D
Sbjct: 62  EQQRARLVYQSRKRGILETDLLLSGFAAKYLKHMTAEELNEYDELLNELD 111

>TDEL0D04790 Chr4 complement(876408..876899) [492 bp, 163 aa] {ON}
           Anc_3.144 YOL071W
          Length = 163

 Score = 30.0 bits (66), Expect = 3.1
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +1

Query: 253 RKIGQSKRSGI-SYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKD 384
           R I QS++ GI   D L      K L++++ ++L EYD+ +NE D
Sbjct: 66  RLIYQSRKRGILETDLLLSRFAAKYLKDMSLKELEEYDSLLNELD 110

>Smik_2.296 Chr2 complement(537111..539210) [2100 bp, 699 aa] {ON}
           YBR156C (REAL)
          Length = 699

 Score = 30.8 bits (68), Expect = 3.1
 Identities = 23/107 (21%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +1

Query: 79  LADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQRHHQRK 258
           +AD    E+  ++  R+ N++ +   +      E  D  + F       +  +Q HH+RK
Sbjct: 493 IADTSKPESRKSKSYRLTNLQLLPPAE-----AERGDLKKKFDKRLSGIMRSQQEHHRRK 547

Query: 259 IGQSKR-SGISYDQLAKLSYEKTLRNLATQD-LSEYDNFVNEKDHKN 393
             + KR S +  D   + S+    ++   ++ L  +DN + + +HK+
Sbjct: 548 QEKQKRMSHLEQDLKKQASFNNDYKDTRLKESLPPFDNRMRDPNHKS 594

>NDAI0B02590 Chr2 complement(647421..647915) [495 bp, 164 aa] {ON}
           Anc_3.144 YOL071W
          Length = 164

 Score = 30.0 bits (66), Expect = 3.1
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = +1

Query: 238 QRHHQRKIGQSKRSGI-SYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKD 384
           +R   R I QS++ GI   D L      K L+++   +L EYD  +NE D
Sbjct: 66  ERTRSRLIYQSRKRGILETDLLLSAFAAKYLKDMDVVELKEYDELLNELD 115

>Kwal_56.22618 s56 complement(207409..209631) [2223 bp, 740 aa] {ON}
           YGR130C - Hypothetical ORF [contig 184] FULL
          Length = 740

 Score = 30.8 bits (68), Expect = 3.1
 Identities = 23/153 (15%), Positives = 71/153 (46%), Gaps = 5/153 (3%)
 Frame = +1

Query: 145 INDVDESVGYTESS-----DKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKL 309
           +  VDE V + +S+     ++ ++ + T ++Y+A E +    ++ ++ ++ +++    +L
Sbjct: 273 LTPVDEFVSWKKSTSGLEVEQYKSIYQTPKDYVALEDQFDSLEVNKNSKTYLNFLNTIEL 332

Query: 310 SYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLA 489
                  N ++ DLS+    V       +   ++++ +    +   + IAD ++     +
Sbjct: 333 L------NGSSHDLSKNHTLVEFSSTALVLAKNKLEAVANLREKEVVEIADVNRSTEVSS 386

Query: 490 VSLESESKKRYEARKRQMESAVIPSGVESFIND 588
           ++ ++E  K  + +  + E + +    +S + D
Sbjct: 387 IASKNEDSKSRQIKALEAELSSLRDKYDSSLED 419

>NDAI0J02920 Chr10 complement(730198..732477) [2280 bp, 759 aa] {ON}
           Anc_4.364 YJR134C
          Length = 759

 Score = 30.8 bits (68), Expect = 3.1
 Identities = 27/150 (18%), Positives = 64/150 (42%), Gaps = 10/150 (6%)
 Frame = +1

Query: 157 DESVGY----TESSDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKT 324
           D+S  Y    + + +   + H    +Y   +Q+ +  K        I +    K++   T
Sbjct: 340 DQSSSYLINNSNNDNSSTSLHNVRNQYELIQQQFNSSK---QNWESIEFSLNTKITDLNT 396

Query: 325 LRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKT---GKIRIADDHKLVNKLAVS 495
           L   +  D+ + +  ++E   +N    S++D+  +        K  ++ + + +NK    
Sbjct: 397 LLKGSKDDIDKLEKKIDELKLENSQLNSQLDKDHEKISNLTEEKKSLSSELESLNKSLHD 456

Query: 496 LESES---KKRYEARKRQMESAVIPSGVES 576
           L  +    +K+Y  +K Q++  ++PS + S
Sbjct: 457 LREDHALLEKKYNIQKSQLQQNIVPSSISS 486

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score = 30.8 bits (68), Expect = 3.3
 Identities = 35/164 (21%), Positives = 69/164 (42%), Gaps = 10/164 (6%)
 Frame = +1

Query: 178  ESSDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSE 357
            E  +++       +E    E+   +    QS+ +  S + + K+  E T  +   + L+ 
Sbjct: 739  EEEEEEEEEEEEEEEEEEGEEEEEEEGDDQSEDNDYSNEDINKIDKETT--SALAKALNL 796

Query: 358  YDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEA--- 528
             D  +NE    N +++S  D   +  +       DD K++ +L   L    ++R EA   
Sbjct: 797  PDGIINENGEVNFNELSESDDEDESEEDEDEESMDDEKMM-ELDDQLSQIFQRRKEALSK 855

Query: 529  ----RKRQMESAVIPSGVESF---INDKNKQFNEKLSRESRNSE 639
                 KR++E+      V +F   + D  + F + + R S+N E
Sbjct: 856  ISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTSKNKE 899

>KLLA0C02915g Chr3 (261280..265170) [3891 bp, 1296 aa] {ON} similar
           to uniprot|P12753 Saccharomyces cerevisiae YNL250W RAD50
           Subunit of MRX complex with Mre11p and Xrs2p involved in
           processing double-strand DNA breaks in vegetative cells
           initiation of meiotic DSBs telomere maintenance and
           nonhomologous end joining
          Length = 1296

 Score = 30.8 bits (68), Expect = 3.3
 Identities = 25/100 (25%), Positives = 49/100 (49%)
 Frame = +1

Query: 298 LAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLV 477
           LAK  +E+T      + LS   N   +K+ +     S ++++   TK  + R+ D  K V
Sbjct: 401 LAKHHFEETTLE---EKLSVLRNSFAKKEQQLSYISSDLNKLADQTKKLRNRLND--KRV 455

Query: 478 NKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDKNK 597
           ++  + +E E+   YE++ +Q  +  I   + + I  KN+
Sbjct: 456 SEKDLKVEKEALNNYESKLKQWNTERIVDAISTSIKTKNQ 495

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]
           {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
           YJL095w BCK1
          Length = 1447

 Score = 30.8 bits (68), Expect = 3.3
 Identities = 39/149 (26%), Positives = 60/149 (40%), Gaps = 7/149 (4%)
 Frame = +1

Query: 181 SSDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEY 360
           S D      +T    IAW + H          S I+  +  +L  ++ LR LA      Y
Sbjct: 164 SWDPTNPDEWTLSRVIAWFKFH------DFPDSWIAVFKRHQLCGQRFLRLLA------Y 211

Query: 361 DNFVNEKDHKNISKISRIDRIQ---KDTKTGKIRIADDHKLVNKLAVSLESESKK----R 519
           DNF   + H  ISK +  D+ Q   KDT    +  +   +       ++  E  K    R
Sbjct: 212 DNFAIYEKHLPISKNASFDKFQALLKDTMKKNVSSSHSRQRSGNSVAAMHIEPNKGVNLR 271

Query: 520 YEARKRQMESAVIPSGVESFINDKNKQFN 606
           +++ + Q +     S  ES IN  N+Q N
Sbjct: 272 HKSSRSQDDIVGSRSASESGIN--NEQLN 298

>ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] {ON}
            similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 2005

 Score = 30.8 bits (68), Expect = 3.4
 Identities = 42/188 (22%), Positives = 85/188 (45%), Gaps = 9/188 (4%)
 Frame = +1

Query: 76   KLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQRHH-- 249
            KLA +E QE N     +  N +++N + + +   E   K         E    EQR+   
Sbjct: 1080 KLA-KEKQELN---DAKGSNEKELNKLKKDLEGKEQKLKSITERAQELEKTLDEQRNSNA 1135

Query: 250  --QRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKI-SRIDR 420
              +RK+ ++ ++ + + +   +S  K L N   Q L      ++E++ K++ ++ +R+  
Sbjct: 1136 DSERKLKENIKA-LEHQKKEAISNSKELENELDQ-LKNKHKSLDEQNTKSVEELKTRVLE 1193

Query: 421  IQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESA----VIPSGVESFIND 588
            ++K+         + H  V K+   L+ ESK     +K Q  +     V+   ++S + +
Sbjct: 1194 VEKERD-------EKHNNVQKIENKLQEESKSLESLQKSQESNKSKLKVLQDKLDSLLQE 1246

Query: 589  KNKQFNEK 612
            KN   +EK
Sbjct: 1247 KNDLVSEK 1254

>Kwal_14.2111 s14 (610460..610636) [177 bp, 58 aa] {OFF} [contig
           229] FULL
          Length = 58

 Score = 28.1 bits (61), Expect = 3.7
 Identities = 19/49 (38%), Positives = 23/49 (46%)
 Frame = -2

Query: 479 FTSLWSSAILILPVLVSFCILSILLILDMFL*SFSLTKLSYSLKSCVAR 333
           F S  S + L LPVL  F      LI  +F   FS+ + S S  S V R
Sbjct: 3   FPSSSSDSSLFLPVLFDFSDTFSFLIFSLFSIRFSIHRNSNSFSSSVKR 51

>TPHA0F01940 Chr6 (437533..439053) [1521 bp, 506 aa] {ON} Anc_2.129
           YNL137C
          Length = 506

 Score = 30.4 bits (67), Expect = 3.9
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 21/123 (17%)
 Frame = +1

Query: 322 TLRNLATQDLSEYDN-------FVNEKDHKNISK-----ISRIDRIQKD-TKTGKIRIAD 462
           TL+NLATQ   E+ N        +  K  + IS      +S  D I+K+ T + K+ +  
Sbjct: 300 TLKNLATQCYQEFSNSKLFDFESIKAKSEEEISTLVKDLLSPSDNIKKNLTDSQKVSMRT 359

Query: 463 DHKLVNKLAVSLESESKKRYEARKRQMESAVIP---SGVESFINDKNKQF-----NEKLS 618
             K +++L        +K Y+  K   +S  +P   + + S +  +   F     NE+L+
Sbjct: 360 GKKHLSELEKKYSEAIRKYYKIAKNDSKSNELPFDSNWINSLVAHEKLDFAKLADNEQLA 419

Query: 619 RES 627
           + S
Sbjct: 420 QTS 422

>CAGL0I08085g Chr9 (790086..790547) [462 bp, 153 aa] {ON} similar to
           uniprot|Q08230 Saccharomyces cerevisiae YOL071w
          Length = 153

 Score = 29.6 bits (65), Expect = 3.9
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = +1

Query: 253 RKIGQSKRSGISYDQLAKLSYE-KTLRNLATQDLSEYDNFVNEKD 384
           R I QS++ GI    L    +  K LR++  ++L EYD  +NE D
Sbjct: 60  RLIYQSRKRGILETDLLLSGFAAKHLRSMTNEELDEYDALLNELD 104

>Kpol_1029.3 s1029 complement(3577..4251) [675 bp, 224 aa] {ON}
           complement(3577..4251) [675 nt, 225 aa]
          Length = 224

 Score = 30.0 bits (66), Expect = 4.0
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 2/76 (2%)
 Frame = +1

Query: 409 RIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSG--VESFI 582
           ++ R+ ++ KTGK R     + VNK    +  ES   Y      ++  ++P G  +E   
Sbjct: 122 KVVRLARNKKTGKSRHYGFVEFVNKDDAKVAHESMDNYLLLGHLLKVKLLPKGAKIEKLF 181

Query: 583 NDKNKQFNEKLSRESR 630
             K + F+E   ++SR
Sbjct: 182 KYKKRVFSETPVKKSR 197

>KLLA0B02981g Chr2 complement(267798..269789) [1992 bp, 663 aa] {ON}
           similar to uniprot|Q07457 Saccharomyces cerevisiae
           YDL074C BRE1 E3 ubiquitin ligase for Rad6p required for
           the ubiquitination of histone H2B recruitment of Rad6p
           to promoter chromatin and subsequent methylation of
           histone H3 (on L4 and L79) contains RING finger domain
          Length = 663

 Score = 30.4 bits (67), Expect = 4.1
 Identities = 24/96 (25%), Positives = 39/96 (40%)
 Frame = +1

Query: 319 KTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSL 498
           K+  N   +    Y+N + + D ++   +SR+     D    K       K  +  A S+
Sbjct: 149 KSSENKLKKATEYYENIIAQYDRQDSESVSRVFNTADDDSNVK-----KEKQSSTGASSV 203

Query: 499 ESESKKRYEARKRQMESAVIPSGVESFINDKNKQFN 606
             ES    +  +   ESAV  +  E  IND N Q +
Sbjct: 204 NDESNDNSDKSQSNKESAVSQAHHEIEINDLNTQIS 239

>KAFR0D02270 Chr4 (459308..461437) [2130 bp, 709 aa] {ON} Anc_5.696
           YIL144W
          Length = 709

 Score = 30.4 bits (67), Expect = 4.1
 Identities = 18/98 (18%), Positives = 43/98 (43%)
 Frame = +1

Query: 304 KLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNK 483
           K+S EK   N    DL+++ N+++  + K++    +ID++  + +  K    D    +  
Sbjct: 353 KVSIEKY--NALKGDLTKFQNYISTMESKSVEWPKKIDKMNSELEKKKSETNDIENDIRN 410

Query: 484 LAVSLESESKKRYEARKRQMESAVIPSGVESFINDKNK 597
           +  SL+       +  ++  E   +   V+   +  +K
Sbjct: 411 ILKSLDDRGLSIEQIEEQNKEKEALMHEVDEITDQTDK 448

>NCAS0I01180 Chr9 (212245..214539) [2295 bp, 764 aa] {ON} Anc_3.343
           YBR102C
          Length = 764

 Score = 30.4 bits (67), Expect = 4.2
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +1

Query: 247 HQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRID 417
           H +K   + R   +   LAK+S  KTLR++ +       NFV    H+N+S+ + ID
Sbjct: 128 HMQKPLNTGRPKEARSSLAKISQPKTLRSILSNPSFNAKNFV----HENLSEANAID 180

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
           similar to uniprot|Q06704 Saccharomyces cerevisiae
           YLR309c IMH1
          Length = 867

 Score = 30.4 bits (67), Expect = 4.2
 Identities = 26/121 (21%), Positives = 58/121 (47%), Gaps = 14/121 (11%)
 Frame = +1

Query: 316 EKTLRNLATQDLSEYDNFVNEKDHKNISKISRID------RIQKD--TKTGKIRIADDHK 471
           E  +R L  Q L   +    E  +K + K+  ++      +++ D  TK+ + ++AD  K
Sbjct: 138 EAKIRELEEQ-LETQNRNSKENSNKLVEKVKLLEEEAQAMKLENDKLTKSTETQLADKQK 196

Query: 472 LVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDKNKQFNE------KLSRESRN 633
           L+++L   ++    K  EA +   +       ++S I++K K+ +       ++S +S+N
Sbjct: 197 LIDQLKGQIQELEDKSREAFENSNDVTGETESLKSTIDEKQKEIDSLKAQILEISTKSQN 256

Query: 634 S 636
           +
Sbjct: 257 T 257

>TDEL0B02780 Chr2 (495985..499077) [3093 bp, 1030 aa] {ON} Anc_5.645
           YOR048C
          Length = 1030

 Score = 30.4 bits (67), Expect = 4.3
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 12/118 (10%)
 Frame = +1

Query: 229 AWEQRHHQRKI--GQSKRSGISYDQLAKLSYEKTLR----NLATQDLSEYDNFV---NEK 381
           A ++R  QR +  GQ +   +  +QL        L     NL T D+  +   +   NE 
Sbjct: 405 AIQRRKLQRNVSKGQDRHPTVPSEQLQLYDTNGQLAAGSWNLTTHDMVNFKKEIMLANEG 464

Query: 382 DHKNISKISRIDRIQKDTKTGKIRIADDHKLVN---KLAVSLESESKKRYEARKRQME 546
           D + I+ I +  R + D    +I   D  K+VN   K   S+    KK+  A+KR++E
Sbjct: 465 DPEAIA-IVKAHRDRNDKLMEEISTQDMEKVVNDANKANYSVADAMKKKLMAKKRKLE 521

>TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa]
           {ON} Anc_4.46 YLR309C
          Length = 1065

 Score = 30.4 bits (67), Expect = 4.3
 Identities = 39/200 (19%), Positives = 90/200 (45%), Gaps = 12/200 (6%)
 Frame = +1

Query: 61  SIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQ 240
           SI+N +  + +++  N  ++ ++  +E + +  E+    +  D + + H  ++   + E+
Sbjct: 288 SIQNLESDNNKLKNENEEKQSKILTLEQVVEKHEN----KIKDLEESVHEKSKLISSLEE 343

Query: 241 RHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDR 420
              +++I  S     + DQ++      T     +Q +S      N+K +K  + IS+   
Sbjct: 344 -DIKKEIQSSAGQSNTEDQVS------TTLPSTSQTISSKKK--NKKKNKKGNNISQPST 394

Query: 421 IQKDTKTGKIR------------IADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPS 564
            Q   K+   +            + ++H+  ++LA+ LE  +K   E +K   +++ +  
Sbjct: 395 TQAPVKSSDSQEKYNALLKEYEVLKEEHEKSDQLALQLEKITKDFDELKKSHNDNSNLKE 454

Query: 565 GVESFINDKNKQFNEKLSRE 624
             E+F  +K K  N+KL  E
Sbjct: 455 ITENF--EKLKLSNQKLIEE 472

>NDAI0A04630 Chr1 complement(1039623..1043981) [4359 bp, 1452 aa]
           {ON} Anc_3.460 YGR116W
          Length = 1452

 Score = 30.4 bits (67), Expect = 4.4
 Identities = 22/93 (23%), Positives = 44/93 (47%)
 Frame = +1

Query: 151 DVDESVGYTESSDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLR 330
           D D+S G T +  +D A     +++ + E+   +      +R+   YD+L +    +   
Sbjct: 132 DEDKSEGTTRTHKEDSASRL--EDFFSEEENEEEETTTTRRRA--EYDELEEDENNRNRV 187

Query: 331 NLATQDLSEYDNFVNEKDHKNISKISRIDRIQK 429
           +  T  L E D+F+ E +  +  + +R  RIQ+
Sbjct: 188 SHKTGILDELDDFIEEDEFSDEDEETRQHRIQE 220

>KLTH0D09262g Chr4 (769384..770055) [672 bp, 223 aa] {ON} similar to
           uniprot|P53927 Saccharomyces cerevisiae YNL110C NOP15
           Constituent of 66S pre-ribosomal particles involved in
           60S ribosomal subunit biogenesis localizes to both
           nucleolus and cytoplasm
          Length = 223

 Score = 29.6 bits (65), Expect = 5.3
 Identities = 41/181 (22%), Positives = 80/181 (44%), Gaps = 7/181 (3%)
 Frame = +1

Query: 88  REIQEANVNRKPRVYNMEDINDVDES-VGYTESSDKDRAFH--YTAQEYIAWEQRHHQRK 258
           RE Q    N       +E +++ DE+  G  + S   RA    +T ++  A ++R  Q++
Sbjct: 19  REEQLELGNSSSNESEIEGLSEDDEAGSGEEQGSSGSRASSGVHTVKKLDA-KKRESQQE 77

Query: 259 IGQSKRSGISY-DQLAKLSYEKTL-RNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKD 432
            G+  + G S  ++L+ + Y   L +    ++L++Y  F    D + +       R+ ++
Sbjct: 78  GGKGSKKGRSKAEELSGIIYVSRLPKGFHERELAKY--FSQFGDLREV-------RLARN 128

Query: 433 TKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSG--VESFINDKNKQFN 606
            KTG  R     + VNK    +  E+   Y      ++   +P G  +E   + K + F+
Sbjct: 129 KKTGNSRHYGFVEFVNKEDALVAQETMHNYLLMNHLLQVVALPKGKKIEKLFHYKKRAFS 188

Query: 607 E 609
           E
Sbjct: 189 E 189

>KLLA0C16401g Chr3 (1435065..1436903) [1839 bp, 612 aa] {ON} similar
           to uniprot|Q05842 Saccharomyces cerevisiae YDL153C SAS10
           Component of the small (ribosomal) subunit (SSU)
           processosome required for pre-18S rRNa processing
           essential nucleolar protein that when overproduced
           disrupts silencing
          Length = 612

 Score = 30.0 bits (66), Expect = 5.4
 Identities = 31/143 (21%), Positives = 63/143 (44%), Gaps = 12/143 (8%)
 Frame = +1

Query: 76  KLADREIQEANVNRKP-RVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQR--- 243
           ++AD ++QE    +K  R Y  +    +D+      S   DR   +   + I +++R   
Sbjct: 402 EIADVDVQEKKTRKKTLRFYTSK----IDQKA----SKKTDR---FKGDDDIPYKERLYE 450

Query: 244 HHQRKIGQSKRSGISYDQLAKLSY-------EKTLRNLATQDLSEYDNFVN-EKDHKNIS 399
             QR + ++++ G+     A L+        EKT +++     +EY   +  ++ HK  S
Sbjct: 451 RQQRLLEEARKRGLHDKNAADLNTDDINSDDEKTAKDIKRDAENEYYKSIRADRQHKKDS 510

Query: 400 KISRIDRIQKDTKTGKIRIADDH 468
           ++     + K  K GK+    +H
Sbjct: 511 RLQAHKEVAKAAKEGKLAELAEH 533

>SAKL0D07612g Chr4 (624385..626778) [2394 bp, 797 aa] {ON} similar
           to uniprot|Q752H8 Ashbya gossypii AFR606C AFR606Cp and
           weakly similar to YFR013W uniprot|P43596 Saccharomyces
           cerevisiae YFR013W IOC3 Member of a complex (Isw1a) with
           Isw1p that has nucleosome-stimulated ATPase activity and
           represses transcription initiation by specific
           positioning of a promoter proximal dinucleosome has
           homology to Esc8p which is involved in silencing
          Length = 797

 Score = 30.0 bits (66), Expect = 5.6
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +1

Query: 130 YNMEDINDVDESVGYTESSDKDRAFHYTAQE 222
           YN++D N+ D+S GY   S K +  H   QE
Sbjct: 753 YNVDDDNEGDDSDGYERQSQKRKRRHVVRQE 783

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
            Component of the eisosome with unknown function;
            GFP-fusion protein localizes to the cytoplasm;
            specifically phosphorylated in vitro by mammalian
            diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score = 30.0 bits (66), Expect = 5.6
 Identities = 36/176 (20%), Positives = 80/176 (45%), Gaps = 13/176 (7%)
 Frame = +1

Query: 61   SIKNRKLADR-EIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWE 237
            ++KN+KL ++ E+ +   N K  +   +D+N+   +V   E +D        +Q+  A  
Sbjct: 514  NMKNQKLQEKNEVLDKQTNVKSEI---DDLNNEKTNV-QKEFNDWTTNLSNLSQQLDAQI 569

Query: 238  QRHHQRKIGQSKRSG------------ISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEK 381
             + +Q  + Q K               ++  +  K  +EK ++ L + +  EY   +N+ 
Sbjct: 570  FKINQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDI 629

Query: 382  DHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMES 549
            D++  S ++ +  I+++    K +++   K +     + E + K   E RKR+ E+
Sbjct: 630  DNQISSLLNEVTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEEN 685

>NCAS0A11540 Chr1 complement(2283352..2285961) [2610 bp, 869 aa]
           {ON} Anc_3.432 YPR112C
          Length = 869

 Score = 30.0 bits (66), Expect = 5.7
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 1/96 (1%)
 Frame = +1

Query: 355 EYDNF-VNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEAR 531
           EY +F  ++KD +    + ++D +     T K    DDH   ++    L    ++R   R
Sbjct: 207 EYADFNKDQKDEQEDEPMMKLDDLNTTETTEKKTREDDHLAQDEKVSDLNWFKQRRVRIR 266

Query: 532 KRQMESAVIPSGVESFINDKNKQFNEKLSRESRNSE 639
           + + E+A   S  +    + N    E    E++N E
Sbjct: 267 EGESEAAKPSSLSKEGNTEGNASLKENTDSENKNDE 302

>TPHA0B01380 Chr2 (309332..312799) [3468 bp, 1155 aa] {ON} Anc_7.462
           YPR042C
          Length = 1155

 Score = 30.0 bits (66), Expect = 5.8
 Identities = 29/125 (23%), Positives = 54/125 (43%), Gaps = 19/125 (15%)
 Frame = +1

Query: 319 KTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSL 498
           +T+ +L+    SE ++ +N+ ++   S+   I R + +  +  +       L+  ++  L
Sbjct: 83  QTINSLSDHSNSEQEHDINQMENGEQSQKLGIYRTRTEKLSNTLS-----NLLPSISARL 137

Query: 499 ESESKKRYEAR-------------------KRQMESAVIPSGVESFINDKNKQFNEKLSR 621
            S SKK+ + +                   K  + S  I +  E   N KNKQF EKL  
Sbjct: 138 HSSSKKKNKNKNQNDEFVDLRDLQVNLPFPKNNINSDFISNKSEYNKNMKNKQFREKLFS 197

Query: 622 ESRNS 636
            ++NS
Sbjct: 198 FTKNS 202

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
           YIL149C (REAL)
          Length = 1682

 Score = 30.0 bits (66), Expect = 5.9
 Identities = 24/108 (22%), Positives = 52/108 (48%), Gaps = 7/108 (6%)
 Frame = +1

Query: 316 EKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGK-IRIADDHKLVNKLAV 492
           +K+L  L  Q + E  + + E +H N +  SRID + ++  + K +  A+ +K+    A 
Sbjct: 549 DKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYADAAN 608

Query: 493 SLESESKKRYEARKRQM------ESAVIPSGVESFINDKNKQFNEKLS 618
             E+ + K+ +  + ++       SAV+    +  +  K  Q N +++
Sbjct: 609 KTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIA 656

>NDAI0K00950 Chr11 (215066..220258) [5193 bp, 1730 aa] {ON}
           Anc_8.753
          Length = 1730

 Score = 30.0 bits (66), Expect = 5.9
 Identities = 19/80 (23%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = +1

Query: 346 DLSEYDNFVNEKDHK-NISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRY 522
           ++ +Y+    +++ K N+   S +D+    ++    R+   HKL+N   V+LE + +KR 
Sbjct: 650 EILQYEKRKKQEEQKLNLIINSSVDQYTIRSEKRNRRLKHGHKLIN-THVTLEKDEQKRI 708

Query: 523 EARKRQMESAVIPSGVESFI 582
           E + ++   A+  +  E++I
Sbjct: 709 ERKAKERLQALKANDEEAYI 728

>Skud_4.521 Chr4 complement(929170..930309) [1140 bp, 379 aa] {ON}
           YDR259C (REAL)
          Length = 379

 Score = 29.6 bits (65), Expect = 6.5
 Identities = 37/170 (21%), Positives = 70/170 (41%), Gaps = 19/170 (11%)
 Frame = +1

Query: 106 NVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGI 285
           NV+  P   N++ +    +++  T  + ++R    TAQ+  A+ QR  +      ++S I
Sbjct: 198 NVSEPPVERNIQQVGGSGKALRNTRRAAQNR----TAQK--AFRQRKEKYIKNLEQKSKI 251

Query: 286 SYDQLAKLSYEKTL------------------RNLATQDLSEYDNFVNEKDH-KNISKIS 408
             D LA+ +Y K+L                  RN  T    EYD   NE +  KN + I 
Sbjct: 252 FDDLLAENNYFKSLNDSLRNDNNILIAQQEAIRNAITMLRGEYDALCNENNMLKNENNII 311

Query: 409 RIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVI 558
           + +      +   +++ +       + +  + ES +R E  +R     +I
Sbjct: 312 KNEHNMSRNENENLKLENKRFHAEYIRMIEDIESTRRREQEQRNEREQLI 361

>TPHA0K02070 Chr11 (442519..443664) [1146 bp, 381 aa] {ON} Anc_4.37
           YLL022C
          Length = 381

 Score = 29.6 bits (65), Expect = 6.5
 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 1/94 (1%)
 Frame = +1

Query: 349 LSEYDNFVNEKDHKNISKISRIDRIQKDTKTGK-IRIADDHKLVNKLAVSLESESKKRYE 525
           L++Y  F  +K HK I   ++I  ++K   TG  +   DD + + ++   +E    +   
Sbjct: 271 LTDYSAFTKDK-HKEILNSTQI-LLKKRIDTGSSMDKEDDEQQLKQIENDIEDLDDENAG 328

Query: 526 ARKRQMESAVIPSGVESFINDKNKQFNEKLSRES 627
           ++KR++E ++    ++  I  K   F+   S ES
Sbjct: 329 SKKRKLEESIDTEALKKIILQKAMGFDFASSEES 362

>KAFR0J02510 Chr10 (477429..478703) [1275 bp, 424 aa] {ON} Anc_6.320
           YNR021W
          Length = 424

 Score = 29.6 bits (65), Expect = 6.7
 Identities = 24/107 (22%), Positives = 46/107 (42%)
 Frame = +1

Query: 319 KTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSL 498
           KTL ++    +  YDNF  +   K  S +   D ++K+       +    K      + +
Sbjct: 320 KTLNDIIAIAVEIYDNFTRDLVQKKASTLVTSDILRKNINFRNQELQKIIKSAKDAELEI 379

Query: 499 ESESKKRYEARKRQMESAVIPSGVESFINDKNKQFNEKLSRESRNSE 639
             E ++  E  K++    +  +G ++ I+ K K   EK  R +RN +
Sbjct: 380 IKEQQREIEKEKKR---ELRKTGQQANIDQKMK---EKRERRARNKQ 420

>NCAS0B08730 Chr2 (1682303..1682992) [690 bp, 229 aa] {ON} Anc_1.71
           YER018C
          Length = 229

 Score = 29.3 bits (64), Expect = 7.2
 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 8/87 (9%)
 Frame = +1

Query: 403 ISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQME---SAVI--PSG 567
           I R+D++QK+ +  +I I       ++     ES     Y+ RKRQ+E   +A++   S 
Sbjct: 55  IGRLDKLQKEQEGLEIEIQTFKNDTDEARTKFES-----YQIRKRQLEMQHTALLTESSE 109

Query: 568 VESFINDKNK---QFNEKLSRESRNSE 639
           ++  + +K K   Q+ EKL  + +  +
Sbjct: 110 LDGMLQEKEKKISQYKEKLQSQRQRDQ 136

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
           YNL186W
          Length = 661

 Score = 29.6 bits (65), Expect = 7.3
 Identities = 38/175 (21%), Positives = 72/175 (41%), Gaps = 9/175 (5%)
 Frame = +1

Query: 118 KPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQRHHQRKIGQS---KRSGIS 288
           +P+  ++ D+ DV+ + GYT SS  +  FH  A EY   E       +G +   + SG S
Sbjct: 93  QPQDESLSDV-DVNAASGYTGSSSSEEEFH-EASEYANGED------LGMAVDMEESGSS 144

Query: 289 YDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDH 468
            DQ  K        + ++++ S  D         ++S++S  +R+Q   +  +     + 
Sbjct: 145 SDQEFKADDVPHESDESSEEESSED---------SVSRVSDSERVQLQEEAQEAEAIVEK 195

Query: 469 KLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESF------INDKNKQFNEKL 615
                     E E K +    +R +   VI   ++ F      IND+    + ++
Sbjct: 196 AKEEGEEEGEEEELKHKAPLSQRSVTPPVILGDIQQFYQVGEDINDRGSNGSSRV 250

>Kpol_1004.54 s1004
           complement(117670..118272,118275..118310,118312..119670)
           [1998 bp, 665 aa] {ON}
           complement(117670..118272,118275..118310,118312..119670)
           [1998 nt, 666 aa]
          Length = 665

 Score = 29.6 bits (65), Expect = 7.3
 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 3/53 (5%)
 Frame = +1

Query: 88  REIQEANVNRKPRVYNMEDINDVDESVGYTESS---DKDRAFHYTAQEYIAWE 237
           ++IQ  ++  +      +  ND+ +   Y +S    DKDR F  T+++YI+++
Sbjct: 474 KQIQSEDIESRREPDGFKRSNDIQKQKEYIQSDENQDKDRVFRSTSKKYISFK 526

>NCAS0D03670 Chr4 (684291..686354) [2064 bp, 687 aa] {ON} Anc_6.188
           YGL086W
          Length = 687

 Score = 29.6 bits (65), Expect = 7.3
 Identities = 34/163 (20%), Positives = 72/163 (44%), Gaps = 13/163 (7%)
 Frame = +1

Query: 106 NVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQR-------HHQRKIG 264
           +V R  ++   E++  +DE+   T SS+  +  +    + +A E+        ++++ + 
Sbjct: 322 DVIRNWKLLKKENLMLIDENSKVTLSSNNLKILN----DELAMERNQLLDLNNNYEQNLI 377

Query: 265 QSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNE------KDHKNISKISRIDRIQ 426
             K+     +Q   LS+E+    L  + L E+DNFVNE      KD  N +    +D  +
Sbjct: 378 NMKKLNHELEQQKLLSFEEC--KLLRKQLDEFDNFVNEAQGEKSKDGNNENYKDLVDEYK 435

Query: 427 KDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAV 555
             T+     + ++ K +N+       +  +  + RK    S++
Sbjct: 436 NKTED----LTNELKRINEEQRQQNQQQSQTNKKRKTNDSSSL 474

>Smik_15.87 Chr15 (160826..161302) [477 bp, 158 aa] {ON} YOL071W
           (REAL)
          Length = 158

 Score = 28.9 bits (63), Expect = 7.4
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +1

Query: 238 QRHHQRKIGQSKRSGISYDQLAKLSYE-KTLRNLATQDLSEYDNFVNEKD 384
           ++   R I QS++ GI    L    +  K L+ +  ++L EYD+ +NE D
Sbjct: 60  EKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELD 109

>NDAI0A03300 Chr1 (747732..750479) [2748 bp, 915 aa] {ON} 
          Length = 915

 Score = 29.6 bits (65), Expect = 7.6
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 1/84 (1%)
 Frame = +1

Query: 388 KNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSG 567
           K+ S+ S+   +Q+  +  ++ +    K  +K A+  +S+ KKR+        S    S 
Sbjct: 71  KSSSQPSQKQVLQQQLQHNQLPLRTPTKEQSK-AIKTKSDEKKRWSFMSTTSSSKKRWST 129

Query: 568 VESFIND-KNKQFNEKLSRESRNS 636
           + SF ND KN+   EK    S NS
Sbjct: 130 LSSFTNDSKNEHVREKEKHSSHNS 153

>YOL071W Chr15 (196507..196995) [489 bp, 162 aa] {ON}  EMI5Subunit
           of succinate dehydrogenase, which couples succinate
           oxidation to ubiquinone reduction; required for FAD
           cofactor attachment to Sdh1p; mutations in human
           ortholog PGL2 are associated with neuroendocrine tumors
           (paraganglioma)
          Length = 162

 Score = 28.9 bits (63), Expect = 7.6
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 8/76 (10%)
 Frame = +1

Query: 181 SSDKDRAFHYTAQEYIAWEQRHHQ-------RKIGQSKRSGISYDQLAKLSYE-KTLRNL 336
           SSDKD       +  IA  +R ++       R I QS++ GI    L    +  K L+ +
Sbjct: 37  SSDKDDHDDVVTRIKIAPIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKM 96

Query: 337 ATQDLSEYDNFVNEKD 384
             ++L EYD+ +NE D
Sbjct: 97  NEEELEEYDSLLNELD 112

>NCAS0E01130 Chr5 complement(212422..215487) [3066 bp, 1021 aa] {ON}
           Anc_3.433 YGR094W
          Length = 1021

 Score = 29.6 bits (65), Expect = 7.6
 Identities = 24/98 (24%), Positives = 42/98 (42%)
 Frame = +1

Query: 232 WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 411
           W++++H+R   Q KR G SYD   +        + A ++      FV   D   I + SR
Sbjct: 173 WKEKYHKRIKNQLKRLGASYDWSREAFTLDPKLSTAVKEA-----FVRLHDAGIIYRASR 227

Query: 412 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYE 525
           +       KT    +  D+K++N   +    + K + E
Sbjct: 228 LVNWSVKLKTTISNLEVDNKIINGRTLLTVPDYKDKIE 265

>NCAS0A14800 Chr1 (2918211..2921429) [3219 bp, 1072 aa] {ON}
           Anc_7.463 YJR092W
          Length = 1072

 Score = 29.6 bits (65), Expect = 7.7
 Identities = 40/137 (29%), Positives = 66/137 (48%), Gaps = 12/137 (8%)
 Frame = +1

Query: 256 KIGQSKRSGISYDQLAKLSYEKTLRNLA-TQDLSEYDN---FVNEK--------DHKNIS 399
           K   SK    S D+ A+L+ ++   +L+ T DLSEYDN   F+N K        D+  I 
Sbjct: 109 KTEYSKLEKNSDDKAAELNLDQKFIDLSETTDLSEYDNSSAFLNSKIKEENTPSDNSFIK 168

Query: 400 KISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESF 579
           K  +I ++  D  T +  IA++    +   V   S+ +KR+    +Q+ S  I S +   
Sbjct: 169 KF-KIAQLSSDEST-ESSIANETDTEHPYGV---SQIEKRF---SKQISS--IHSDLNQL 218

Query: 580 INDKNKQFNEKLSRESR 630
            N  + Q  + LS +S+
Sbjct: 219 ANKSSIQAIQALSEQSK 235

>KNAG0G03330 Chr7 (717383..720769) [3387 bp, 1128 aa] {ON} Anc_8.824
           YML104C
          Length = 1128

 Score = 29.6 bits (65), Expect = 7.7
 Identities = 21/78 (26%), Positives = 35/78 (44%)
 Frame = +1

Query: 382 DHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIP 561
           D  ++S   R  ++ +D+K+  +   D H++V+ L   LE    +    R    ES  + 
Sbjct: 424 DPTSLSYFRRFLKMNEDSKS--LLYLDFHQMVDSLKDPLEDAGTENIAIRYTDRESTQLK 481

Query: 562 SGVESFINDKNKQFNEKL 615
              ESF  D N Q   +L
Sbjct: 482 HIRESFFTDSNLQSMREL 499

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] {ON}
            YDR507C (REAL)
          Length = 1136

 Score = 29.6 bits (65), Expect = 7.7
 Identities = 31/159 (19%), Positives = 73/159 (45%), Gaps = 13/159 (8%)
 Frame = +1

Query: 193  DRAFHYTAQEYIAWEQRHHQRKIGQSK-RSGISYDQLAKLSYEKTLRNLATQDLSEYDNF 369
            D  F Y   E I  E+   +RK+ ++K R  +   +  +   E+T + L  ++L      
Sbjct: 548  DEIFEYEKYEQIRKEKEELERKVREAKAREELERRRRRQEEKERTRKLLEKEELKMKQEE 607

Query: 370  VNEKDHKNISKISR-IDRIQKDTKTGKIR-----IADDHKLVNKLAVSLESESKKRYEAR 531
            + ++   +IS + + + R +++   G IR     + ++ K ++ L   +++  ++R  + 
Sbjct: 608  LKKQIEMDISDLEQELSRHKEEKPDGNIRSISAPMENEEKNIDHLGTDIDNILRRRNFSL 667

Query: 532  KRQMESAVIPSGVES------FINDKNKQFNEKLSRESR 630
            + +  S + P  V S      +  +  +  NE+L+ E +
Sbjct: 668  QTRPVSRLDPGIVFSNPIETVYPVEPKRSENERLTTEKK 706

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 29.3 bits (64), Expect = 9.0
 Identities = 14/48 (29%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = +1

Query: 85  DREIQEANVNRKPRVYNMEDIND--VDESVGYTESSDKDRAFHYTAQE 222
           DR+++EA  + +   YN+E+ ++   +E V   ES D++  ++YT  +
Sbjct: 337 DRDLEEAVGSMRKHDYNLEEEDEQSENEEVEDEESEDEEEEYYYTESD 384

>TBLA0G00380 Chr7 complement(73663..75075) [1413 bp, 470 aa] {ON}
           Anc_2.45 YNL206C
          Length = 470

 Score = 29.3 bits (64), Expect = 9.1
 Identities = 23/112 (20%), Positives = 56/112 (50%), Gaps = 2/112 (1%)
 Frame = +1

Query: 283 ISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIAD 462
           ISY  + ++++  TL    T+D  +Y+  + ++     S+ ++ID   K+       +++
Sbjct: 278 ISYSSITRVTFNATL---ITKDSEKYEFSMIDQ-----SEFNKIDEYVKNKSVVDNSMSE 329

Query: 463 DHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGV--ESFINDKNKQFNEK 612
           + K  +K + +   E     EAR +  E+ +   G+  +S  +++++ FN +
Sbjct: 330 ELKAKSKKSNTSAEELSALKEARSKLAENGMTVDGINFDSDDDEEDEDFNNE 381

>AGR196W Chr7 (1122726..1124168) [1443 bp, 480 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL091W (GLR1)
          Length = 480

 Score = 29.3 bits (64), Expect = 9.2
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +1

Query: 376 EKDHKNISKISRIDRIQKDTKTGKIRIADDHKLV 477
           EK+  NI K   I R++KD  TGK+ +    K++
Sbjct: 247 EKEGVNIHKKESIQRVEKDPNTGKLTVHLSGKII 280

>SAKL0H09372g Chr8 (796939..798387) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|P41921 Saccharomyces cerevisiae
           YPL091W GLR1 Cytosolic and mitochondrial glutathione
           oxidoreductase converts oxidized glutathione to reduced
           glutathione
          Length = 482

 Score = 29.3 bits (64), Expect = 9.2
 Identities = 12/32 (37%), Positives = 23/32 (71%)
 Frame = +1

Query: 361 DNFVNEKDHKNISKISRIDRIQKDTKTGKIRI 456
           D++VNE    NI K S++++++KD  +GK+ +
Sbjct: 245 DHYVNEGI--NIHKTSKVEKVEKDENSGKLTV 274

>Suva_13.294 Chr13 (478757..480274) [1518 bp, 505 aa] {ON} YMR115W
           (REAL)
          Length = 505

 Score = 29.3 bits (64), Expect = 9.3
 Identities = 19/69 (27%), Positives = 33/69 (47%)
 Frame = +1

Query: 421 IQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDKNKQ 600
           I KD ++GK R+     L  +  +S   E K+ +E RK+++      S ++    D N  
Sbjct: 216 INKDIESGKKRLLQHLLLAQEEILSKSPELKEFFEKRKKKL------SMIKDINRDPNDD 269

Query: 601 FNEKLSRES 627
           F   +S E+
Sbjct: 270 FKTYVSEEN 278

>Skud_13.274 Chr13 (473000..474517) [1518 bp, 505 aa] {ON} YMR115W
           (REAL)
          Length = 505

 Score = 29.3 bits (64), Expect = 9.3
 Identities = 19/68 (27%), Positives = 32/68 (47%)
 Frame = +1

Query: 421 IQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDKNKQ 600
           I KD ++GK R+     L  +  +S   E K+ +E RK+++      S ++    D N  
Sbjct: 216 INKDIESGKKRLLQHLLLAQEEILSKSPELKEFFEKRKKKL------SVIKDISRDSNDD 269

Query: 601 FNEKLSRE 624
           F   +S E
Sbjct: 270 FKTFVSEE 277

>ZYRO0D06886g Chr4 (592600..594222) [1623 bp, 540 aa] {ON} similar
           to uniprot|P15565 Saccharomyces cerevisiae YDR120C TRM1
           tRNA methyltransferase localizes to both the nucleus and
           mitochondrion to produce the modified base N2
           N2-dimethylguanosine in tRNAs in both compartments
          Length = 540

 Score = 29.3 bits (64), Expect = 9.4
 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 10/74 (13%)
 Frame = +1

Query: 88  REIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEY---------IAWEQ 240
           ++++   +   P  +N+ED N V E         KD  F+   Q++          AW+Q
Sbjct: 17  QQLKNKIIGSNPNAFNLEDFNVVKEGKAEILFPKKDTVFYNPIQQFNRDLSVCCIKAWDQ 76

Query: 241 RHHQRKIGQ-SKRS 279
            + + K  + SKRS
Sbjct: 77  LYRENKHKKGSKRS 90

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
           fungal- type binuclear cluster domain DNA-binding
           transcriptional activator or CHA1 and some similarities
           to YOR337W uniprot|P47988 Saccharomyces cerevisiae
           YOR337W TEA1 Mutants are defective in Ty1
           Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 29.3 bits (64), Expect = 9.5
 Identities = 19/61 (31%), Positives = 28/61 (45%)
 Frame = +1

Query: 184 SDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYD 363
           +DK+   +  +QEY    +     KI Q   S  SY   +KL   +TL  LA  D+   +
Sbjct: 218 ADKNEELYKKSQEYYTLAKTKVLNKIFQLDGSTASYSSSSKLGIIQTLLCLAFYDIGNGE 277

Query: 364 N 366
           N
Sbjct: 278 N 278

>Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 29.3 bits (64), Expect = 9.6
 Identities = 13/65 (20%), Positives = 30/65 (46%)
 Frame = +1

Query: 283 ISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIAD 462
           +  +Q  K+S+   +  +   D  E  +  +   H +  +  RI+  +   K GK+++ +
Sbjct: 27  VKKEQEKKISFNPVVTPIRPDDYHEKTSRSSSSSHSDSPEFLRINNNKSSQKNGKLKVFE 86

Query: 463 DHKLV 477
             KL+
Sbjct: 87  SKKLI 91

>KLTH0F17908g Chr6 complement(1445723..1447320,1448299..1448566)
           [1866 bp, 621 aa] {ON} similar to uniprot|P32769
           Saccharomyces cerevisiae YKR084C
          Length = 621

 Score = 29.3 bits (64), Expect = 9.6
 Identities = 19/105 (18%), Positives = 50/105 (47%), Gaps = 6/105 (5%)
 Frame = +1

Query: 343 QDLSEYDNFVNEKDHKNISKI------SRIDRIQKDTKTGKIRIADDHKLVNKLAVSLES 504
           +D +E+D+++N+++++ +S++         D +  D  + K+ I D     ++  + L+ 
Sbjct: 22  RDEAEFDDYLNDEEYQLMSEMFPRAKKELADYVGWDNLSVKVTIFDHEFNFDEAMIELKR 81

Query: 505 ESKKRYEARKRQMESAVIPSGVESFINDKNKQFNEKLSRESRNSE 639
             KK+    K+Q  S       +  + +  K+  E + + ++  E
Sbjct: 82  SLKKKKTEAKKQAVSNFQQKSPDDVVLEAQKKAFEDVEKTTKGVE 126

>SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly
           similar to uniprot|P33420 Saccharomyces cerevisiae
           YPL174C NIP100 Large subunit of the dynactin complex
           which is involved in partitioning the mitotic spindle
           between mother and daughter cells putative ortholog of
           mammalian p150(glued)
          Length = 869

 Score = 29.3 bits (64), Expect = 10.0
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
 Frame = +1

Query: 316 EKTLRNLATQDLSE--YDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLA 489
           +K + +L +Q  +E  Y+N V+    KNI     I+ +++  +  K +   D KL  ++ 
Sbjct: 260 KKIITDLTSQLAAEGSYNNIVDMLTEKNIQLTEEIEELKQALEKTKDKQMFDEKL-ERMY 318

Query: 490 VSLESESKKRYEARKRQMES 549
             +E E     E  +R MES
Sbjct: 319 KEVEEELSNEVEDLQRAMES 338

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,177,892
Number of extensions: 1087245
Number of successful extensions: 4293
Number of sequences better than 10.0: 118
Number of HSP's gapped: 4254
Number of HSP's successfully gapped: 118
Length of query: 214
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 109
Effective length of database: 41,441,469
Effective search space: 4517120121
Effective search space used: 4517120121
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 32 (16.9 bits)