Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2253.490ON21319610221e-142
YGR129W (SYF2)3.490ON2151987441e-100
Skud_7.4403.490ON2131956782e-90
Suva_7.4173.490ON2121966662e-88
TDEL0D055803.490ON1932012629e-28
ZYRO0D10032g3.490ON2091912412e-24
NCAS0E008203.490ON2021962375e-24
Kpol_480.153.490ON2071932151e-20
SAKL0F02816g3.490ON1921932052e-19
NDAI0G009503.490ON2132011974e-18
CAGL0I10538g3.490ON2001901782e-15
KLTH0F14784g3.490ON1951961702e-14
Ecym_12393.490ON1931931677e-14
Kwal_55.212263.490ON1962011624e-13
KLLA0E04643g3.490ON2211961547e-12
AFR308W3.490ON1921951395e-10
TBLA0C044703.490ON2221911231e-07
KNAG0B008203.490ON20751964e-04
KLTH0E13200g8.568ON482108740.44
KAFR0C011303.144ON14555710.57
TPHA0D042403.490ON209198720.63
KLTH0E07480g4.97ON53394711.1
KNAG0K010103.144ON15845662.6
TPHA0M004603.144ON15445663.1
Kpol_1032.253.144ON20145663.8
CAGL0I08085g3.144ON15345636.0
NDAI0B025903.144ON16451636.7
TDEL0D047903.144ON16346628.3
NOTE: 1 genes in the same pillar as Smik_6.225 were not hit in these BLAST results
LIST: KAFR0C01950

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.225
         (213 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...   398   e-142
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...   291   e-100
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...   265   2e-90
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...   261   2e-88
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....   105   9e-28
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...    97   2e-24
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    96   5e-24
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    87   1e-20
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...    84   2e-19
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    80   4e-18
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    73   2e-15
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    70   2e-14
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    69   7e-14
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    67   4e-13
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    64   7e-12
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    58   5e-10
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    52   1e-07
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    42   4e-04
KLTH0E13200g Chr5 complement(1171972..1173420) [1449 bp, 482 aa]...    33   0.44 
KAFR0C01130 Chr3 complement(229329..229766) [438 bp, 145 aa] {ON...    32   0.57 
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    32   0.63 
KLTH0E07480g Chr5 complement(687623..689224) [1602 bp, 533 aa] {...    32   1.1  
KNAG0K01010 Chr11 (197551..198027) [477 bp, 158 aa] {ON} Anc_3.1...    30   2.6  
TPHA0M00460 Chr13 complement(87266..87730) [465 bp, 154 aa] {ON}...    30   3.1  
Kpol_1032.25 s1032 complement(53514..54119) [606 bp, 201 aa] {ON...    30   3.8  
CAGL0I08085g Chr9 (790086..790547) [462 bp, 153 aa] {ON} similar...    29   6.0  
NDAI0B02590 Chr2 complement(647421..647915) [495 bp, 164 aa] {ON...    29   6.7  
TDEL0D04790 Chr4 complement(876408..876899) [492 bp, 163 aa] {ON...    28   8.3  

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  398 bits (1022), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/196 (100%), Positives = 196/196 (100%)

Query: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77
           VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA
Sbjct: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77

Query: 78  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 137
           WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR
Sbjct: 78  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 137

Query: 138 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 197
           IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK
Sbjct: 138 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 197

Query: 198 NKQFNEKLSRESRNSE 213
           NKQFNEKLSRESRNSE
Sbjct: 198 NKQFNEKLSRESRNSE 213

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score =  291 bits (744), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 170/198 (85%), Gaps = 2/198 (1%)

Query: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77
           V+VSIK+RKLADREIQE + NRKPRVY+MED+ND DESVG TES +K++AFHYT QEY A
Sbjct: 18  VDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDA 77

Query: 78  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLA--TQDLSEYDNFVNEKDHKNISKI 135
           WE+RH Q K GQS+R GISYDQLAKLSYEKTLRNLA  TQ+ S+ D+  +E+D+KN+ K 
Sbjct: 78  WERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKK 137

Query: 136 SRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFIN 195
            RI ++QKDTKTGKI IADD KLVNKLAVSL+SESKKRYEARKRQM++A    GVESFIN
Sbjct: 138 GRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFIN 197

Query: 196 DKNKQFNEKLSRESRNSE 213
           DKNKQFNEKLSRES+ SE
Sbjct: 198 DKNKQFNEKLSRESKGSE 215

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  265 bits (678), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 134/195 (68%), Positives = 160/195 (82%)

Query: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77
           VNVSIKNRKLADREIQEA +NRKP+VY+MED+ND  E V   E+SDKD+AFHYT QEY A
Sbjct: 18  VNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYNA 77

Query: 78  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 137
           W+Q+ +QRK GQ +RSG SYDQ+AKLSYEKTLRNL TQ+ ++ +N VN+ D  +  K   
Sbjct: 78  WKQKQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNLVTQNSNKNENSVNKNDSNSSPKNGA 137

Query: 138 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 197
           I +IQ++ KTGKI I DD KLVNKLA +LESESKKRYEAR++QME+A  PS VESFINDK
Sbjct: 138 IHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFINDK 197

Query: 198 NKQFNEKLSRESRNS 212
           NKQFNEKLSRE ++S
Sbjct: 198 NKQFNEKLSREPKDS 212

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score =  261 bits (666), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 161/196 (82%), Gaps = 1/196 (0%)

Query: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77
           V+ S+K RKLADREIQEA+ NRKPRVY+MED +D DE V  T+S DKDRAFHYT QEY A
Sbjct: 18  VDASLKTRKLADREIQEASSNRKPRVYSMEDASD-DELVRETKSDDKDRAFHYTVQEYNA 76

Query: 78  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 137
           WEQ+  QRK G+++ +G SYDQLAKLSY+KTLRNL TQ+  ++++ VNEKD K     SR
Sbjct: 77  WEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKHESSVNEKDSKGSLGKSR 136

Query: 138 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 197
           I++IQK++ TGKIRI DD +LVNKLA +LES+SKKR++ARKRQME+   PSGVESFINDK
Sbjct: 137 IEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFINDK 196

Query: 198 NKQFNEKLSRESRNSE 213
           NKQFNEKL RESR SE
Sbjct: 197 NKQFNEKLGRESRGSE 212

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score =  105 bits (262), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 72/201 (35%), Positives = 122/201 (60%), Gaps = 31/201 (15%)

Query: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRA--FHYTAQEY 75
           V+V+I+ RK+A+RE ++ ++  KP++Y+MED N++       +SS++ R    +Y+ +EY
Sbjct: 18  VDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEM--GTRPVDSSERRRLKLMNYSMREY 75

Query: 76  IAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKI 135
             W+++   +++   KR G +  +LAK SYEK        DLS      +++++ N    
Sbjct: 76  EEWDKKQKGKEV---KRGGANVQELAKYSYEK--------DLSR-----SKQNNGN---- 115

Query: 136 SRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESA---VIPSGVES 192
            R+ +I  D KT ++++ DD KLVNKLA  L+  +++R+ ARK+ ME A     P G   
Sbjct: 116 -RVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGG--- 171

Query: 193 FINDKNKQFNEKLSRESRNSE 213
           +IN+KNKQFN KL R+ + +E
Sbjct: 172 YINEKNKQFNLKLDRQMKETE 192

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score = 97.4 bits (241), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 106/191 (55%), Gaps = 18/191 (9%)

Query: 20  VSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWE 79
           +S++NRKL + E +E    RKPRVY +E     + S+   +    ++  +YT Q+Y  W 
Sbjct: 30  ISVENRKLVNAESKELAAGRKPRVYQLEA---PEPSLPTQDDKHGNQLMNYTIQQYEEWN 86

Query: 80  QRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRID 139
            R   +    +KR   +   +AK +Y+K L  L       + + + +  + N   I +++
Sbjct: 87  SRQRDQT---NKRDSGNLQDMAKYTYDKELNKL-------HKDTMLQNRYTNGGSIQKMN 136

Query: 140 RIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVI--PSGVESFINDK 197
           R   + KTGK+ I DD +LV KLA  ++  + +RYEAR+R+ME + +   S    +IN+K
Sbjct: 137 R---NPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQNASSGGGYINEK 193

Query: 198 NKQFNEKLSRE 208
           NKQFNEKL R+
Sbjct: 194 NKQFNEKLDRQ 204

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 95.9 bits (237), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 107/196 (54%), Gaps = 17/196 (8%)

Query: 19  NVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDK-DRAFHYTAQEYIA 77
           + +I+NR L DRE ++   + KPRVYNM+D  D        ++ DK  +  +YT ++Y  
Sbjct: 20  DATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKLMNYTLRQYEE 79

Query: 78  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 137
           WE++   +   + K       QLA  SY+K + NL        + F  +K     +   R
Sbjct: 80  WEKKQKDK---KIKDDSSDMKQLAMFSYDKGVSNL--------NRFRTDK-----TTTER 123

Query: 138 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 197
             +IQ ++KTGK+ I D+ KLVN LA +L   + KRY   K+++++    S  E +IN++
Sbjct: 124 EVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYINER 183

Query: 198 NKQFNEKLSRESRNSE 213
           NK FNEKL RESR  E
Sbjct: 184 NKHFNEKLDRESRYGE 199

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 87.4 bits (215), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/193 (32%), Positives = 105/193 (54%), Gaps = 16/193 (8%)

Query: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77
           V++ I+NRKL D   +E   N KP+ Y+ME++ + D++V      + DR  +Y+ +EY  
Sbjct: 20  VDILIENRKLLDANTRELKKNSKPKTYSMEELAE-DDTVNTGTVDEADRLLNYSIREYEE 78

Query: 78  WEQRH--HQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKI 135
           WE++   H+  +  +K S  S  Q+AK +Y          D         +  + N  KI
Sbjct: 79  WEKKQGRHKENVHVTKSSVNSTAQIAKFTY----------DKQIKKLQKQKSTNDNRGKI 128

Query: 136 SRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFIN 195
           S+I   +KD KTGKI + D  +L+ +LA  L   +K+RY+   ++ +     +   S+IN
Sbjct: 129 SKI---RKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENYSYIN 185

Query: 196 DKNKQFNEKLSRE 208
           +KNK+FN+KL R+
Sbjct: 186 EKNKEFNDKLERQ 198

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score = 83.6 bits (205), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 107/193 (55%), Gaps = 27/193 (13%)

Query: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSD-KDRAFHYTAQEYI 76
           V+VS+KNRK A++E ++A  + KP+VY+M +    DE+    +  D + +  +Y+ ++Y 
Sbjct: 18  VDVSVKNRKEAEKEEKQAKQSGKPKVYSMNE----DETFKDQKEEDTRGKLLNYSIKDYE 73

Query: 77  AWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHK-NISKI 135
            W Q     K+  S   G S   LAK +Y+K +R +             EKD   N  K+
Sbjct: 74  KW-QLKRTAKLKNS--DGSSQQDLAKYTYDKEIREM-------------EKDGSLNRGKV 117

Query: 136 SRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFIN 195
           ++  R+      G+I+I DD K + +LA +L   +K+RY  RK+Q E  +  S    FIN
Sbjct: 118 TKA-RL---NGKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEK-LDSSTTGGFIN 172

Query: 196 DKNKQFNEKLSRE 208
           DKNKQFNEKLSR+
Sbjct: 173 DKNKQFNEKLSRQ 185

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 80.5 bits (197), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 66/201 (32%), Positives = 112/201 (55%), Gaps = 27/201 (13%)

Query: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVD------ESVGYTESSDKDRAF--- 68
           +++  +NRK AD+E++E + + KP+VY+++ + D D      + +G   + ++ R F   
Sbjct: 21  LDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEEEKRKFKLM 80

Query: 69  HYTAQEYIAWEQRHHQRKIGQSKR-SGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEK 127
           +YT +EY  W++   Q+K  Q KR  G    +LA  +YEK L  L     S+ +N  +E+
Sbjct: 81  NYTIREYEEWDK---QQKDKQRKRVDGSDLTELATFTYEKELSKLN----SKLENISHEQ 133

Query: 128 DHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIP 187
            H          +I  +T+ GK+ + D+ +L+N L  +L   +KKRY  RK++++S    
Sbjct: 134 KH----------QIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASS 183

Query: 188 SGVESFINDKNKQFNEKLSRE 208
               ++  DKNKQFNEKL RE
Sbjct: 184 DIAGNYFKDKNKQFNEKLERE 204

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 73.2 bits (178), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 105/190 (55%), Gaps = 19/190 (10%)

Query: 19  NVSIKNRKLADREIQEANVNRKPRVYNM-EDINDVDESVGYTESSD-KDRAFHYTAQEYI 76
           ++ I+NR L  +E +E     KPRVY+M +D +D DE     E SD +   F YT Q++I
Sbjct: 19  DIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSDEQSDMRTNLFQYTVQDFI 78

Query: 77  AWE-QRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKI 135
            WE ++  ++K     +SG+    LAK +Y+K L+NL   +             K  +K 
Sbjct: 79  DWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF------------KMKAKE 126

Query: 136 SRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFIN 195
           ++  RI KD  +GK+ I D+ +LV +L+ +L+  +K+RY++  R++ +    + +   IN
Sbjct: 127 TQF-RINKD--SGKVNIKDNKELVQRLSQNLKETAKQRYDSN-RKIANDKEHTSLSGSIN 182

Query: 196 DKNKQFNEKL 205
            KN QFN+ L
Sbjct: 183 AKNLQFNKSL 192

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 70.1 bits (170), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 101/196 (51%), Gaps = 20/196 (10%)

Query: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77
           V++S+KN++   +E ++ +   KP VY+M+   +   S   TE S + +   Y+ +++  
Sbjct: 18  VSLSVKNKQQILQEEKQTSARAKPAVYSMK--TEEAPSSETTEESKEAKLLQYSMKDFEQ 75

Query: 78  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 137
           W+ +  +R+  Q       Y  LAK +Y+K ++ L         N+ N        K+ +
Sbjct: 76  WQDK--ERRKSQKSSDVAKYQDLAKFTYDKEVQQLRK-------NYTN--------KVEK 118

Query: 138 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDK 197
             ++  + K GKI + DD  LV  LA SL   + +RY   ++++   ++      FIN+K
Sbjct: 119 PKKVSINKK-GKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEK 177

Query: 198 NKQFNEKLSRESRNSE 213
           NKQFN+K+ R+++  E
Sbjct: 178 NKQFNDKIERQTKKRE 193

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 68.9 bits (167), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 104/193 (53%), Gaps = 25/193 (12%)

Query: 18  VNVSIKNRK-LADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYI 76
           V++SIKNRK +   E+ +   + KP VY++ D       V  T ++++ +  +Y+  +Y 
Sbjct: 18  VDISIKNRKEIVSEEVLQVGRS-KPEVYSINDEGAAVNEVQSTSNTERRKLLNYSLIDYE 76

Query: 77  AWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKIS 136
            W+++  Q     +    I+Y      +Y+  ++ L    L++              KI+
Sbjct: 77  KWDEKEKQANFDGTYSGDIAYS-----TYKNEIKQLRKGGLTK-------------GKIT 118

Query: 137 RIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMES-AVIPSGVESFIN 195
           +  RI   +++GK+ I D+ +LVNKLA +LE  S++R+   K++++      S + +F+N
Sbjct: 119 K-GRI---SESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVN 174

Query: 196 DKNKQFNEKLSRE 208
           +KN+ FNEKLSR+
Sbjct: 175 EKNRHFNEKLSRQ 187

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 67.0 bits (162), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 101/201 (50%), Gaps = 30/201 (14%)

Query: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77
           +++S+KN+    RE +  + +RKP VY+M +    +E +   + ++ ++   Y+  EY  
Sbjct: 18  IDLSVKNKNEVIREEKMVSASRKPAVYSM-NAEGAEEEIA-KDVTEANKLLKYSMLEYEQ 75

Query: 78  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 137
           W+ +   +K       G S+  LAK +Y+K +     Q LS+ D                
Sbjct: 76  WQDKV--KKNSHRLEGGASFQDLAKSTYDKEV-----QQLSKIDG--------------- 113

Query: 138 IDRIQKDTK-----TGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVES 192
            +R+ K+TK      GKI + DD +LV  L  +L   + +RY   ++++   +  +    
Sbjct: 114 -NRVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGG 172

Query: 193 FINDKNKQFNEKLSRESRNSE 213
           +IN+KNKQFN+KL R+++  E
Sbjct: 173 YINEKNKQFNDKLERQTKKRE 193

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 63.9 bits (154), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 95/196 (48%), Gaps = 35/196 (17%)

Query: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77
           V VSI+N+K     I E   N + RVY+M D  +       +E  D  +  +Y+ +EY  
Sbjct: 54  VEVSIRNKKAI---IAEEKKNSERRVYSMADDGEDKARSNKSEPEDPIKLANYSIREYEK 110

Query: 78  WE-----QRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNI 132
           WE      RH++  +G        +  +AK SY+K +  L  +D+S          H   
Sbjct: 111 WEAKTQNSRHNKSVMG-------DFQTIAKNSYKKEVDALP-KDIS----------HPLK 152

Query: 133 SKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVES 192
             I         T+ GK+++ D+ +LV K+   L   SKKRY  RK++++     +  + 
Sbjct: 153 GGI---------TEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDG 203

Query: 193 FINDKNKQFNEKLSRE 208
           FINDKNK+FN KL+ E
Sbjct: 204 FINDKNKRFNAKLNSE 219

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 58.2 bits (139), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 93/195 (47%), Gaps = 26/195 (13%)

Query: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIA 77
           V+ SI+NRK A  E +      KPRVY+M +    +     T+S ++ +  +Y   +Y  
Sbjct: 18  VDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQS-EQLKLLNYRIADYEK 76

Query: 78  WEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 137
           W+++  + K       G    +LA  +Y   L  L  + +            K  +   R
Sbjct: 77  WDEKQKRHK---QPSDGADLGELANSTYRSELHQLHRRGVV-----------KGRATNGR 122

Query: 138 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSG--VESFIN 195
           I      + +GK+ + D+ +LV KLA +++  +K+R+E R+++   A    G      +N
Sbjct: 123 I------SASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKK---AAKDGGRATAGSLN 173

Query: 196 DKNKQFNEKLSRESR 210
           DKN+ FNEKL RE R
Sbjct: 174 DKNRHFNEKLDREFR 188

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 92/191 (48%), Gaps = 36/191 (18%)

Query: 37  VNRKPRVYNMED--------INDVDESVGYTESSDKDRAFHYTAQEYIAWEQRHHQRKI- 87
            N KP+VY+M D        IND +    ++E     +  +YT +EY  WE + ++    
Sbjct: 38  TNNKPKVYSMTDEFDKDELPINDENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTE 97

Query: 88  --GQSKRSGI-SYDQLAKLSYEKTLRNL-ATQDLSEYDNFVNE-----KDHKNISKISRI 138
               SK   I S D LAK +Y+K +R L      +   N  N+     K+H+N       
Sbjct: 98  SQTNSKDDQIESLDSLAKRTYDKDIRKLNKALRATNSGNKSNKPGKIIKNHRN------- 150

Query: 139 DRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYE-ARKRQMESAVIPSGVESFINDK 197
                  ++ KI I DD  LV +L  +L+++S + Y+   +R+   +   SG    +N K
Sbjct: 151 -------ESNKIVIKDDKFLVEELVNNLKTKSDRLYKHLGERRKNYSTTLSG---HVNTK 200

Query: 198 NKQFNEKLSRE 208
           N++FNEKL+RE
Sbjct: 201 NQEFNEKLTRE 211

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 159 VNKLAVSLESESKKRYEARKRQM--ESAVIPSGVESFINDKNKQFNEKLSR 207
           V +L   L   SKKRY  RK +M  + A   S ++ +IN+KNKQFN+KL R
Sbjct: 152 VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202

>KLTH0E13200g Chr5 complement(1171972..1173420) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|P41921 Saccharomyces
           cerevisiae YPL091W GLR1 Cytosolic and mitochondrial
           glutathione oxidoreductase converts oxidized glutathione
           to reduced glutathione
          Length = 482

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 46/108 (42%), Gaps = 18/108 (16%)

Query: 57  GYTESSDKDRAFHYTAQE---------YIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEK 107
           GY    D D  F  T Q          YI  E       +G      I  + L +  +++
Sbjct: 179 GYEHGIDSDDFFKLTEQPKKVVVSGAGYIGVELAGVFHGLGSETHMVIRGETLLR-KFDE 237

Query: 108 TLRNLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADD 155
            ++N  T      D++VNE    NI K ++ID++ KD  TGK+ +  D
Sbjct: 238 CIQNTIT------DHYVNEG--INIHKTAKIDKVHKDEGTGKLSVHLD 277

>KAFR0C01130 Chr3 complement(229329..229766) [438 bp, 145 aa] {ON}
           Anc_3.144 YOL071W
          Length = 145

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 85  RKIGQSKRSGI-SYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISRI 138
           R I QS++ GI   D L      K L+N+    L EYD F+NE D      I++I
Sbjct: 53  RLIYQSRKRGILETDLLLSGFAAKNLKNMGMDQLKEYDAFLNELDWDIYYWITQI 107

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 87/198 (43%), Gaps = 26/198 (13%)

Query: 22  IKNRKLADREIQEANVNRKPRVY--NMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWE 79
           I++RK  + + +E     KP+VY  NM+D  D D       ++ +     YT ++Y  WE
Sbjct: 22  IEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDLLTNNSERALLTYTIRDYEEWE 81

Query: 80  Q--RHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHKNISKISR 137
           +  +   + +  +  S  S  Q AK +Y+K +  +  +       F  +++      I+R
Sbjct: 82  ESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMKKRQ----GKFATDEE------ITR 131

Query: 138 IDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAV----------IP 187
              +++    GK+ I DD  LVN     +   S  RY   KR   +AV            
Sbjct: 132 GSAMKEVLDDGKLLIKDDKHLVNGFISDINKVSNDRY--IKRMKLNAVNNDATGSKVSHD 189

Query: 188 SGVESFINDKNKQFNEKL 205
            G  S+ N KNK FN+KL
Sbjct: 190 KGKTSYNNAKNKDFNDKL 207

>KLTH0E07480g Chr5 complement(687623..689224) [1602 bp, 533 aa] {ON}
           weakly similar to uniprot|P53191 Saccharomyces
           cerevisiae YGL023C
          Length = 533

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 36/94 (38%), Gaps = 9/94 (9%)

Query: 61  SSDKDRAFHYTAQEYIAWEQRHHQRKIG-----QSKRSGISYDQLAKL----SYEKTLRN 111
           S  K  A HY  + +  WE++HH R  G     Q  R  +  D+ A+     +    L  
Sbjct: 399 SDSKRHACHYCHKIFTFWERKHHCRHCGDIFCSQHVRHWLYLDKDARFVIGGAGVGALSK 458

Query: 112 LATQDLSEYDNFVNEKDHKNISKISRIDRIQKDT 145
           +    L EYD  V E    + +     +   K T
Sbjct: 459 ICDGCLQEYDKLVREGPSSSAANAQTTNETPKST 492

>KNAG0K01010 Chr11 (197551..198027) [477 bp, 158 aa] {ON} Anc_3.144
           YOL071W
          Length = 158

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 85  RKIGQSKRSGISYDQLAKLSYE-KTLRNLATQDLSEYDNFVNEKD 128
           R I QS++ GI    L   S+  K L+N++ + L EYD  +NE D
Sbjct: 65  RLIYQSRKRGILETDLLLSSFAAKNLKNMSKEQLEEYDELLNELD 109

>TPHA0M00460 Chr13 complement(87266..87730) [465 bp, 154 aa] {ON}
           Anc_3.144 YOL071W
          Length = 154

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 85  RKIGQSKRSGI-SYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKD 128
           R I QS++ GI   D L      K L+ +  Q L EYD+ +NE D
Sbjct: 61  RLIYQSRKRGILETDLLLSRFAAKYLKTMTPQQLDEYDSLLNELD 105

>Kpol_1032.25 s1032 complement(53514..54119) [606 bp, 201 aa] {ON}
           complement(53514..54119) [606 nt, 202 aa]
          Length = 201

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 85  RKIGQSKRSGI-SYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKD 128
           R I QS++ GI   D L      K L+ +  ++L EYDN +NE D
Sbjct: 107 RLIYQSRKRGILETDLLLSGFAAKYLKEMTPEELDEYDNLLNELD 151

>CAGL0I08085g Chr9 (790086..790547) [462 bp, 153 aa] {ON} similar to
           uniprot|Q08230 Saccharomyces cerevisiae YOL071w
          Length = 153

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 85  RKIGQSKRSGI-SYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKD 128
           R I QS++ GI   D L      K LR++  ++L EYD  +NE D
Sbjct: 60  RLIYQSRKRGILETDLLLSGFAAKHLRSMTNEELDEYDALLNELD 104

>NDAI0B02590 Chr2 complement(647421..647915) [495 bp, 164 aa] {ON}
           Anc_3.144 YOL071W
          Length = 164

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 80  QRHHQRKIGQSKRSGI-SYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDH 129
           +R   R I QS++ GI   D L      K L+++   +L EYD  +NE D 
Sbjct: 66  ERTRSRLIYQSRKRGILETDLLLSAFAAKYLKDMDVVELKEYDELLNELDW 116

>TDEL0D04790 Chr4 complement(876408..876899) [492 bp, 163 aa] {ON}
           Anc_3.144 YOL071W
          Length = 163

 Score = 28.5 bits (62), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 85  RKIGQSKRSGI-SYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDH 129
           R I QS++ GI   D L      K L++++ ++L EYD+ +NE D 
Sbjct: 66  RLIYQSRKRGILETDLLLSRFAAKYLKDMSLKELEEYDSLLNELDW 111

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,787,098
Number of extensions: 879292
Number of successful extensions: 4238
Number of sequences better than 10.0: 170
Number of HSP's gapped: 4195
Number of HSP's successfully gapped: 172
Length of query: 213
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 108
Effective length of database: 41,441,469
Effective search space: 4475678652
Effective search space used: 4475678652
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 63 (28.9 bits)