Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2243.489ON70570534410.0
Skud_7.4393.489ON71371328380.0
YGR128C (UTP8)3.489ON71371327890.0
Suva_7.4163.489ON71371327770.0
NCAS0E008303.489ON67171515260.0
TDEL0D055703.489ON64971014830.0
Kpol_480.163.489ON65570714630.0
ZYRO0D10054g3.489ON66471014550.0
SAKL0F02838g3.489ON65470813960.0
NDAI0G009603.489ON70075313960.0
TPHA0D042303.489ON65270913760.0
TBLA0C044603.489ON69873513671e-180
CAGL0I10560g3.489ON67871813441e-177
KLTH0F14762g3.489ON65070913021e-171
KLLA0E04665g3.489ON64770812431e-162
AFR307C3.489ON65071012421e-162
Kwal_55.212223.489ON3733976902e-83
KAFR0C019403.489ON6095766289e-72
KNAG0B008303.489ON6076495622e-62
Kwal_55.21225singletonOFF2152404226e-47
ZYRO0E08074g6.271ON59236820.33
TPHA0E017505.436ON459102790.57
NDAI0J024104.275ON94948724.9
TPHA0B016804.333ON56738725.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.224
         (705 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...  1330   0.0  
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...  1097   0.0  
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...  1078   0.0  
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...  1074   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   592   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   575   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   568   0.0  
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   565   0.0  
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   542   0.0  
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   542   0.0  
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   534   0.0  
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   531   e-180
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   522   e-177
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   506   e-171
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   483   e-162
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   483   e-162
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   270   2e-83
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   246   9e-72
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   221   2e-62
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   167   6e-47
ZYRO0E08074g Chr5 complement(633136..634914) [1779 bp, 592 aa] {...    36   0.33 
TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436     35   0.57 
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    32   4.9  
TPHA0B01680 Chr2 (375904..377607) [1704 bp, 567 aa] {ON} Anc_4.3...    32   5.4  

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score = 1330 bits (3441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/705 (94%), Positives = 666/705 (94%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120
           PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120

Query: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180
           LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII
Sbjct: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180

Query: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKVCYKLLEL 240
           AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKVCYKLLEL
Sbjct: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKVCYKLLEL 240

Query: 241 TDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIEL 300
           TDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIEL
Sbjct: 241 TDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIEL 300

Query: 301 PLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAV 360
           PLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAV
Sbjct: 301 PLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAV 360

Query: 361 INSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVILK 420
           INSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVILK
Sbjct: 361 INSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVILK 420

Query: 421 PLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKEE 480
           PLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKEE
Sbjct: 421 PLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKEE 480

Query: 481 HYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNLLSLLRDQP 540
           HYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPK             DRTRNLLSLLRDQP
Sbjct: 481 HYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNLLSLLRDQP 540

Query: 541 RLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDIQ 600
           RLFKQAIVTC            FSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDIQ
Sbjct: 541 RLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDIQ 600

Query: 601 NFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYIDKQVKI 660
           NFIEFMTSTENDNSLEGFNH              DSIGLFSLEGALLESLTSYIDKQVKI
Sbjct: 601 NFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYIDKQVKI 660

Query: 661 AERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705
           AERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI
Sbjct: 661 AERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score = 1097 bits (2838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/713 (76%), Positives = 605/713 (84%), Gaps = 8/713 (1%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPSLSQPFRLA LPKIASLSNFSLQA+YVQVADGTFNESTNNITLGISGSS+SQYIINPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIE--------DKDNNEKVINSQTKRNIEIWSFGL 112
           PKL FDYPIPSTN+ITAC+A E QVN+E        D ++ EK  NSQTKRNIEIWSFG 
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 113 MVNKGNYTLNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKI 172
           MVNKGNYTLNV TK+LE+  N ++E+LVE+ I++  + G++  LSQ+KIK KAKVM+IKI
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180

Query: 173 DTKNNLIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDK 232
           D KN+LIIA+LQNGLIEFYD KLKLL+SFDISYDNLKYAKWFTENG +F+FVLCPL+DDK
Sbjct: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240

Query: 233 VCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHC 292
           VCYK+LEL+D+E+++NSPIKELSSTIIEGFSF+ SKLCYQFGKLYKLN+GKIYVYSLPHC
Sbjct: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300

Query: 293 QLQQVIELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKT 352
           QLQQ+IELPLIN S+ E DLISFQPVSVNR+LLTVNNI+YLLDLLHCS L  REL+HVKT
Sbjct: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360

Query: 353 FQLLNTAVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEK 412
           FQLL +A+I+SEKSH+SKTIAIGISTKNG NPTSSLEIINIDVGTNTLKDSLGKSFQ  K
Sbjct: 361 FQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGK 420

Query: 413 KDSSVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFF 472
            D+SVILKPLFDDE+VT NMVKRN+IDG+I++P F YDE+I KLS LK+NDI SFD+IFF
Sbjct: 421 NDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIFF 480

Query: 473 KDLKIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNL 532
            DLK+KEEHYTEKDRFISD  FLNKVLDLIF KF GNDYPK             +RT  L
Sbjct: 481 NDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKALTFLLTHPLFPLNRTHGL 540

Query: 533 LSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMK 592
           LSLLRDQPRLFKQAIVTC            FSIRN+ELLLDISFR+LQDFTRDSIKQEMK
Sbjct: 541 LSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQEMK 600

Query: 593 RLSKLDIQNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTS 652
           +LSKLDIQNFIE +T+TE D  LEGFNH              DSIGLFSLEGALLE+LT 
Sbjct: 601 KLSKLDIQNFIECITNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLENLTL 660

Query: 653 YIDKQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705
           YIDKQVKIAERNTELWNLIDIK SQHGF  L+  S +SQKQALP Y MEYLDI
Sbjct: 661 YIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score = 1078 bits (2789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/713 (75%), Positives = 599/713 (84%), Gaps = 8/713 (1%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPSLSQPFRLA LPKIASLSNFSLQA+YVQVADGTFNESTNNITLGISGSS+SQYIINPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIE--------DKDNNEKVINSQTKRNIEIWSFGL 112
           PKL FDYPIPSTNIITACNA + Q NI+        D+ NNEK IN+Q KRN+EIW+FGL
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 113 MVNKGNYTLNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKI 172
           MVNKGNYTLNVITK LE+T + ++++L E+ I+N  YTGS+  LSQYKIKAKAKVMSIKI
Sbjct: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180

Query: 173 DTKNNLIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDK 232
           DTKN+L+IAILQNGLIE +DFKL LLHSFDISYDNLKYAKWFTENG E++FVLCPLQDDK
Sbjct: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240

Query: 233 VCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHC 292
           VCYKLLELTD  + E+SPIKELSSTIIEGFSF++SKLCYQFGKLYKLN+GKIY+YSLPHC
Sbjct: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300

Query: 293 QLQQVIELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKT 352
           QLQQVIE P+++      DLISFQPVSVNRVLLTVNN++YLLDLLHCSTL QREL+HVKT
Sbjct: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360

Query: 353 FQLLNTAVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEK 412
           FQLL +AVINSEKSH+SKTIAIGISTKNG NPTSSLEIINIDVGTNTLKDSLGKSFQ   
Sbjct: 361 FQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGN 420

Query: 413 KDSSVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFF 472
            DSSVILKPLFDD+++ +  VK N++ GD S+P    +E+I KLSAL+ NDITSFDDIFF
Sbjct: 421 NDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFF 480

Query: 473 KDLKIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNL 532
           K+LKIKEEHYTEKDR+ISD  FLNKVLDLIF KF+GNDYPK              RTRNL
Sbjct: 481 KELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTRNL 540

Query: 533 LSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMK 592
           LSLLRDQPRLFKQAIVTC            FSIRN+ELLLDISFRILQDFTRDSIKQEMK
Sbjct: 541 LSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEMK 600

Query: 593 RLSKLDIQNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTS 652
           +LSKLD+QNFIEF+TS   D+S E FN               DSIGLFSLEGALLE+LT 
Sbjct: 601 KLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLTL 660

Query: 653 YIDKQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705
           YIDKQV+IAERNTELWNLID K  QHGF +  F++ +SQK+ALPTYTMEYLDI
Sbjct: 661 YIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score = 1074 bits (2777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/713 (74%), Positives = 601/713 (84%), Gaps = 8/713 (1%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPSLSQPFRLA LPKIASLSNFSLQA+YVQVADG FNE TNNITLGISGSS+SQYIINPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNN-------EKVINSQTKRNIEIWSFGLM 113
           PKL FDYPIPSTNIITACNA + QV IE+   N        +V N Q+KR++EIWSFGLM
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVTNFQSKRDVEIWSFGLM 120

Query: 114 VNKGNYTLNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKID 173
           VNKGNYTLNVITK +E+  + ++++L EN  +   Y G++ +LSQYKIK K KVM+IKID
Sbjct: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180

Query: 174 TKNNLIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKV 233
            KN+L+IA+LQNGL+EFYDFKLKLLHS+DISY NLKYAKWFTENG EF+FVLCPL+DDKV
Sbjct: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDKV 240

Query: 234 CYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQ 293
           CYKL EL+D+E +E+SPIKELSSTIIEGFSF+ SK CYQFGKLYKLN+GKI+VYSLPHCQ
Sbjct: 241 CYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQ 300

Query: 294 LQQVIELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTF 353
           LQQ+I++PLIN    E+DLISFQPVSVNR+LLTVNN +YLLDLLHCS L QREL+HV+TF
Sbjct: 301 LQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTF 360

Query: 354 QLLNTAVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKK 413
           QLL +AVI+SEKS +SKTIAIGISTKNG NPTSSLEIINIDVGTNTLKDSLGKSFQ  K 
Sbjct: 361 QLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGKN 420

Query: 414 D-SSVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFF 472
           D SSV+LKPLFDDE V +NMVKRN+IDG+IS+PTFQYDEII K+SALK+ND+ SFDDIFF
Sbjct: 421 DTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIFF 480

Query: 473 KDLKIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNL 532
           KDLK+KEEHYTEKDRFISD  FLN+VLDLIFEKFNGNDYPK             +RT NL
Sbjct: 481 KDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPLNRTHNL 540

Query: 533 LSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMK 592
           LS LRDQPRLFKQAIVTC            FSIRNKELLLDISFRILQDFTRDSIKQEMK
Sbjct: 541 LSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMK 600

Query: 593 RLSKLDIQNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTS 652
            LSKLDIQNFI+F+T+T+ D++LE  NH              DSIGLFSLEGALL++L S
Sbjct: 601 NLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNLAS 660

Query: 653 YIDKQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705
           YIDKQV+IAERNTELWNL++ K SQHGFTN+  +S +SQKQALPTYTMEYL+I
Sbjct: 661 YIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/715 (47%), Positives = 469/715 (65%), Gaps = 54/715 (7%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPSLSQPFRL  LPKIASLSNF+LQ++Y+QV D TF+ +TN IT+GISGSSVSQYI+NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120
           PKLIF++PIPSTNI+TACN  E + + E                 E W F  M NK + T
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSE-----------------ETWCFATMANKTS-T 102

Query: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180
           LN+I K    T  N +E+        +       + S++KIKA   V+ IKI  K  +I+
Sbjct: 103 LNLINKNQYQT--NEEES-------GDSAPSDSSVTSEFKIKADDHVVDIKILNKKKIIV 153

Query: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKVCYKLLEL 240
            +L+NG I+ YDF+LKLL+S +++Y+N+++ + F E+G +F+FVLC L++DKVC KL ++
Sbjct: 154 -VLKNGKIQTYDFELKLLNSINMAYNNVRFVEHFHEDGKDFMFVLCDLENDKVCLKLFQI 212

Query: 241 TDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIEL 300
            +     N    EL+STI+E F  +++K CYQFGK YKL   KI VYSLP  Q Q  I L
Sbjct: 213 NENIETINDSAIELTSTILENFPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITL 272

Query: 301 PLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAV 360
           P+I +      ++SF+P+S NR+LLTVNN +YLLDL+H S L +REL+H+KTFQLL TAV
Sbjct: 273 PMITDLKEGERVVSFKPISPNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAV 332

Query: 361 INSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSV-IL 419
           +++  +  ++T+AIG+STK G+NPTSSLE++N+DVGT+T+KDSLGKSFQ    +++V  L
Sbjct: 333 VDTNINQ-NRTLAIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSL 391

Query: 420 KPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKE 479
           K LFDDE    +  K+        +  F Y++I  +L   K ND+T FDDIFFK   IK+
Sbjct: 392 KSLFDDENDYSDKKKQ--------VKNFNYEKIYKELVDSK-NDVTKFDDIFFKSFDIKK 442

Query: 480 EHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNLLSLLRDQ 539
           E+YTEKDRFI +  FL +++DLIFE F   +YPK             +RT+ LL+ L + 
Sbjct: 443 EYYTEKDRFIYNHEFLVQIIDLIFETF-KEEYPKTFTYLLTDPLFPLERTKGLLARLNNH 501

Query: 540 PRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDI 599
           PRLFKQAIVTC            F+I N EL LDIS RILQD+TRDSIK+E+K+L K+++
Sbjct: 502 PRLFKQAIVTCPNLPLNELLAELFTISNGELSLDISLRILQDYTRDSIKKELKKLPKIEV 561

Query: 600 QNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYIDKQVK 659
           +NFIEF+   E+D      +               DSIGLF+L+ A+LE L+ YID+QV 
Sbjct: 562 ENFIEFIIDEESDIK----DTTNAPHLFQLLSLVVDSIGLFALDNAVLERLSKYIDEQVA 617

Query: 660 IAERNTELWNLIDIKSSQHGFTNLAFESASS---------QKQALPTYTMEYLDI 705
           IA+ NTELW+L+D  S+   + N  F +++S         Q++ LP Y++EYLD+
Sbjct: 618 IAQSNTELWHLLDY-SNVLAYKNDKFVTSTSKDSNTSLKLQEEVLPKYSVEYLDL 671

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/710 (45%), Positives = 439/710 (61%), Gaps = 66/710 (9%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPSLSQ F+LA LP++ASLSNF+ Q N++QVAD     ++N IT+GIS S++SQY++NPT
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNPT 59

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120
           PKL+   PIPSTNI+TAC+   +         +E+          EIW + L   K   T
Sbjct: 60  PKLVLSIPIPSTNIVTACDVARS---------DEQ----------EIWCYALQAGKV-CT 99

Query: 121 LNVITKV--LENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNL 178
           LNV +KV   EN +N+ D                       K+K   + + + ++ K+  
Sbjct: 100 LNVASKVSHAENGVNSDDV---------------------LKVKVDDQAVGVHVNGKDKT 138

Query: 179 IIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKVCYKLL 238
           I+ +L+NGLI+FYDF+LKLLHS D+SY ++   K+FTE   +F+F+LC L +DKVC+KL 
Sbjct: 139 IVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGANDFLFILCSLPEDKVCFKLF 198

Query: 239 ELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVI 298
           EL+   N    PIKELSS I+E FS   SK+CYQ G+LY+L   ++ VY+LP CQL Q +
Sbjct: 199 ELS-LPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIGHEVLVYALPQCQLVQAV 257

Query: 299 ELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNT 358
            LP++  +D    +IS +P+S NR+L+T +N +YLL+L H S L QREL+H+K+FQLL +
Sbjct: 258 TLPMVQGAD----VISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKSFQLLKS 313

Query: 359 AVINSEKSHS---SKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDS 415
           AVI+S  S S    KT  IG+ TK+G NPTSSLEI+N+DVGT TLKDSLGK F    +  
Sbjct: 314 AVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFTVSNEPI 373

Query: 416 SVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDL 475
           S +LKPLF DE+                   F +++I   L   K + I+SFD IF ++L
Sbjct: 374 SQVLKPLFSDEDNEAEDEDNK-------FEHFDFNQIYQHLEKNKQS-ISSFDRIFLREL 425

Query: 476 KIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNLLSL 535
            IK EHYTE DRFI D  FL+ V+ LI + F   +YPK             D T  LLS 
Sbjct: 426 NIKREHYTELDRFICDRQFLSNVVHLILQNFQ-EEYPKALTFLLTHPLFPVDCTPKLLSR 484

Query: 536 LRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLS 595
           LR+ PRLFKQAIVTC            FSI N EL LDIS RILQD+T D IKQE+++L+
Sbjct: 485 LREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEVRKLN 544

Query: 596 KLDIQNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYID 655
           K+D+QNFIEF+ S+ ++N++   +               DSIGLF+L+G LL+ L  YI 
Sbjct: 545 KIDVQNFIEFVISSNDENAIRSSHQ-----LFQLLSLVLDSIGLFALDGVLLDRLADYIQ 599

Query: 656 KQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705
           ++V IAERN++L +L+D K +  GF      S  S ++A+P YT+EYLD+
Sbjct: 600 ERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/707 (46%), Positives = 448/707 (63%), Gaps = 54/707 (7%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPS SQPFRLA LPKI SLSN   Q + +Q+AD  F+  +N IT+GISGS++SQYIINPT
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADD-FSLESNKITIGISGSTISQYIINPT 59

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120
           P L+F+ PIPSTN +TACN G     + D D ++          +E W++GL  NK N+T
Sbjct: 60  PSLVFNVPIPSTNNVTACNIGHF---VSDTDGSK----------LECWAYGLSYNK-NHT 105

Query: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEG-LLSQYKIKAKAKVMSIKIDTKNNLI 179
           LN+       +I  +D++          Y  S G ++  Y  K   K+  IKI+ K  +I
Sbjct: 106 LNI-------SIKTSDDD---------KYATSGGEVVETYSQKCDDKIEHIKINEKEKVI 149

Query: 180 IAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKVCYKLLE 239
           + +L+NGLI+FYDF LKLL S ++ Y ++ + + F E+G +F  +L  ++  K+ +KL E
Sbjct: 150 VVVLKNGLIQFYDFTLKLLKSVNVMYSDISFVEHFEEDGKQFAIILSNIEGKKISFKLYE 209

Query: 240 LTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIE 299
           L  + N + S I ELSSTI+E     +S++CYQFGK+Y+L + ++Y+Y+LP CQLQQ IE
Sbjct: 210 L--FTNDKTS-INELSSTILEDADLGESQICYQFGKIYRLFEDRLYIYNLPQCQLQQTIE 266

Query: 300 LPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTA 359
           LP I   D   D++SF P++ NR+LLTVNN +YLLDL+H S L +R+LSHVK +QLL + 
Sbjct: 267 LPFIQKKD--SDVLSFSPIANNRILLTVNNKIYLLDLVHNSILAERDLSHVKVYQLLKSI 324

Query: 360 VINSE-KSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVI 418
           V+ S+ ++ +SKTIAIG+S KNG +P SSLE+IN+DVG+ TLKDSLGKSFQ      ++ 
Sbjct: 325 VVPSKGENKNSKTIAIGVSIKNGPSPISSLEVINVDVGSGTLKDSLGKSFQVANVKKNIP 384

Query: 419 LKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIK 478
           L+ LF ++E          I       +F Y  I+ +L   K NDI  FDDIFFK L I 
Sbjct: 385 LQSLFPEDET---------IYAKGEQKSFDYKNILQELQNNK-NDINKFDDIFFKKLNIM 434

Query: 479 EEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNLLSLLRD 538
           +E+YTE+DRFI D  FL+ VLDLIF  F   DYP+               TRNLL+  R+
Sbjct: 435 KEYYTEQDRFIYDQKFLSDVLDLIFSAFK-KDYPRALTFLLTHPLFPISHTRNLLTKFRN 493

Query: 539 QPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLD 598
           QPRLFKQA+VTC            F+I N EL LDIS RILQD+TRDSIKQE+K LSK+D
Sbjct: 494 QPRLFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRILQDYTRDSIKQELKTLSKVD 553

Query: 599 IQNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYIDKQV 658
           IQNFIEF+  T++++  + FN               D+ GLF+LE   LE L++YID QV
Sbjct: 554 IQNFIEFVIDTDSEDKSQ-FN----PQLFQLLSLVLDASGLFALEEETLEKLSAYIDNQV 608

Query: 659 KIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705
            +AERN  LW+L+D  S +    N A +    Q ++L  Y++EYL++
Sbjct: 609 NVAERNNRLWHLLDENSDKRSTLNQANDQNVLQTKSLSAYSVEYLEL 655

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/710 (43%), Positives = 445/710 (62%), Gaps = 51/710 (7%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPS+ QPFRL+ LP+I +LSN+ +Q++Y++V+    + ++N IT+GIS S++SQYI+NPT
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVS-SDISPNSNKITIGISESAISQYILNPT 59

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120
           PKL+ +  IPSTN+++AC+        +DK               EIW + +   K ++ 
Sbjct: 60  PKLLSNISIPSTNVVSACDVATLA---DDK---------------EIWCYCVKSGKSHFL 101

Query: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180
              +  V  +T+ +TD     +K E+            +KIK  +KV+ IKI      I+
Sbjct: 102 NASVKPVDADTVLDTDGG---DKTED------------FKIKMDSKVVGIKIIPDYKAIV 146

Query: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKVCYKLLEL 240
            +L++GLI++YDF+L+ L S DISY N+K   +F+ENG  F+FVL   +++KVC+KL EL
Sbjct: 147 VVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNKVCFKLFEL 206

Query: 241 TDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIEL 300
             ++ + ++PIKELS+TI+E F+ D SKLCYQ GKLY+L    I  Y+LP C L Q   L
Sbjct: 207 LYHDGKRHTPIKELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQCHLVQTTHL 266

Query: 301 PLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAV 360
           P+I + + +   +S  PVS NR+LLTVNN VYLLDL+H S L +R L+H KTFQLL +A 
Sbjct: 267 PMILDPNSQK--VSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKTFQLLRSAP 324

Query: 361 INSEKS-----HSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDS 415
           +N   S      +++T+AIG++TKNG NPTS+LE+IN+DVGT TLKDSLGKSFQ+     
Sbjct: 325 LNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKSFQSINDSK 384

Query: 416 SVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDL 475
           +  L+PLF D+E        +N D D  +  F Y++I  +LS   +  I+ FD  F K L
Sbjct: 385 THNLQPLFSDDESDAG----DNADSD-EVVAFAYEDIFKELSK-NNKSISKFDSTFAKRL 438

Query: 476 KIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNLLSL 535
            I+EEHYT+++RFI D  FL+KV+ LI + F+  +YP+             D TR LL  
Sbjct: 439 NIQEEHYTDRERFICDQEFLSKVVRLILDSFD-QEYPRALTFLLTHPLFPTDCTRGLLER 497

Query: 536 LRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLS 595
            R+ PRLFKQAIVTC            FSI N EL LDIS RILQDFT D IK E+K+L+
Sbjct: 498 FRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEVKKLN 557

Query: 596 KLDIQNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYID 655
           K+D+ NF+ F+ S +++   E   +              D+IGLF+L+GALL+ L+ YID
Sbjct: 558 KVDVHNFVNFLISPKDE---ELIQNKSTYELFQLLSLVIDAIGLFALDGALLQRLSDYID 614

Query: 656 KQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705
           +QV +AERN  LWNL+D ++   G T     S+ +++Q LP YT+EYL++
Sbjct: 615 EQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLEL 664

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/708 (45%), Positives = 439/708 (62%), Gaps = 59/708 (8%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           M S+SQPFRL ALPKIASL+NFS Q +Y+QVA+ T   S N I +G+SGSS+SQYIINPT
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVAN-TLTPSANKINIGVSGSSISQYIINPT 59

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120
           PKL+ +  IPST+I+TAC+  E Q N  D +  E            +W + L+ NK  +T
Sbjct: 60  PKLVHNLSIPSTSIVTACDVSEIQQNEGDTETQE------------VWCYALVANKS-FT 106

Query: 121 LNVITKVL---ENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNN 177
           LN I K L     ++N+T         EN            YK+  K KV S+KI     
Sbjct: 107 LNTIIKPLTADAPSVNSTQ------TFEN------------YKVSIKHKVASVKIFPSRK 148

Query: 178 LIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIE-FIFVLCPLQDDKVCYK 236
            IIA+LQNGL++ +DF+LKLLHS DISY N+   K+FT   ++ F+ VL  L DDKVCYK
Sbjct: 149 TIIAVLQNGLVQTFDFQLKLLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDDKVCYK 208

Query: 237 LLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQ 296
           L E+  +++  N P+KEL+S I+EGFS  +SK  YQFGK+Y L+ GKI +YSLPH QL  
Sbjct: 209 LFEIIHHDS--NVPLKELNSVILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPHFQLSN 266

Query: 297 VIELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLL 356
            I LP + +     +++SF+P+S NR LLTV+N +YLLDLLH + L QREL+HVKTFQLL
Sbjct: 267 TINLPFVTH----ENVVSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVKTFQLL 322

Query: 357 NTAVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSS 416
            TA+I    + ++KTIAIG+STK+  N TS+L+I+NI+VG+ TLKDS+ K F  +     
Sbjct: 323 TTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGFLTQDATEE 382

Query: 417 VILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLK 476
           V L  LFD+++   +    +  D         Y++I+ +L   KS     FD++FFK L 
Sbjct: 383 V-LNSLFDEQDDELDEDGTSQFD---------YNQILSELEKAKSK-TEKFDNVFFKSLN 431

Query: 477 IKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNLLSLL 536
           IK+E+YTE DRF +   FL+KVL LIFE FN  +YP+                  LLS  
Sbjct: 432 IKKEYYTEYDRFFNSQGFLDKVLSLIFENFN-KEYPRALTYLLTHPLFPAKHATCLLSKF 490

Query: 537 RDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSK 596
           ++ PRLF+QAIVTC            F++ N EL LD+S RILQDFT+DSIKQ +K++SK
Sbjct: 491 KEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSIKKMSK 550

Query: 597 LDIQNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYIDK 656
           +DI NFI F+ + ++D       +              DSIGLF+L+G  LE+L  +I+ 
Sbjct: 551 VDINNFIGFVINEDDDEE----RNKSKPQLFQLLNLVLDSIGLFALDGESLENLHQFIEN 606

Query: 657 QVKIAERNTELWNLIDIKSSQ-HGFTNLAFESASSQKQALPTYTMEYL 703
           QV I E+N EL NL+D  S++     +    S+S+ +QALP+Y++EYL
Sbjct: 607 QVDIVEQNIELLNLLDDTSAKSTSIISSYSASSSTTEQALPSYSVEYL 654

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/753 (44%), Positives = 457/753 (60%), Gaps = 101/753 (13%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPSLSQPFRL  LPKIASLSN+SLQ +Y+QV   TFN +TN + +G+SGS++SQYIINPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120
           PKLIF+YPIPSTNI+TAC+                + N     N E+W FGL+ NK  YT
Sbjct: 61  PKLIFNYPIPSTNIVTACDV---------------LENDNDNTNNEVWCFGLVANK-TYT 104

Query: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNL-- 178
           L +ITK      +    +      E+ V      +  ++ +K  +K++ IKI  K     
Sbjct: 105 LTLITK------DKQKSSATMEDDEDVVDVIDTTIKDEFNVKLDSKIVDIKIIKKKADDI 158

Query: 179 -IIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQD-DKVCYK 236
            I+ +L+NGLI+F++  LKLL++  I+Y N+K+ + F E+  +F+F +C L D +KVC K
Sbjct: 159 SIMIVLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIK 218

Query: 237 LLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQ 296
           L ++       N    EL+S I+E F+  ++K CYQFGK YKL    + VYSLP  QL+ 
Sbjct: 219 LFQI------NNDSAIELNSIIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEH 272

Query: 297 VIELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLL 356
              +P+I   D    ++S +P+S NR+LLT+NN +YLLDL+H S L +REL+H+K+ QLL
Sbjct: 273 TTTIPMIKTDD---QIVSMKPISTNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLL 329

Query: 357 NTAVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSF-----QAE 411
            +AVI  +  +++KTI IG+STK G NPTSSLEIIN+DVG+NTLKDSLGK F     Q +
Sbjct: 330 RSAVI-GKGENNNKTITIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFQNLNLQNQ 388

Query: 412 KKDSSVILKPLFDDEEVTENMVKRNNIDGD---------ISIPTFQYDEIIVKLSALKSN 462
            + S+  LKPLFD            N DGD         ++   F YDEI+ KLS   +N
Sbjct: 389 IQISTQALKPLFDP-----------NTDGDKDDDLFKKLVTKEQFNYDEILTKLSE-NTN 436

Query: 463 DITSFDDIFFKDLKIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNG-------NDYPKXX 515
           DI  FD+IFF+   IK+EHYTE DRFI +  F  K++DLIFEKF         N+YPK  
Sbjct: 437 DIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGSTATTAQTNEYPKTL 496

Query: 516 XXXXXXXXXXXDRTRNLLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDIS 575
                      +RT++LLS   + PRLFKQAIVTC             +I+N EL LDIS
Sbjct: 497 TFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVTCPNLPLPELLNELLTIKNNELSLDIS 556

Query: 576 FRILQDFTRDSIKQEMKRLSKLDIQNFIEFMTSTE---NDNSLEGFNHXXXXXXXXXXXX 632
            RILQD+++DSIKQE++ L +L+I+NFI+F+ + E   + NS + F              
Sbjct: 557 LRILQDYSKDSIKQELRNLPRLEIENFIDFILNDEIKDDQNSPQLFQ---------LLAL 607

Query: 633 XXDSIGLFSLEGALLESLTSYIDKQVKIAERNTELWNLIDIKSS--QHGFTNLAFESASS 690
             DSIGLF+L   +LE+L++YID+QV I E+NTELW LID  ++   H   + +F SAS+
Sbjct: 608 VLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSHNKKDNSFSSASA 667

Query: 691 ------------------QKQALPTYTMEYLDI 705
                             QK+ALP Y+++YL++
Sbjct: 668 STNSKSNNISSNNKKSFTQKEALPMYSVDYLEL 700

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/709 (44%), Positives = 441/709 (62%), Gaps = 61/709 (8%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPSLSQPFRLA LPKIA LS++++Q+  +QVAD  F   +N IT+G+SG +VSQY+INPT
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINPT 59

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120
           P +    PIPSTN +TACN  + +             ++ T+   EIW + L VNK N T
Sbjct: 60  PNVSQTVPIPSTNNVTACNVAQYK-------------DADTEELFEIWVYNLAVNKKN-T 105

Query: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180
           L+V  K ++                +   T     L  Y +K  A V+ IKI+ ++  I+
Sbjct: 106 LHVAIKTVD---------------PDKFSTTQSDALETYTVKCDASVVGIKINKEDKTIV 150

Query: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKVCYKLLEL 240
             L NG I+ +DFKLKLL+S + SYDN+ +++ F EN   F  +L  ++ +K+ YKL EL
Sbjct: 151 VTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNKLSYKLYEL 210

Query: 241 TDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIEL 300
                ++ + IKELSSTI+E     DSK+ YQFGKLY+L K +++VYSLP CQL   I L
Sbjct: 211 F---GQDKTSIKELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQLVDTITL 267

Query: 301 PLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAV 360
           P I+    +   ISF+PVS NR+LLTV+N +++LDL+H +TL +R L HVK FQLL + V
Sbjct: 268 PQIDLK--KSQAISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLKSVV 325

Query: 361 INS-EKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVIL 419
           I + + S++ KTIAIG+S KNG +P ++LEIIN +VGT TLKDSLG SF   K   S IL
Sbjct: 326 IETNDASNNHKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVSKSFKSNIL 385

Query: 420 KPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKE 479
           +PLF D+    N+VKR++         F+Y+ I+ KLS+ + NDI  FDDIFF DL I++
Sbjct: 386 QPLFTDDA---NLVKRHD---------FKYEAILKKLSSTE-NDIKKFDDIFFGDLYIQQ 432

Query: 480 EHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNLLSLLRDQ 539
            +YT+ +RFI D+ FL+ V+DLIF+ F   +YP               +T+NLL  LR+ 
Sbjct: 433 NYYTDNERFIFDVTFLSDVIDLIFKNFQ-KEYPSALTFLLTHPLFPIHQTKNLLLKLREH 491

Query: 540 PRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDI 599
           PRLFKQA+VTC            FSI N EL +DIS RILQD+T+DSIK E+K L+K+DI
Sbjct: 492 PRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLELKNLNKIDI 551

Query: 600 QNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYIDKQVK 659
           QNFI+F+    N+   E   H              D+ GLFS+EG LL  L+ YIDKQV+
Sbjct: 552 QNFIDFVIDPNNE---EEKKH--NEQLFVLLSLVLDASGLFSIEGPLLTQLSEYIDKQVE 606

Query: 660 IAERNTELWNLIDIKSSQHGFTNLAFESASS---QKQALPTYTMEYLDI 705
           + E++ +LW+LID      G  N  ++++ +   + +AL  Y++EYL++
Sbjct: 607 MIEKSNKLWHLID---GTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  531 bits (1367), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 316/735 (42%), Positives = 458/735 (62%), Gaps = 67/735 (9%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPSLSQPFRLA LPKIASLSN+SLQ +Y+QVA  TF   TN +TLGISGS +SQYIINPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIE--------------DKDN---NEKVINSQ--- 100
           PKL+F+  IPSTN +TA N       +E              DKDN    E+V  ++   
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 101 -TKRNIEIWSFGLMVNKGNYTLNVITKVLENTINNTDENLVENKIENNVYTGSEG-LLSQ 158
            TKR++E+W++GL+ NK N TLN+  K         DE           ++ + G ++ +
Sbjct: 121 VTKRSVELWAYGLVANKSN-TLNISVKT-----TGLDE-----------FSTTPGEIIRK 163

Query: 159 YKIKAKAKVMSIKIDTKNNLIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENG 218
             IK  +KV++IKI  +   I+ +L+NGL++ +DF L L  S DI+Y+++++ + FTE+ 
Sbjct: 164 KTIKVDSKVVNIKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESK 223

Query: 219 IEFIFVLCPLQDDK--VCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKL 276
             F+ +L  + ++K  VC+KL +L    + +++ + ELS +I++ F    SKL YQFGKL
Sbjct: 224 QNFLLILSNIDEEKSSVCFKLYQLR--LDSDSNQVSELSFSILQDFDLSKSKLSYQFGKL 281

Query: 277 YKLNKGKIYVYSLPHCQLQQVIELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDL 336
           Y+L   +++VYSLP CQL Q I L  I  +    D+ S +PV+ NR++L +NN+VYL+D 
Sbjct: 282 YRLTGSELFVYSLPQCQLLQNISLAEIFPNTI--DVSSIKPVANNRLVLAINNVVYLIDT 339

Query: 337 LHCSTLGQRELSHVKTFQLLNTAVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVG 396
           LH S L +RE +HVKTFQLL +A I  + + + +TIAIG+STK+G    S+LE+INI+VG
Sbjct: 340 LHRSILAEREFTHVKTFQLLQSATI-GDSNITQRTIAIGVSTKSGPTSASALELINIEVG 398

Query: 397 TNTLKDSLGKSFQAE-KKDSSVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVK 455
           + TLKDSLGK    +  + S   LKPLFD+ +  E  +    +    ++ +F +++I   
Sbjct: 399 SGTLKDSLGKGVSKKLSEGSHSDLKPLFDEND--EKSLIGTPVHDISNVKSFNFNKI--- 453

Query: 456 LSALKSND-ITSFDDIFFKDLKIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKX 514
           L+ LKS+D I+ FD  FF+ L+IKE HYTE DRFISD  F+   +DLIF+KF+  ++PK 
Sbjct: 454 LADLKSSDTISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFD-TEFPKA 512

Query: 515 XXXXXXXXXXXXDRTRNLLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDI 574
                         T  LL  L+D PRLFKQAIVTC            F+++N EL LDI
Sbjct: 513 FTFLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDI 572

Query: 575 SFRILQDFTRDSIKQEMKRLSKLDIQNFIEFMTSTEND----NSLEGFNHXXXXXXXXXX 630
           S R+LQD++R+ +KQE+K+L  +DI+NFIEF+ +   +    N+ + F            
Sbjct: 573 SLRVLQDYSRNDVKQEIKKLDNVDIENFIEFIITPTTEEIQTNTPQLFQ---------LL 623

Query: 631 XXXXDSIGLFSLEGALLESLTSYIDKQVKIAERNTELWNLIDIKSSQHGFTNLAFESASS 690
               DSIGLF+L+G LLE L++YI++QV IAER++ELW+L+D  ++   F N   +S   
Sbjct: 624 SLVLDSIGLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIG 683

Query: 691 QKQALPTYTMEYLDI 705
            K+ L  Y+++YLDI
Sbjct: 684 NKETLSVYSVDYLDI 698

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  522 bits (1344), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 302/718 (42%), Positives = 439/718 (61%), Gaps = 53/718 (7%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPSLSQPFRLA LPKIASL NFS +  Y++VAD +F   +N++ LGISGSS+S+Y+I PT
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVAD-SFTPDSNSVLLGISGSSISKYVITPT 59

Query: 61  PKLIFDYPIPSTNIITACNAG----------EAQVNI-EDKDNNEKVINS-QTKRNIEIW 108
           P+LIF+ PIPST++++ACN G          + Q    E  D      N+ +  ++ EIW
Sbjct: 60  PRLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIW 119

Query: 109 SFGLMVNKGNYTLNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVM 168
            + L  N   +TLN + + ++N  NNT      +  ENN          Q+  K K +++
Sbjct: 120 CYALSANNKTHTLNCLIREVDN--NNT------SITENN---------PQFNAKFKEQII 162

Query: 169 SIKIDTKNNLIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPL 228
           +I++DTK+ +I+ + + GL++FYD +LKLL+S +  Y ++K  K F ENG+E++ ++  L
Sbjct: 163 NIEVDTKHKVIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDL 222

Query: 229 QDDKVCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYS 288
           +D KV  +L E++  E +    +KEL+S+IIE F+  DS LCYQFG++Y+L K +I VYS
Sbjct: 223 KDQKVALQLYEVSTEEKK----VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYS 278

Query: 289 LPHCQLQQVIELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELS 348
           +P  QL   +++P ++  + ++ LIS +P++ NRVLLTV N +YLLDLLH S L +RE+S
Sbjct: 279 IPSLQLNSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVS 338

Query: 349 HVKTFQLLNTAVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSF 408
           H+KTFQ+L TA +N + S S  T+A+GISTKNG NPTS+LEIINIDVG+N+LKDSLGKSF
Sbjct: 339 HMKTFQILKTA-MNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSF 397

Query: 409 QAEKKDSSVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFD 468
                     LK LF + +                +P+  + EI+ KL    +N    FD
Sbjct: 398 LRRNNQIQGQLKNLFPEPKY--------------ELPSINFPEILGKLK--NANSAEKFD 441

Query: 469 DIFFKDLKIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGN-DYPKXXXXXXXXXXXXXD 527
           + FF  L IKEE +TE  RF++D  FL  VLDLIF K + N   P+             +
Sbjct: 442 ETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKE 501

Query: 528 RTRNLLSLLRDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSI 587
           +   LL+ ++   RLFKQAIVTC            F+I+N EL++DIS RILQD+T+D+I
Sbjct: 502 KAIGLLTKVKSNSRLFKQAIVTCPNLPLQELLQELFTIKNSELVVDISMRILQDYTKDAI 561

Query: 588 KQEMKRLSKLDIQNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALL 647
           K+E+K+L ++ ++NF+ F+    N  +                    DSIGLF LE ++L
Sbjct: 562 KEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGLEESIL 621

Query: 648 ESLTSYIDKQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705
             L+S I+K+VKIAERN ELWN++D K      ++    S  ++    P Y +EY+DI
Sbjct: 622 IQLSSIIEKEVKIAERNVELWNIMDAKMLSVKKSSSTAASKLAENSQTP-YIVEYIDI 678

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  506 bits (1302), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 292/709 (41%), Positives = 428/709 (60%), Gaps = 63/709 (8%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPS+SQPFRL ALPKIASL+N++ Q NY+QVAD T   +TNNI +G+SGS+VSQYIINPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVAD-TLTPTTNNINVGVSGSAVSQYIINPT 59

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120
           PKL+++ PI STN+++AC   E             +  +  K + E+  +G+  N+  Y+
Sbjct: 60  PKLVYNQPISSTNVVSACAVAE-------------ITTTSEKDSQEVICYGIQSNRV-YS 105

Query: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180
           L    K + +T   +D +  E               + +K+    +++++K+      I+
Sbjct: 106 LCATIKPVSSTA--SDSSFGET-------------YAAHKVSVSDQIVNLKVFPDTKSIV 150

Query: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFT-ENGIEFIFVLCPLQDDKVCYKLLE 239
           A+L++GLI+F+DF+LKL HS D SY N+ Y + FT E+G  + F+L  +   KV +KL E
Sbjct: 151 AVLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDIDGHKVSFKLFE 210

Query: 240 LTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIE 299
           +   ++   +P  ELSS I+E     DS++ YQFG++Y+L+   + +Y+LPH Q  + IE
Sbjct: 211 IG--QSDSATPATELSSVILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPHFQHSRTIE 268

Query: 300 LPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTA 359
           LP +        +ISF+P+S NR LLT +N ++LLDLLH + L QRE+ HVK FQLL TA
Sbjct: 269 LPFLA----PESIISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVKIFQLLETA 324

Query: 360 VINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVIL 419
           VI    + ++KTIA+G+S K+G+NP+SSL+IINIDVGT TL+DS+GK F + +++ S  L
Sbjct: 325 VIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGFMS-RENKSQHL 383

Query: 420 KPL---FDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLK 476
           +PL    +D E  E                F YD I+ +LS    N I +FD +FFK L 
Sbjct: 384 QPLISTLNDTEAAE----------------FNYDRILKELSKAADN-IENFDSVFFKRLG 426

Query: 477 IKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNLLSLL 536
           IK  +YT+ DRF++D  FL  V  LIF+ F  ++YPK               T NLL  L
Sbjct: 427 IKNNYYTDSDRFVNDREFLEDVSTLIFKSFK-SEYPKALTYLLTNPLFPVSHTHNLLQKL 485

Query: 537 RDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSK 596
           +D PRLFKQAIVTC            F++ N EL LD+S RILQDF +DSIK+ +K+ SK
Sbjct: 486 KDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAIKQKSK 545

Query: 597 LDIQNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYIDK 656
           +D+ NFI F+ S EN    E                  DS+GLF+LE  +LE LT YID+
Sbjct: 546 IDVNNFINFVIS-EN---FEEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKLTKYIDQ 601

Query: 657 QVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705
           Q+ + + N EL+NL++ K+ ++GF     ++++S +  +  Y++E L++
Sbjct: 602 QLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  483 bits (1243), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 281/708 (39%), Positives = 433/708 (61%), Gaps = 66/708 (9%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           M S+SQPFRL+ALPKI SL+N++ Q +Y+QV D   + S N + +GISGSS+SQY+INPT
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINPT 59

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120
           PKL+F+ PIPSTNI+TAC+       +ED              N E+W +GL   K ++ 
Sbjct: 60  PKLVFNLPIPSTNIVTACDV------VEDA------------ANTEVWCYGLEARKVSH- 100

Query: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180
           L++ TK +               I++ V + +  + SQ+K K K++V+SIKI +K   ++
Sbjct: 101 LHLATKPM---------------IQDAVSSSNAEITSQFKYKLKSEVVSIKIYSKAEKVL 145

Query: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTEN-GIEFIFVLCPLQDDKVCYKLLE 239
            IL+NGLI+ +D++LKL ++ DISYD++++ ++F +  G +F FVLC L D+K+CYKL +
Sbjct: 146 VILRNGLIQTFDYELKLSNTIDISYDDIRFVQFFQDGQGNDFFFVLCQLSDEKICYKLFQ 205

Query: 240 LTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKL-NKGKIYVYSLPHCQLQQVI 298
           +      E+    EL+S I+E ++ +++KLC++FGKLY L N  ++ +Y LPH QLQ  I
Sbjct: 206 V----RSESVSCIELNSIILENYTLENAKLCFEFGKLYVLKNSNELSIYQLPHLQLQTSI 261

Query: 299 ELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNT 358
           +LP I+    +  ++S +PVS NRVLLT +N +YL+DLL+ + L Q++L ++K  QLL+T
Sbjct: 262 QLPFIS----KDAVVSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQNIKAIQLLST 317

Query: 359 AVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVI 418
           AV+      + KTIA+ ++TKNGANPTS L++INIDVGT TLKD++GK F  ++K     
Sbjct: 318 AVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFMVKQKQK--- 374

Query: 419 LKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIK 478
           L+ LF++          +N D D+ +P+  Y+ II +L   K   I +FD IFFK L + 
Sbjct: 375 LQKLFEE----------SNEDDDVELPSPDYERIIKQLHICKK--IENFDSIFFKMLSLD 422

Query: 479 EEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNLLSLLRD 538
           +E+YT+ DRF++D   L +++D +F  F  ++YPK                + LL+ L++
Sbjct: 423 KEYYTDNDRFLNDSDLLTQIIDCLFLNFK-DEYPKALTYLLTHPLFPPVHAKGLLTKLKN 481

Query: 539 QPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLD 598
            PRLFKQAIVTC            F+I N EL  DI+ R+LQD+ ++SIK  ++++ K+D
Sbjct: 482 NPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKMD 541

Query: 599 IQNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYIDKQV 658
           I NF++ + ++   +S    N               DSIGLF+L+   LE L+S++D QV
Sbjct: 542 ITNFLDMILNSNKADSDLKLNK---PQIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQV 598

Query: 659 KIAERNTELWNLID--IKSSQHGFTNLAFESASSQKQALPTYTMEYLD 704
            +  +N EL +L +   K S          + SS  Q +  YT++YL+
Sbjct: 599 SVVSQNIELLHLAEHYTKHSSVVNNKSNSSTNSSSTQPISAYTVDYLE 646

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  483 bits (1242), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 273/710 (38%), Positives = 413/710 (58%), Gaps = 67/710 (9%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           M  ++QPFRLA LPKI+SL+N++ Q +Y+QVAD     ++N +T+G+SGSS+SQY+INPT
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVAD-VLEPTSNTVTVGVSGSSISQYVINPT 59

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120
           PKL+++ PIPSTN++T C+     + + D                E+WS+ L  N   +T
Sbjct: 60  PKLVYNIPIPSTNVVTGCDV----LAMSD--------------GAELWSYALTANGKVHT 101

Query: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180
           L+ + +        T  +  E++               +K   K +V+ ++I +    I+
Sbjct: 102 LHAVLRKAGAAPQETGLDASEDE--------------HFKQTLKGRVVRVRILSACKRIM 147

Query: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTEN-GIEFIFVLCPLQDDKVCYKLLE 239
            +L  GLI+ YD++L+LLHS DISY N+   ++FT++ G +++FVLC +Q+ K CYKL +
Sbjct: 148 VVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQ 207

Query: 240 LTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIE 299
           L    + EN PI EL+S I+E F+  +SK+ YQFGKLY+L   K+YVYSLPH QL   + 
Sbjct: 208 LN--HSAENLPITELNSVILEDFALAESKMVYQFGKLYRLVDSKMYVYSLPHFQLSHCVP 265

Query: 300 LPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTA 359
           LP +   D     +S Q +S NR+LLT  N ++LLDLLH + L +RELS++K FQLL  A
Sbjct: 266 LPFVRKDD----QVSLQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNIKFFQLLRAA 321

Query: 360 VI-NSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVI 418
           VI  +    S++T AIG+STK G+NP+S+L+++ I VGT TLKDSLGK F + +   +  
Sbjct: 322 VIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFLSGEHRRTEA 381

Query: 419 LKPLF--DDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLK 476
           LKPLF  DD+E                 P   +  I+ +L++  +    +FD IF+K L 
Sbjct: 382 LKPLFGTDDDES----------------PNIDFAAILAELTSRTTPK--AFDSIFYKRLG 423

Query: 477 IKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNLLSLL 536
            K+E+YTE DRFI++  FL  +LD IF  F  +++PK               T+ LL  L
Sbjct: 424 PKKEYYTEHDRFINNSEFLAGILDHIFATF-ADEFPKALIYLLTHPLFPSSHTKGLLPKL 482

Query: 537 RDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSK 596
           +  PRLFKQA+VTC            F++ N EL LD+S R+LQ+FT++ IKQ ++ LS+
Sbjct: 483 KAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQGIRELSR 542

Query: 597 LDIQNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYIDK 656
           +D+ NF+ F+     D                      D++GL +LEG +L  L+++ID 
Sbjct: 543 VDLHNFLNFVIKDSTDVEER---QKAKPQLFQLLSLVIDAVGLLALEGDILHRLSAFIDS 599

Query: 657 QVKIAERNTELWNLIDIKSSQHG--FTNLAFESASSQKQALPTYTMEYLD 704
           QV +A++  EL  L++  S++ G    ++     S     +P Y++EYLD
Sbjct: 600 QVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLD 649

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  270 bits (690), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 164/397 (41%), Positives = 231/397 (58%), Gaps = 28/397 (7%)

Query: 313 ISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAVINSEKSHSSKTI 372
           +SF P+S+NR LLT +N VYLLDLLH + L QRE +HVKTFQLL TAVI    S ++ TI
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 373 AIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKD----SSVILKPLFDDEEV 428
           AIG++TK G   TSSL+++NIDVGT TLKDS+GK F + K       S++  P  +D EV
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTP--NDTEV 118

Query: 429 TENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKEEHYTEKDRF 488
            E+                 Y +I+  L+  KSN    FD +FFK L IK ++YT+ DRF
Sbjct: 119 QEH----------------NYTQILKDLAKTKSNS-DKFDSVFFKKLNIKNDYYTDSDRF 161

Query: 489 ISDLVFLNKVLDLIFEKFNGNDYPKXXXXXXXXXXXXXDRTRNLLSLLRDQPRLFKQAIV 548
           ++D  FL   L LIFE F  ++YPK               T +LL  L+D PRLFKQAIV
Sbjct: 162 LNDQEFLGNSLKLIFENFQ-SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIV 220

Query: 549 TCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDIQNFIEFMTS 608
           TC            F++ N EL LD+S RILQDF++DSIK  +K+ SK+D+  FI F+ +
Sbjct: 221 TCPNLPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMN 280

Query: 609 TENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYIDKQVKIAERNTELW 668
              D                      DS+GLF+LE   L+ L++YID+Q+ + ++N +L+
Sbjct: 281 ENVDED----RVKNKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLY 336

Query: 669 NLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705
           NL+D ++ ++       +S S  + A+  Y++E L++
Sbjct: 337 NLVDERNFKNILGQHHADSLSVGEGAITAYSVEQLEL 373

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  246 bits (628), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 191/576 (33%), Positives = 300/576 (52%), Gaps = 81/576 (14%)

Query: 156 LSQYKIKAKAKVMSIKIDTKNNLIIAILQNGLIEFYDFKL-----KLLHS--FDISYDNL 208
           L+  K+  ++K+M  K+ +  +  I IL+NG IE YD  L     K  H    ++ +   
Sbjct: 89  LNGKKVPIQSKIM--KLFSDESQTITILENGTIEKYDSNLIKSTYKTPHKDLVNVEFIES 146

Query: 209 KYAKWFTENGIEFIFVLCPLQDDKVCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSK 268
           KYA   ++N I        L D     +L  + + ++  +S  K L              
Sbjct: 147 KYALLISQNSIS-------LYDINTMIELRNVANVQDIVDSDFKSLD------------- 186

Query: 269 LCYQFGKLYKLNK--GKIYVYSLPHCQLQQVIELPLINNSDFEHDLISFQPVSVNRVLLT 326
                GKLY+ N+   K  ++ +    +  +I +P IN  D E D++SF  V  N V++ 
Sbjct: 187 -----GKLYQFNQKLSKFDIWEISSMTIVNIITIPFIN--DVEKDVVSFTVVDDNCVVMA 239

Query: 327 VNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAVINSEKSHSSKTIAIGISTKNGANPTS 386
           VN+ +Y L+L   S +   EL ++K F+L++           S    +G+S  N      
Sbjct: 240 VNSTIYALNLHLSSVISMSELLNLKWFKLIDNL---------SNQFVLGLSFNNE---NY 287

Query: 387 SLEIINIDVGTN-TLKDSLGKSF-------QAEKKDSSVILKPLFDDEEVTENMVKRNNI 438
             E+IN+D+ +N  LKDSLGK F       Q+EK+  +++LK LF  +E  E++   N+ 
Sbjct: 288 KFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKE--TLVLKSLFSADEADEDL--HNDS 343

Query: 439 DGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKEEHYTEKDRFISDLVFLNKV 498
           D D+   TF YD+IIV L+    N  + FD IFF+   IK+EHYTE DRF+ +  FL KV
Sbjct: 344 DSDVE-HTFNYDKIIVDLNKAVKNP-SKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKV 401

Query: 499 LDLIFEKF----NGNDYPKXXXXXXXXXXXXXDRTRNLLSLLRDQPRLFKQAIVTCXXXX 554
           ++LI + +    +GN+YPK               T+NLL   R+ PRL+KQAIVTC    
Sbjct: 402 IELILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLP 461

Query: 555 XXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDIQNFIEFMTSTENDNS 614
                   F+I N EL LDIS R+LQD+T+DSIK+++K L K+DI+NFIEF+T  E    
Sbjct: 462 LGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDE---- 517

Query: 615 LEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYIDKQVKIAERNTELWNLIDIK 674
               +               DSIGLF+L+  +L  ++++I+++  +A++N+EL +L+D  
Sbjct: 518 ----DQQVSSQLFQLLSLIIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYN 573

Query: 675 SSQHGFTNLAFE-----SASSQKQALPTYTMEYLDI 705
            S+      + +     + S  ++ LPTYT+E+LD+
Sbjct: 574 PSKQSSARQSSKLINNNNKSLHRKTLPTYTVEHLDL 609

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 49/77 (63%), Gaps = 7/77 (9%)

Query: 1  MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
          MPS+SQPF +  +PK +S S        + V+  +   ++N++ + IS  +VS+++INPT
Sbjct: 1  MPSISQPFAITTVPKQSSTSP-------IIVSSHSLTANSNSLDVAISKYAVSKFVINPT 53

Query: 61 PKLIFDYPIPSTNIITA 77
          PKLI   PIPS  ++TA
Sbjct: 54 PKLINSIPIPSNEVVTA 70

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  221 bits (562), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 195/649 (30%), Positives = 307/649 (47%), Gaps = 81/649 (12%)

Query: 85  VNIEDKDNNEKVINSQTKRNIEIWSFGLMVNK---GNYTLNVITKVLENTINNTDENLVE 141
            N+  + +  KV+ SQ        +  + V+K     Y +N   K++ +       NL  
Sbjct: 12  ANVPRQASQTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKLVNS--KAIPSNLTV 69

Query: 142 NKIENNVYTGSEG-------LLSQYKIKAKAKV---MSIKIDTKNNLIIAILQNGLIEFY 191
              +N VY            L   ++I  K+ V   +S KI  ++ +  AILQ+G ++ Y
Sbjct: 70  TAFDNGVYATQSNNKSFCLYLDESHQIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQKY 129

Query: 192 DFKLKLLHSFDISYDNLKYAKWFTENGIEFI---FVLCPLQDDKVCYKLLELTDYENREN 248
               ++           K+        +EFI   + L         Y+L  LT+      
Sbjct: 130 KGGEQVFA---------KHLPLKDIKQVEFIDGQYALIVAAQSTALYELENLTELR---- 176

Query: 249 SPIKELSSTIIEGFSFDDSKLCYQ-FGKLYK--LNKGKIYVYSLPHCQLQQVIELPLINN 305
                +S+T+     F+  K   Q  GK+Y+  L      ++ L       V+ +P ++ 
Sbjct: 177 -----VSTTL----HFEQFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSA 227

Query: 306 SDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAVINSEK 365
           S  +   ++F  V  +RV L + N +YLLDL   S L   + + +K  +L+  A      
Sbjct: 228 S--KGAPLTFTVVGDSRVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGA------ 279

Query: 366 SHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSF-----QAEKKDSSVILK 420
                + AI +S     N  S L+IIN+++G+ ++KDSLGK F     +    +S V L+
Sbjct: 280 --RDGSFAIALSHGPQDNAVS-LDIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLR 336

Query: 421 PLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKEE 480
           P+ D               GD +  +F Y  I+ KL+A  + D   FD IFFK+L I +E
Sbjct: 337 PILDA--------------GDKTKRSFDYASILKKLTA-AAKDPAKFDQIFFKELYIVQE 381

Query: 481 HYTEKDRFISDLVFLNKVLDLIFEKFN---GNDYPKXXXXXXXXXXXXXDRTRNLLSLLR 537
            YTE DRFI D  FL++ + +I + ++    + YP              D+TR+LLS ++
Sbjct: 382 CYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVK 441

Query: 538 DQPRLFKQAIVTCXXXXXXXXXXXXFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKL 597
             PRL+KQ IVTC            F I N EL LD+S +ILQD+T+DSIK+EMK L ++
Sbjct: 442 QIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSLKILQDYTKDSIKKEMKALPRV 501

Query: 598 DIQNFIEFMTSTENDNSLEGFNHXXXXXXXXXXXXXXDSIGLFSLEGALLESLTSYIDKQ 657
           ++ NFI+F+    N NS E  +               DSIGLF+L+G LL  L  YID  
Sbjct: 502 NVTNFIKFVIGNYN-NSDE--SSVATPQLFQLLSLVIDSIGLFALDGELLTELAGYIDNM 558

Query: 658 VKIAERNTELWNLIDIKSSQHGFTNL-AFESASSQKQALPTYTMEYLDI 705
           VKIAE NTELWNL++ ++++         +   +QK+  P Y +++L+I
Sbjct: 559 VKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKTQKKVFPPYLVDHLEI 607

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 46/79 (58%), Gaps = 7/79 (8%)

Query: 3  SLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPTPK 62
          S+SQPF +A +P+ AS +        V ++  +   + N + + +S  S+SQYIINPTPK
Sbjct: 4  SISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56

Query: 63 LIFDYPIPSTNIITACNAG 81
          L+    IPS   +TA + G
Sbjct: 57 LVNSKAIPSNLTVTAFDNG 75

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  167 bits (422), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 93/240 (38%), Positives = 145/240 (60%), Gaps = 28/240 (11%)

Query: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60
           MPS+SQPFRL ALPKIASL+N++ Q +Y+QVAD T   +TN + +GISGS++SQY+INPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVAD-TLTPATNRVNVGISGSAISQYVINPT 59

Query: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120
           PKL+++ PI STN++TAC+  E         NNE      T    E+  + L  NK  ++
Sbjct: 60  PKLVYNLPISSTNVVTACDVAEVA-----GTNNEG-----TAEAHEVLCYALQANK-TFS 108

Query: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180
           +  + K + +    TD +  E               + +K+    + +++K+      I+
Sbjct: 109 ICAVKKPIPSAA--TDSSFGET-------------YATHKVALANQAVNVKVFPATKSIV 153

Query: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWF-TENGIEFIFVLCPLQDDKVCYKLLE 239
           A+L +GLI+F+D+ LKL HS D SY N+++ + F +E+  +F+F+L  L   KV +KLL+
Sbjct: 154 AVLSSGLIQFFDYDLKLQHSIDSSYGNVQFVQHFVSESKQDFMFLLSDLDGRKVSFKLLK 213

>ZYRO0E08074g Chr5 complement(633136..634914) [1779 bp, 592 aa] {ON}
           similar to uniprot|P38687 Saccharomyces cerevisiae
           YPL243W SRP68 Component of the signal recognition
           particle (SRP) ribonucleoprotein (RNP) complex that
           functions in protein targeting to the endoplasmic
           reticulum (ER) membrane
          Length = 592

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%)

Query: 638 GLFSLEGALLESLTSYIDKQVKIAERNTELWNLIDI 673
           GL+ L+G  LESL  ++D   K+ ER TE+ N  DI
Sbjct: 420 GLYQLKGRYLESLALHVDAHQKLEERLTEMGNFQDI 455

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 2/102 (1%)

Query: 214 FTENGIEFIFVLCPLQDDKVCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQF 273
           F +N  E    LC   D KV +K+  ++ +    N PI       +     + SK   ++
Sbjct: 353 FWDNEKEIFKTLCQ-NDIKVSHKVGLVSSFR-VPNIPITSPIRFQLSVLGINKSKRMAEY 410

Query: 274 GKLYKLNKGKIYVYSLPHCQLQQVIELPLINNSDFEHDLISF 315
            K Y  + G   VY   H Q++   ++PLI+ +D +H  +SF
Sbjct: 411 LKNYSADTGVSLVYKGDHSQMKLSYQIPLIHGNDNKHSGLSF 452

>NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {ON}
           Anc_4.275 YLR409C
          Length = 949

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 147 NVYTGSEGLL-SQYKIKAKAKVMSIKIDTKNNLIIAILQNGLIEFYDF 193
           +VY    G+L  +YK+  KA V  I +D  N  +++   +GL+ FYDF
Sbjct: 492 HVYNMQSGILRKKYKLHKKA-VTGIALDGMNRKMVSCGLDGLVGFYDF 538

>TPHA0B01680 Chr2 (375904..377607) [1704 bp, 567 aa] {ON} Anc_4.333
           YML069W
          Length = 567

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 3/38 (7%)

Query: 281 KGKIYVYSLPHCQLQQVIELPLINNSDFEHDLI-SFQP 317
           +GK Y Y L H Q+Q++I LP ++  D  H ++ S +P
Sbjct: 277 RGKTYEYKLQHRQIQKIISLPKVD--DIHHLIVLSIEP 312

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,675,758
Number of extensions: 3628771
Number of successful extensions: 15371
Number of sequences better than 10.0: 142
Number of HSP's gapped: 15956
Number of HSP's successfully gapped: 145
Length of query: 705
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 588
Effective length of database: 40,065,477
Effective search space: 23558500476
Effective search space used: 23558500476
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)