Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2233.487ON31331316630.0
YGR127W3.487ON31231314120.0
Suva_7.4153.487ON31331313840.0
Skud_7.4383.487ON31331313650.0
CAGL0I10582g3.487ON3193268221e-109
NCAS0E008403.487ON3363248131e-107
NDAI0G009703.487ON3323397911e-104
SAKL0F02882g3.487ON2983167451e-97
KAFR0C019303.487ON3133237348e-96
TDEL0D055503.487ON3103166903e-89
Kpol_1017.93.487ON3103246565e-84
KLLA0E04687g3.487ON3063216549e-84
KNAG0B008403.487ON3133236522e-83
TPHA0D032603.487ON3143246435e-82
ZYRO0D10098g3.487ON2762646041e-76
Kwal_55.212173.487ON3033085817e-73
KLTH0F14718g3.487ON3003165522e-68
Ecym_12423.487ON3113235288e-65
AFR305W3.487ON3093215235e-64
TBLA0D029903.487ON3183234967e-60
Skud_7.6115.16ON59335780.35
Suva_10.3358.401ON875116741.1
KLTH0C02156gsingletonON81895721.8
KLLA0D15180g3.443ON2379169678.0
YOL076W (MDM20)3.130ON79674668.9
TBLA0G00730singletonON80161669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.223
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   645   0.0  
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   548   0.0  
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   537   0.0  
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   530   0.0  
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   321   e-109
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   317   e-107
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   309   e-104
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   291   1e-97
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   287   8e-96
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   270   3e-89
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   257   5e-84
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   256   9e-84
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   255   2e-83
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   252   5e-82
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   237   1e-76
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   228   7e-73
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   217   2e-68
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   207   8e-65
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   206   5e-64
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   195   7e-60
Skud_7.611 Chr7 (1021279..1023060) [1782 bp, 593 aa] {ON} YGR278...    35   0.35 
Suva_10.335 Chr10 (584112..586739) [2628 bp, 875 aa] {ON} YLR240...    33   1.1  
KLTH0C02156g Chr3 complement(193918..196374) [2457 bp, 818 aa] {...    32   1.8  
KLLA0D15180g Chr4 (1284273..1291412) [7140 bp, 2379 aa] {ON} wea...    30   8.0  
YOL076W Chr15 (187024..189414) [2391 bp, 796 aa] {ON}  MDM20Non-...    30   8.9  
TBLA0G00730 Chr7 complement(165589..167994) [2406 bp, 801 aa] {O...    30   9.2  

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/313 (100%), Positives = 313/313 (100%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60
           MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60

Query: 61  GINKEGKLATILNLKLGSERSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYDGLK 120
           GINKEGKLATILNLKLGSERSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYDGLK
Sbjct: 61  GINKEGKLATILNLKLGSERSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYDGLK 120

Query: 121 ATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEKAW 180
           ATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEKAW
Sbjct: 121 ATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEKAW 180

Query: 181 EKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVTMST 240
           EKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVTMST
Sbjct: 181 EKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVTMST 240

Query: 241 IYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQYSV 300
           IYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQYSV
Sbjct: 241 IYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQYSV 300

Query: 301 SAPKEEKRFEFEL 313
           SAPKEEKRFEFEL
Sbjct: 301 SAPKEEKRFEFEL 313

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/313 (83%), Positives = 293/313 (93%), Gaps = 1/313 (0%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60
           MCILMATRAHPDYELILISNRDEFLARKTHATCWHN+DFILSPYDLA+TS E Q FGTWS
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60

Query: 61  GINKEGKLATILNLKLGSERSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYDGLK 120
           GINKEGKLATILNLKL +E++  KS+SRGLLP+IFLS H+A+F+DWD+Y KF  HYDGLK
Sbjct: 61  GINKEGKLATILNLKLDNEQNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGHYDGLK 120

Query: 121 ATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEKAW 180
           +TGDFNFFYGDVI+KQYKVIDSLGRTFDVLSSTCRKDLDSYMV+SNG+FY++SSIP +AW
Sbjct: 121 STGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPGQAW 180

Query: 181 EKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVTMST 240
           EKVK+ARDSLE+LV +NI  DEE IISSCFQLASKSSLP T+S PDVLQM VDPNVTM+T
Sbjct: 181 EKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQM-VDPNVTMNT 239

Query: 241 IYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQYSV 300
           IYVPPLRRPP DDLGASIPDGD+YGTRSQIVLL+SKDST+ TFIER++YSSDEDVR+YSV
Sbjct: 240 IYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKYSV 299

Query: 301 SAPKEEKRFEFEL 313
           ++PKEEKRF+F+L
Sbjct: 300 TSPKEEKRFKFKL 312

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/313 (80%), Positives = 283/313 (90%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60
           MCILMATRAHP YELILISNRDEFL RKTHATCWHNDDFILSPYD+A+TS E Q FGTWS
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60

Query: 61  GINKEGKLATILNLKLGSERSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYDGLK 120
           GINKEGKLATILNLK+  +RS  KSKSRG+LP+ FL++H+A F+DWD Y+KF  HYDGL+
Sbjct: 61  GINKEGKLATILNLKMDDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYDGLR 120

Query: 121 ATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEKAW 180
            TGDFNFFYGDVIEK+YKVIDSLG TFDVL STCR+D DSYMVISNG+++N+SSI E+AW
Sbjct: 121 TTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISEQAW 180

Query: 181 EKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVTMST 240
           EKVK+ARDSLE L+ DNI  DEET+IS+CFQLASKSSLP T  KPD+LQMLVDPNVTM+T
Sbjct: 181 EKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVTMNT 240

Query: 241 IYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQYSV 300
           IYVPPLRRPPGDDLGASIPDGD+YGTRSQIVLL+SKDS+K TFIER++YSSDEDV  YS 
Sbjct: 241 IYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSHYSA 300

Query: 301 SAPKEEKRFEFEL 313
           SAPKEEKRFEFEL
Sbjct: 301 SAPKEEKRFEFEL 313

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/313 (79%), Positives = 280/313 (89%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60
           MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLA+TSKE Q FGTWS
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60

Query: 61  GINKEGKLATILNLKLGSERSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYDGLK 120
           GIN+EGKLATILNLKL  +R TIKSKSRGLLP+ FLS H+A+F++WD+Y KF  +YDGL 
Sbjct: 61  GINREGKLATILNLKLDGQRDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYDGLN 120

Query: 121 ATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEKAW 180
            TGDFNFFYGDVIEKQYK+IDSLGRTF+VL STC+ +L+SYM +SNG FYN+ SI E+AW
Sbjct: 121 TTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISEQAW 180

Query: 181 EKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVTMST 240
           +KVK+ARD LE LV  NI  DEETIIS+CFQLASKSS+PGT SKP+ LQML DPNV M+T
Sbjct: 181 KKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVIMNT 240

Query: 241 IYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQYSV 300
           IYVPPLRRPP DDLGASIPDGD+YGTRSQIVLL+SK+S+K TFIERI+YSSDEDV  YSV
Sbjct: 241 IYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNHYSV 300

Query: 301 SAPKEEKRFEFEL 313
           + PKEEKRFEF+L
Sbjct: 301 ATPKEEKRFEFKL 313

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  321 bits (822), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 163/326 (50%), Positives = 224/326 (68%), Gaps = 21/326 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAR--TSKEGQEFGT 58
           MCIL ATR HPDYELI+ISNRDEFL RKTH+TCWHNDDFILSPYDLAR    +    FGT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 59  WSGINKEGKLATILNLKLGSE---RSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNH 115
           W+G+N++G++AT+LNL++  E   +  I  +SRG LP++FL++ + NF+DWD+Y+KF   
Sbjct: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120

Query: 116 YDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNG-------R 168
           Y  +K TGDFN FYGD  E +Y +IDSLG T  + S   +     Y+VISN        +
Sbjct: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGK----GYLVISNNIHDKLHLQ 176

Query: 169 FYNTSSIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKP-DV 227
             + +S PE+ W K+K  +  +E+ V  N  L +E +I +CF+LAS + +   +++  D+
Sbjct: 177 SQDINSGPEE-WGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDL 235

Query: 228 LQMLVDPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERI 287
           ++ L    VT  TIYV PL  PP +++G+ +  G +YGTRSQIVLL+ K  TKATFIERI
Sbjct: 236 VKSL---GVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERI 292

Query: 288 IYSSDEDVRQYSVSAPKEEKRFEFEL 313
           IYSSD+D+  YS S PKEE R+E+++
Sbjct: 293 IYSSDQDISLYSTSNPKEELRYEYDI 318

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  317 bits (813), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 215/324 (66%), Gaps = 22/324 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSK--EGQEFGT 58
           MCIL+AT AHP YELILISNRDEF  RKTH +CWHNDDFILSP+D+A++ +  E + FGT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 59  WSGINKEGKLATILNLKLGSE---RSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNH 115
           W GIN++ K+ATILNLKL S+   +  +K +SRG++P++FLS H+++F  WD+Y KF   
Sbjct: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136

Query: 116 YDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSI 175
           Y+ L+ TGDFNFFYGD +  +Y++IDS G TF VLS       D Y+ +SN  F      
Sbjct: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSG------DPYLTVSNDMFATGGIT 190

Query: 176 PEKA-------WEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVL 228
            E+A       W K+K  +  L+DLV ++  LDE+ +I  CF+LAS  S    V   +  
Sbjct: 191 VERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCS----VQPKENT 246

Query: 229 QMLVDPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERII 288
           +   +  + M TI+VPPL     DD+G S+  G +YGTRSQIV+LISK+  +   +E I+
Sbjct: 247 KFNQNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHIL 306

Query: 289 YSSDEDVRQYSVSAPKEEKRFEFE 312
           Y+SD D++ YS + PKE K FEF+
Sbjct: 307 YTSDNDIQHYSSTNPKEVKSFEFK 330

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  309 bits (791), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 163/339 (48%), Positives = 218/339 (64%), Gaps = 35/339 (10%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSK--EGQEFGT 58
           MCIL+AT AHPDYELILISNRDEFL RKTH +CWHNDDFILSPYD+A+  K  + + FGT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 59  WSGINKEGKLATILNLKLG---SERSTIKSKSRGLLPYIFLSNH-EANFKDWDSYSKFGN 114
           W GINK+GK+AT+LNLKL    S +  +  KSRG+LP+++LS+  E +F +WD Y  F  
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120

Query: 115 HYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSS 174
            Y GL++TGDFN FYGDV  KQY+++DS+G T   L+S C+     Y+V+SN  F     
Sbjct: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQ-----YLVVSNDVFTCNGQ 175

Query: 175 IPE------------------KAWEKVKLARDSLEDLVSDNI--GLDEETIISSCFQLAS 214
           + E                  + W KVKL    L+ LV+ +I    DE+TIIS CF+L+S
Sbjct: 176 LGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSS 235

Query: 215 KSSLPGTVSKPDVLQMLVDPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLI 274
             S    V+  D  +   +  +   TI VPPLR    DD+G S+P G++YGTRSQIV+LI
Sbjct: 236 TCS----VTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILI 291

Query: 275 SKDSTKATFIERIIYSSDEDVRQYSVSAPKEEKRFEFEL 313
            + + +  F E +IY+SD D++ +S + PKE  RF+F L
Sbjct: 292 KRGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  291 bits (745), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 211/316 (66%), Gaps = 21/316 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60
           MCIL+ T AHP Y LILISNRDEF  R+TH TC H+DDFI+SP+D++ T+K G+ FGTW 
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTK-GRNFGTWC 59

Query: 61  GINKEGKLATILNLKL---GSERSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYD 117
           G+NK+GK+A ILNL++   G+ ++    +SRG++P  FL+  + +F +WDSY KF +HY 
Sbjct: 60  GVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYP 119

Query: 118 GLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPE 177
           G++ TG+FN FYGD  + +YK+I SL  T D   +      D YMV+SN    +     +
Sbjct: 120 GIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQND-----DGYMVVSNDLISS-----K 169

Query: 178 KAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVT 237
           K W K+ LA++ L +LV  ++   +++I+  CF+LAS S    T S+  V++     +VT
Sbjct: 170 KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHS----TCSEKIVVK---HESVT 222

Query: 238 MSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQ 297
             TIYVPPL    G DL  S+P G +YGTRSQIV+L+SKD  K TF+ER++Y+ DEDV +
Sbjct: 223 NETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLK 282

Query: 298 YSVSAPKEEKRFEFEL 313
           Y    PKE+  FEF++
Sbjct: 283 YGPKNPKEQIEFEFDI 298

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  287 bits (734), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 216/323 (66%), Gaps = 21/323 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQE-FGTW 59
           MCIL ATR+H +YELILISNRDE+L RKTH TCWHND+FILSPYD++R    G + FGTW
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60

Query: 60  SGINKEGKLATILNLKLGSE---RSTIKSKSRGLLPYIFLSN---HEANFKDWDSYSKFG 113
            G+NK+GK+ATILNL+  S    +  +K +SRGL+P+ FL +   +E +F++W+++ KF 
Sbjct: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120

Query: 114 NHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTS 173
           + Y  L+++GDFNFFYGD+ E  Y++IDSLG TF VL +  R      M+ISN  + +  
Sbjct: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRN-----MIISNDLYQHKD 175

Query: 174 SIPEK-AWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLV 232
               K  W K+K+  + L   + +    +E+ +++ CF+LAS  S+  ++++ +      
Sbjct: 176 EYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREE------ 229

Query: 233 DPNVTMS--TIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYS 290
           +PN  ++  TIYVPPL+  P +D+G +  +G +YGTR+QIV+L+ KD    T +E  I++
Sbjct: 230 NPNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHN 289

Query: 291 SDEDVRQYSVSAPKEEKRFEFEL 313
           SDE++ +YS   PKE +R +F +
Sbjct: 290 SDEEIYKYSGLNPKEVQRLDFTI 312

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  270 bits (690), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 144/316 (45%), Positives = 198/316 (62%), Gaps = 11/316 (3%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60
           MCIL+AT  HP Y+L+L+SNRDE+ ARK     W  D+F+L P D    S  G++ GTW 
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDS-SGEDLGTWI 59

Query: 61  GINKEGKLATILNLKLGSE---RSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYD 117
           G N++GK+ T+LNLKL S+   R  +  +SRG +P  FLS+  ANFKDWD+Y KF + + 
Sbjct: 60  GANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQ 119

Query: 118 GLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPE 177
           GL+ T DFNFFYGD     Y+VIDSLG T  VL  T  K    Y+V+SN  F   S+   
Sbjct: 120 GLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEK----YIVVSNDIFQGESN-KN 174

Query: 178 KAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVT 237
           + W+K+ LA  +L  LV +    DE+  I  CF +AS +         +     V+  ++
Sbjct: 175 RVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVE--LS 232

Query: 238 MSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQ 297
           M T++VPPL+    D LGAS+P G++YGTRSQ V+L+SKD +  T++ERII+ SD D  Q
Sbjct: 233 MQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQ 292

Query: 298 YSVSAPKEEKRFEFEL 313
           YS    KE+KR++F+L
Sbjct: 293 YSRDHYKEQKRYDFDL 308

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  257 bits (656), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 212/324 (65%), Gaps = 25/324 (7%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDF--ILSPYDLARTS-KEGQEFG 57
           MCIL+A+R HP+Y+LILISNRDEFL R+TH TCW+  ++  IL PYD+++++ K   + G
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG 60

Query: 58  TWSGINKEGKLATILNLKLG-SERSTIKS--KSRGLLPYIFLSNHEAN-FKDWDSYSKFG 113
           TW GIN+ G+++TILNLK   S +S++ S  KSRG LP  FL N E +   +WDSY KF 
Sbjct: 61  TWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKFV 120

Query: 114 NHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTS 173
             Y  +K TGDFNFFYGDV   +Y VIDS+G T +VL+       + Y+VISN +F  ++
Sbjct: 121 KEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVD-----NPYLVISNDKFGKSN 175

Query: 174 SIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKP-DVLQMLV 232
               K WEK+ LA++ L+ L    +   E+ +I  CF +AS ++L   + K  DV +++ 
Sbjct: 176 GKSTKEWEKITLAKNLLKHLP---LCETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMT 232

Query: 233 DPNVTMSTIYVPPLR---RPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIY 289
           +      TI VPPL    +   + +GAS+P G +YGTRSQIV+L++K+ TK  FIERI+Y
Sbjct: 233 E------TILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILY 286

Query: 290 SSDEDVRQYSVSAPKEEKRFEFEL 313
           +SD+DV    +S+P ++  + F +
Sbjct: 287 NSDDDVTTQKLSSPIQDLTYNFTI 310

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  256 bits (654), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 144/321 (44%), Positives = 191/321 (59%), Gaps = 25/321 (7%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60
           MCIL ATRAHPDY+LIL+SNRDEF  RKTHATCW++D FILSPYD+A   K+GQ +GTW 
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMA-IEKKGQGYGTWL 59

Query: 61  GINKEGKLATILNLK----LGSERSTIKS--KSRGLLPYIFLSNHE-ANFKDWDSYSKFG 113
           GIN+ G++A ILNLK    L SE   +    +SRG++P  FL   + A F +WDS+ KF 
Sbjct: 60  GINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119

Query: 114 NHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTS 173
             +  L+ TG F  FYGD    +Y VID L  + +            +MVISN  F+   
Sbjct: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKM------EHMVISNDIFHCAV 173

Query: 174 SIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVD 233
                 W K +     L+ L  +  G+ +E ++  CF+L S  +        DV      
Sbjct: 174 GEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFN---EGEDV------ 224

Query: 234 PNVTMSTIYVPPLRRPPG-DDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSD 292
            +VT S+IYVPPLR   G D +G S+P GD+YGTRSQIV+L+ KD+ + T+ E +IY SD
Sbjct: 225 DSVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDN-RVTYEEHVIYESD 283

Query: 293 EDVRQYSVSAPKEEKRFEFEL 313
           ED   YS   PKE  +F+F +
Sbjct: 284 EDCETYSFMDPKEVIQFQFNM 304

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  255 bits (652), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 141/323 (43%), Positives = 202/323 (62%), Gaps = 22/323 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEF--GT 58
           MCIL+ TR HPDY+L+LISNRDEF  R TH T WH+ D+ILSPYD+ +   +  +   GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 59  WSGINKEGKLATILNLKLGSE------RSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKF 112
           W G+N+ G+++T+LNLKL  E      ++ +K +SRGL+P++FLS+       WDS+ KF
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSD-RGFIDQWDSFEKF 119

Query: 113 GNHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRF--Y 170
            + Y  L+ +GDFN F GD+ ++ YKV+DS G TF VL+ T   +    MV+SN  +  +
Sbjct: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMN----MVVSNDTYKEF 175

Query: 171 NTSSIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQM 230
           N + I E  W KVKL +  L +LV+  + LD+ + I  CF  AS  S+    S  D+ + 
Sbjct: 176 NENDISE--WNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEK--SHEDISKT 231

Query: 231 LVDPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYS 290
              P V  +TI+VPPL+  P  D+G +   G ++GTRSQ+V L+SKD  + T  ERI+++
Sbjct: 232 ---PEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHT 288

Query: 291 SDEDVRQYSVSAPKEEKRFEFEL 313
           SD D    S   PKE K+F F+L
Sbjct: 289 SDLDRDFNSPHNPKEVKQFTFDL 311

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  252 bits (643), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 136/324 (41%), Positives = 203/324 (62%), Gaps = 22/324 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWH--NDDFILSPYDLARTSKEGQEFGT 58
           MCIL  TR+HPDYELILISNRDEFL RKT  +CW+  ++  +L PYDL+R   +  +FGT
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60

Query: 59  WSGINKEGKLATILNLKLGS---ERSTIKSKSRGLLPYIFLSNHEAN-FKDWDSYSKFGN 114
           W GIN+ G+++++LNLK+     E   ++ KSRG LP  FL N + N F DW+SYSKF  
Sbjct: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120

Query: 115 HYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSS 174
            Y  L+ TG FN F GDV +++Y +IDS G+T  +L     ++  S +VISN  F +   
Sbjct: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGK-DENGKSSVVISNSEFISND- 178

Query: 175 IPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTV--SKPDVLQMLV 232
             ++ W K+      +++ +S +I  DE ++I SCF++AS S L      S  D+L ++ 
Sbjct: 179 --KERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSELTNEYLHSHDDILDLMT 235

Query: 233 DPNVTMSTIYVPPLRRP---PGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIY 289
           +      T++VPP++       D++GAS+P G FYGTRSQIV+L++K+ T   ++ER++Y
Sbjct: 236 E------TVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLY 289

Query: 290 SSDEDVRQYSVSAPKEEKRFEFEL 313
             D+DV +  +  P  E  FE+ +
Sbjct: 290 ECDDDVSKAGIEKPINELNFEYNI 313

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  237 bits (604), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 124/264 (46%), Positives = 177/264 (67%), Gaps = 11/264 (4%)

Query: 53  GQEFGTWSGINKEGKLATILNLKL--GSERS-TIKSKSRGLLPYIFLSNHEANFKDWDSY 109
             +FGTW GINK+G++ T+LNLKL  G++R   +   SRG +P  FLS H+ +++ W+SY
Sbjct: 20  AHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSY 79

Query: 110 SKFGNHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRF 169
           +KF N +  L  TGDFNFFYGD    QYK+IDSL +T DVL++   +D  SYMV+SN  +
Sbjct: 80  NKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVY 139

Query: 170 YNTSSIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQ 229
                  E+ W KV+LA+ +L  L+ DN+  D+++ IS CFQ+AS S  PG   + +  +
Sbjct: 140 RYQG---EETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTS--PGLDWQSE--E 192

Query: 230 MLVDPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIY 289
           +L   +VT  +I+VPPL+ PP  +LG +   G FYGTRSQIVLL+SKD  K TF+ER+++
Sbjct: 193 LLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLH 251

Query: 290 SSDEDVRQYSVSAPKEEKRFEFEL 313
           +SDE V Q S   P E+ +F+F+L
Sbjct: 252 NSDEQVSQRSPDHPAEQLKFQFDL 275

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  228 bits (581), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 123/308 (39%), Positives = 180/308 (58%), Gaps = 23/308 (7%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60
           MCIL+A+ AHP Y LILISNRDEF+ R+T  TC ++DD+++SP D+          GTW 
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60

Query: 61  GINKEGKLATILNLKLGSERSTIKSK--SRGLLPYIFLSNHEANFKDWDSYSKFGNHYDG 118
           G N+ G++A ILNL+ G+   T   +  SRG +   +L++ +    DW+SY+KF +    
Sbjct: 61  GANRNGRIAVILNLRTGNTNQTKTKRIVSRGNVTMRYLTDKQP-ASDWNSYAKFASKCPD 119

Query: 119 LKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEK 178
           +K+  +FN FYGD     Y  IDS G +F+VL S      + Y+VISN    + +     
Sbjct: 120 IKSC-EFNMFYGDCKSGDYTAIDSSGHSFEVLRSQ-----NPYLVISNDSIESATK---- 169

Query: 179 AWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDV-LQMLVDPNVT 237
            W K++LA   + DLV D++   E+ +++ CF LAS         K D  +  +    VT
Sbjct: 170 -WPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH--------KQDYNVDHMDKEKVT 220

Query: 238 MSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQ 297
            S I+VPPL  P  +DLGAS+P G FYGTRSQIV+L+SK+     F+E ++Y SD +   
Sbjct: 221 SSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTH 280

Query: 298 YSVSAPKE 305
           +  + PK+
Sbjct: 281 FCAANPKK 288

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  217 bits (552), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 127/316 (40%), Positives = 183/316 (57%), Gaps = 22/316 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60
           MCILMA+ AHP Y LI ISNRDEF  RKT  TC ++DD+ILSP D A  S      GTW 
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60

Query: 61  GINKEGKLATILNL--KLGSERSTIKSK-SRGLLPYIFLSNHEANFKDWDSYSKFGNHYD 117
           G+N++G++A ILNL  K  ++R  +KS  SRG +P  +L +   +  DW+S+ KF + Y 
Sbjct: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPS-TDWNSFEKFVSKYP 119

Query: 118 GLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPE 177
            +    +FN FYGD I  +Y  IDSLG + + L++         +V+SN    ++S    
Sbjct: 120 QITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTAN-----KPNLVLSNDHIDSSSR--- 170

Query: 178 KAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVT 237
             W KV+ A   L++LV  +    EE +I  CF LAS +  P  +   D  +       T
Sbjct: 171 --WPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTE-PAEIDNSDKEEF------T 221

Query: 238 MSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQ 297
            S+I++PP+  P   D+GAS+P G FYGTRSQIV+L+ +     +F ER+++ SD +V  
Sbjct: 222 CSSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPL 281

Query: 298 YSVSAPKEEKRFEFEL 313
           +S   PKE+ +F   +
Sbjct: 282 HSEKHPKEKLQFNLHV 297

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  207 bits (528), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 122/323 (37%), Positives = 176/323 (54%), Gaps = 23/323 (7%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLART------SKEGQ 54
           MCIL+AT  HPDY+LILISNRDEF  R+TH TCWH D  IL+PYD++ +      SK   
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 55  EFGTWSGINKEGKLATILNLKLGSER---STIKSKSRGLLPYIFLSN-HEANFKDWDSYS 110
            +GTW GIN+ G ++ +LNLK  SE         KSRG +   FL +    N+  W++Y 
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120

Query: 111 KFGNHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFY 170
           KF  H+  L  T  F  FYGD+    + +IDS  R+ +  SS        Y+VISN R  
Sbjct: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSK-----QPYVVISNSRVN 175

Query: 171 NTSSIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQM 230
                P   W+KV      L++LV  N+ + +E ++  CF+LA  S          V+Q 
Sbjct: 176 CEDEGPR--WKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQF----DVNGVIQ- 228

Query: 231 LVDPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYS 290
           + D ++   TI+VP L+      +G S   G++YGTR+ IV+L+  +    T  E +I+ 
Sbjct: 229 VTDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHD 287

Query: 291 SDEDVRQYSVSAPKEEKRFEFEL 313
           SD+D+   S   PK +  +EF++
Sbjct: 288 SDKDIGLSSAMNPKTKVAYEFDI 310

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  206 bits (523), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 177/321 (55%), Gaps = 23/321 (7%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEF---- 56
           MCIL AT AHP Y+L+LISNRDE+ ARKTH TCW ++D IL+PYD+A    +G +     
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 57  GTWSGINKEGKLATILNLK---LGSERSTIKSKSRGLLPYIFLSNHEANFKD-WDSYSKF 112
           GTW GIN+ G ++ +LNL       +       SRG +   +L + + N  D W++Y KF
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120

Query: 113 GNHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNT 172
           G H+  L  T  F  FYGDV+  Q+ VI+SLG+T D  S +       Y V+SNG     
Sbjct: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQS------PYYVVSNGPSDGA 174

Query: 173 SSIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLV 232
            ++ +  W KV       + ++ +++ + EE ++  CF LAS S     VS   +   + 
Sbjct: 175 KALGQ--WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQY---VSNQPI--GVH 227

Query: 233 DPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSD 292
           D ++   TI+VP L    G     S   G +YGTRS IV+L+S+D    T  E +I+ SD
Sbjct: 228 DDSIPKRTIFVPALYNLSG-QANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSD 285

Query: 293 EDVRQYSVSAPKEEKRFEFEL 313
           +D+  YS+  PKE+    F L
Sbjct: 286 QDLDSYSILNPKEQVTHRFSL 306

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  195 bits (496), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 119/323 (36%), Positives = 178/323 (55%), Gaps = 39/323 (12%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAR-TSKEG------ 53
           MCIL+ T AHP Y+LILISNRDE   R+TH+TCW+++  IL PYD+++    +G      
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 54  -QEFGTWSGINKEGKLATILNLKLGSERSTIKS------KSRGLLPYIFLSNHEANFKDW 106
             E GTW G+NK+GK+ T+LNL L  E +          +SRGL+P  +L + +  F+DW
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNL-LKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDW 119

Query: 107 DSYSKFGNHYDGLKA-TGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVIS 165
           ++Y KF      +    G FN F GD+   +Y +I+S+G++  VL        + YMV+S
Sbjct: 120 NTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEE-----NPYMVVS 174

Query: 166 NGRFYNTSSIPEKAWEKVKLARDSLEDLVS---DNIGLDEETIISSCFQLASKSSLPGTV 222
           N  + +   + E  W K+K     LE L++   DN   DE  I+  CFQ++S  +L G  
Sbjct: 175 NINWGDPKKMGE--WSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKK 232

Query: 223 SKPDVLQMLVDPNVTMSTIYVPPLRRPPGD---------DLGASIPDGDFYGTRSQIVLL 273
              ++ ++      T   I+VPPL+R  G+            A      +YGTRSQIV+L
Sbjct: 233 IDGNIERL----EQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVL 288

Query: 274 ISKDSTKATFIERIIYSSDEDVR 296
             + S K TF+ERI++  +ED +
Sbjct: 289 CERKSNKVTFVERILHCKNEDAK 311

>Skud_7.611 Chr7 (1021279..1023060) [1782 bp, 593 aa] {ON} YGR278W
           (REAL)
          Length = 593

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 21  RDEFLARKTHATCWHNDDFILSPYDLARTSKEGQE 55
           R E ++R+TH   W    +IL   DL+RT +EG E
Sbjct: 177 RLEVVSRRTHNMIWEKLRYILQTQDLSRTLREGLE 211

>Suva_10.335 Chr10 (584112..586739) [2628 bp, 875 aa] {ON} YLR240W
           (REAL)
          Length = 875

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 46/116 (39%), Gaps = 36/116 (31%)

Query: 36  NDDFILSPYDLARTSKEGQEFGTWSGINKEGKLATILNLKLGSERSTIKSKSRGLLPYIF 95
           N D  L+PY +  T  +            EG +  I N  L S    I SK  G+LPY+ 
Sbjct: 650 NVDLKLTPYKILATGPQ------------EGAIEFIPNDTLAS----ILSKHHGILPYLK 693

Query: 96  L----SNHEANFKDW--DSYSK-----------FG---NHYDGLKATGDFNFFYGD 131
           L     N E   +DW  D++ K            G    H D L  T D +FF+ D
Sbjct: 694 LHYPDKNTELGVQDWVLDNFVKSCAGYCVITYILGVGDRHLDNLLVTPDGHFFHAD 749

>KLTH0C02156g Chr3 complement(193918..196374) [2457 bp, 818 aa] {ON}
           weakly similar to uniprot|P40355 Saccharomyces
           cerevisiae YJR061W Hypothetical ORF
          Length = 818

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 5/95 (5%)

Query: 103 FKDWDSYSKFGNHYDGLKATGDFNFFYGDVIE-KQYKVIDSLGRTFDVLSSTCRKDLDSY 161
           FK +   S   NH D  +   D  FF G V + K+ + ++SL RT+  L  T  ++L S+
Sbjct: 360 FKYFYESSSIQNHPDNFQNHMDIRFFSGWVPKWKRLRTLNSLMRTW--LDFTKSENLTSW 417

Query: 162 MVIS--NGRFYNTSSIPEKAWEKVKLARDSLEDLV 194
           +  S  +   Y+ S  P  A + V++    L  L 
Sbjct: 418 LAHSSLHAYLYSGSQFPWAASQNVQMPIQDLHKLA 452

>KLLA0D15180g Chr4 (1284273..1291412) [7140 bp, 2379 aa] {ON} weakly
           similar to uniprot|Q06116 Saccharomyces cerevisiae
           YPR117W Hypothetical ORF
          Length = 2379

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 70/169 (41%), Gaps = 34/169 (20%)

Query: 134 EKQYKVIDSLGRTFDVLSSTCRK---DLDSYMVISNGRFYNTSSIPEKAWEKVKLARDSL 190
           EK + V D  G   D ++ST      +LD  +VI        S  P +  E ++ ++ + 
Sbjct: 463 EKWHFVCDRYGSNPDTVASTLHNIQVNLDELVVIDGLLKVVKSFTPAEPKETLQPSQGTN 522

Query: 191 EDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVTMSTIYVPPLRRPP 250
               S  + ++ + +   CF L++K  LP  +           PN+  S +   PLR   
Sbjct: 523 HRFSSYQLQIEAKGL---CFTLSAKDYLPSNM-----------PNIDHSIV---PLR--- 562

Query: 251 GDDLGASIPDGDF-YGTR-SQIVLLISKDSTKATFIERIIYSSDEDVRQ 297
                    DG +  G    Q  +L+S +S+ ATF E  +Y S  D  +
Sbjct: 563 ---------DGTYKIGLEVDQSHMLLSGNSSHATFTELRLYKSSSDFEK 602

>YOL076W Chr15 (187024..189414) [2391 bp, 796 aa] {ON}
           MDM20Non-catalytic subunit of the NatB N-terminal
           acetyltransferase, which catalyzes N-acetylation of
           proteins with specific N-terminal sequences; involved in
           mitochondrial inheritance and actin assembly
          Length = 796

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 9/74 (12%)

Query: 126 NFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEKAWEKVKL 185
           N +  + I K  K+++S  + F+V S    K LD Y +I+N        + + A+ K+  
Sbjct: 229 NLYLKNFILKHTKLLNSPQKLFEVCSKLIEKGLDDYELITN--------LIDAAY-KLSK 279

Query: 186 ARDSLEDLVSDNIG 199
           ++D ++  + +N+G
Sbjct: 280 SKDEVKQWIDENLG 293

>TBLA0G00730 Chr7 complement(165589..167994) [2406 bp, 801 aa] {ON} 
          Length = 801

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 22  DEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWSGINKEGKLATILNLKLGSERS 81
           +E+   K+  T   ++++++SP+  AR+  E  E  +W   +  G L  I +LK+   RS
Sbjct: 514 EEYFTNKSAFTL--SEEYLISPFLTARSYLEHFEITSWISSDIGGSLTNISDLKIFLSRS 571

Query: 82  T 82
           T
Sbjct: 572 T 572

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,217,075
Number of extensions: 1580270
Number of successful extensions: 4470
Number of sequences better than 10.0: 47
Number of HSP's gapped: 4517
Number of HSP's successfully gapped: 47
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)