Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2223.486ON23023010621e-148
YGR126W3.486ON2302309651e-133
Skud_7.4373.486ON2302309251e-127
Suva_7.4143.486ON2302308991e-123
NCAS0E008503.486ON2302305033e-63
CAGL0I10604g3.486ON2112304875e-61
NDAI0G009803.486ON2342284279e-52
KAFR0C019203.486ON2232404085e-49
TDEL0D055403.486ON2162464023e-48
KNAG0B008503.486ON2252344016e-48
KLTH0F14696g3.486ON2191553363e-38
SAKL0F02904g3.486ON2221513172e-35
Kwal_55.212153.486ON1421442982e-33
TPHA0D032503.486ON2192322352e-23
Kpol_1017.103.486ON2342372242e-21
KLLA0E04709g3.486ON1661492165e-21
KLTH0G02266g3.503ON644671482e-10
Kwal_47.189193.503ON640671456e-10
KLLA0E03829g3.503ON609671421e-09
KAFR0C020303.503ON624671412e-09
AFR322C3.503ON592801393e-09
TDEL0D057103.503ON616991314e-08
KNAG0B007303.503ON622821296e-08
CAGL0I10384g3.503ON630671296e-08
TBLA0D029003.503ON6911061271e-07
Skud_16.4503.503ON622861261e-07
NDAI0I027703.503ON626911252e-07
Smik_16.4083.503ON622861252e-07
YPR156C (TPO3)3.503ON622671252e-07
Skud_7.4483.503ON611811243e-07
YGR138C (TPO2)3.503ON614811243e-07
NCAS0F036203.503ON634671233e-07
Suva_7.4253.503ON613811216e-07
NCAS0E007503.503ON620671216e-07
Smik_6.2333.503ON614811216e-07
Suva_16.4843.503ON622671201e-06
TPHA0D033103.503ON613671201e-06
SAKL0F02442g3.503ON610671191e-06
ZYRO0G19646g3.503ON594821137e-06
Kpol_1017.33.503ON621821128e-06
ZYRO0D08998g6.308ON842106850.027
KAFR0L011007.271ON61874701.7
Skud_10.3624.373ON1581111702.2
Kpol_1000.244.373ON158072692.7
Kpol_1025.28.228ON150773674.2
ZYRO0F14036g8.350ON28060655.7
Suva_12.2304.373ON1581111667.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.222
         (230 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...   413   e-148
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...   376   e-133
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...   360   e-127
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...   350   e-123
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...   198   3e-63
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...   192   5e-61
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...   169   9e-52
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...   161   5e-49
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....   159   3e-48
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...   159   6e-48
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...   134   3e-38
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...   126   2e-35
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...   119   2e-33
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...    95   2e-23
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...    91   2e-21
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    88   5e-21
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    62   2e-10
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    60   6e-10
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    59   1e-09
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    59   2e-09
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    58   3e-09
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    55   4e-08
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    54   6e-08
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    54   6e-08
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    54   1e-07
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    53   1e-07
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     53   2e-07
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    53   2e-07
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    53   2e-07
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    52   3e-07
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    52   3e-07
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    52   3e-07
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    51   6e-07
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               51   6e-07
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    51   6e-07
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    51   1e-06
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    51   1e-06
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    50   1e-06
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    48   7e-06
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    48   8e-06
ZYRO0D08998g Chr4 (771821..774349) [2529 bp, 842 aa] {ON} simila...    37   0.027
KAFR0L01100 Chr12 (206906..208762) [1857 bp, 618 aa] {ON} Anc_7....    32   1.7  
Skud_10.362 Chr10 (643130..647875) [4746 bp, 1581 aa] {ON} YJR13...    32   2.2  
Kpol_1000.24 s1000 complement(56352..59846,59848..61095) [4743 b...    31   2.7  
Kpol_1025.2 s1025 complement(4571..9094) [4524 bp, 1507 aa] {ON}...    30   4.2  
ZYRO0F14036g Chr6 (1153919..1154761) [843 bp, 280 aa] {ON} conse...    30   5.7  
Suva_12.230 Chr12 (364040..368785) [4746 bp, 1581 aa] {ON} YJR13...    30   7.0  

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  413 bits (1062), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 217/230 (94%), Positives = 217/230 (94%)

Query: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDD 60
           MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDD
Sbjct: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDD 60

Query: 61  ILDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALP 120
           ILDDQ             TLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALP
Sbjct: 61  ILDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALP 120

Query: 121 DITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHST 180
           DITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHST
Sbjct: 121 DITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHST 180

Query: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230
           RSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD
Sbjct: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score =  376 bits (965), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 197/230 (85%), Positives = 208/230 (90%)

Query: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDD 60
           MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDS+ P+QPL+KNDTIVGKGQ E+D 
Sbjct: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDS 60

Query: 61  ILDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALP 120
            +DDQ             TLKRPTSNSIEKMVT NALEG SET+DSLKEDGLNL KKALP
Sbjct: 61  NVDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALP 120

Query: 121 DITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHST 180
           DITAPVTNSAHDA FPEEYRLETETGLVKLKTLE+L+REDSRVSSTKKEH NDHTD+HST
Sbjct: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHST 180

Query: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230
           RSKVTTNSQGSSLEPNKLNMAVEKNKK+IE+YQKHKSEKGIKGFFHRIFD
Sbjct: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  360 bits (925), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/230 (81%), Positives = 201/230 (87%)

Query: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDD 60
           MPVPSV+VTTDNEYEDISSFSSIDSYKPEPFTGFKDSQ P+QPL+KNDTIVGK QSEN++
Sbjct: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 60

Query: 61  ILDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALP 120
            +D+Q             TLKRP+SNSIEKM+T NALEG SET DSLK +GLNL KKALP
Sbjct: 61  NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 120

Query: 121 DITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHST 180
           DITAPVTNSAH+  FPEEYRLETETGLVKLKTLETL+REDSRVSS KKEH NDH D HST
Sbjct: 121 DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 180

Query: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230
           RSKVTT SQGSSLE +KLNMAVEKNKKKIEQY+KHKSEKGIKGFFHRIFD
Sbjct: 181 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  350 bits (899), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 198/230 (86%)

Query: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDD 60
           M VP+V+VTTDNEYEDISSFSSIDSYKPEPFTGFKDSQ P+QPL+KNDTIVGKGQSENDD
Sbjct: 1   MAVPTVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKGQSENDD 60

Query: 61  ILDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALP 120
            +DDQ             TLKRPTSNSIEKMVT NALEG SET+DSLK++GLNL KK  P
Sbjct: 61  SVDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTP 120

Query: 121 DITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHST 180
           DITAPVTNSAHDA FPEEYRLETETGLVKLKTLETL+REDSRVS  KK+H +DHTD HST
Sbjct: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLETLKREDSRVSGAKKDHGHDHTDAHST 180

Query: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230
           RSK T  SQGSSLE +KLN+AVEKNKK+IE+YQKHK EKGIKG FHR+FD
Sbjct: 181 RSKATAYSQGSSLESDKLNIAVEKNKKRIEKYQKHKGEKGIKGLFHRMFD 230

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score =  198 bits (503), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 151/230 (65%), Gaps = 12/230 (5%)

Query: 7   TVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGK----GQSENDDIL 62
           T +T++++ED+SSFSSIDSY+PEPFTG K+     +   + DT+ G      Q   +   
Sbjct: 7   TTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTAY-KGTDRKDTLSGDETELKQEHTNATA 65

Query: 63  DDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDI 122
                           TL+RP SN+IE+++T NA EG +ETL SL   GL+L KKA  DI
Sbjct: 66  TSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDI 125

Query: 123 TAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHSTRS 182
            AP+T++  D  FPEEY LETETGLVK KT+ETLRRE SRVSST++       D+ S +S
Sbjct: 126 NAPLTSNPADVAFPEEYNLETETGLVKAKTIETLRRETSRVSSTRR-----GDDVVSHKS 180

Query: 183 KVTTNSQGS--SLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230
           + T  SQ S  SL+  KLN+AVEKNKK++E+ +KHK +KG+KGF +R+FD
Sbjct: 181 QATGKSQRSAQSLQAEKLNLAVEKNKKELEKIEKHKHQKGLKGFMNRLFD 230

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score =  192 bits (487), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 151/230 (65%), Gaps = 19/230 (8%)

Query: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDD 60
           M     T  TD E EDISSFSS+DSYKPEPFTG + ++  ++ L +  T   +G      
Sbjct: 1   MSYNGTTSDTDYEVEDISSFSSVDSYKPEPFTGLEHTK--NENLSRKATNASQGT----- 53

Query: 61  ILDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALP 120
            +DD              TLK+  S +IEK+VTQNA+ G SET++SLK  GL++++KA+P
Sbjct: 54  YMDD------ATSKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIP 107

Query: 121 DITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHST 180
           D  AP+T +  +  FPEEYRLET+TGLVK+KTLETL+R+ ++VS      N+D +    +
Sbjct: 108 DYNAPLTTTGTNQ-FPEEYRLETDTGLVKMKTLETLKRKSTQVS-----RNSDLSSKDKS 161

Query: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230
            SK  +N    S    K+NMAVE+NKK+I +YQKHKSEKGIKGFFHR+FD
Sbjct: 162 ISKSQSNKSEVSDIAQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score =  169 bits (427), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 113/228 (49%), Positives = 150/228 (65%), Gaps = 13/228 (5%)

Query: 10  TDNEYEDISSFSSIDSYKPEPFTGFKDSQLPD-QPLMKNDTIVGKGQSENDDILDDQXXX 68
           TDNE++DISSFSSIDSY+PEPFTG K ++LP+ QP   + T     Q  +D ++      
Sbjct: 13  TDNEFDDISSFSSIDSYQPEPFTGLKGNELPNAQP---STTATTTEQDHDDTVISSHSHD 69

Query: 69  XXXX---XXXXXXTLKRPTSN--SIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDIT 123
                        TLK+  SN   IEK +T N +   +ETLDSL + GLN +KK++ DI 
Sbjct: 70  TKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADIN 129

Query: 124 APVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHSTRSK 183
            P+  +A  A FPEEYR+ETETGLVK KT+E+LRR++S ++S     + D     S R+ 
Sbjct: 130 TPL--NAGTAEFPEEYRIETETGLVKAKTIESLRRQES-IASANSRRSQDQGSFKSARTN 186

Query: 184 VTTNSQG-SSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230
            T  S+  SSL+PNKLNMAVEKNKK++E+Y KHK +KGIKGFF+R+FD
Sbjct: 187 NTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score =  161 bits (408), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 95/240 (39%), Positives = 141/240 (58%), Gaps = 34/240 (14%)

Query: 8   VTTDNEYEDISSFSSIDSYKPEPFTG----------------FKDSQLPDQPLMKNDTIV 51
           ++ + + EDISSFSSI+SYKPEPF G                 KD+Q       + + + 
Sbjct: 1   MSIEQDVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVD 60

Query: 52  GKGQSENDDILDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDG 111
              Q + +D                   LK+  S  IE++VTQNA+ G +ET+DSL+  G
Sbjct: 61  PLKQVQTNDSFWS-FRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATG 119

Query: 112 LNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKE-H 170
           L+L K+A+PDI +P+   +H++   +E + ET+TGL+K KTLETL R ++R SS+K++  
Sbjct: 120 LDLTKRAVPDINSPI---SHESKLIDESKFETDTGLIKTKTLETLNRSNTRNSSSKRKIL 176

Query: 171 NNDHTDIHSTRSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230
            ND             NS  S L+P ++NM VE+N+KK+E+YQ+HK EKG+KGFF++IFD
Sbjct: 177 GND-------------NSNTSGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score =  159 bits (402), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 134/246 (54%), Gaps = 49/246 (19%)

Query: 3   VPSVTVTTD---NEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSEND 59
            P  T   D   N+++++SSFSSIDSY+P+PFTG    +LP              Q +N 
Sbjct: 2   APGTTTKLDDASNQFDEVSSFSSIDSYQPQPFTG--QEELP--------------QEKNP 45

Query: 60  DILDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKAL 119
           D                  TL    SN+IEK VT NA+ GTSET  SL++ GL+ +KKA+
Sbjct: 46  D-------SSSRRSSKSGTTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAI 98

Query: 120 PDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHS 179
           PDI  P+T +A  + FPEEYR+ET+TGLVKLKTL  L R D+RVS          +D   
Sbjct: 99  PDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIG--------SDGKI 150

Query: 180 TRSKVTTNSQGSSLEPN---------------KLNMAVEKNKKKIEQYQKHKSEKGIKGF 224
           +R      +  S +EP                 L  A+EKNK +IE+++KH+ EKG+KGF
Sbjct: 151 SRKSSGPGTIDSKIEPKPDTAKAEQEAAQNAENLEHAIEKNKHRIEKFEKHRHEKGLKGF 210

Query: 225 FHRIFD 230
            HR+FD
Sbjct: 211 VHRLFD 216

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score =  159 bits (401), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 98/234 (41%), Positives = 148/234 (63%), Gaps = 28/234 (11%)

Query: 8   VTTDNEYEDISSFSSIDSYKPEPFTGFK-DSQLPDQPLMKNDTIVGKGQSENDDILDDQX 66
           + TD E++++SSFSS+DSYKPEPF GF  + +  D  L KNDTI+      ++D+ ++  
Sbjct: 7   IVTDPEFDEVSSFSSVDSYKPEPFVGFGTEEEQHDSRLFKNDTILN-----SEDLAENTA 61

Query: 67  XX-XXXXXXXXXXTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNL-KKKALPDITA 124
                        TL +  SN+IE++VT+NA+   SE+ D+L+  GL+  K++ +PDI A
Sbjct: 62  NTPSDLNSKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINA 121

Query: 125 PVT-NSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHSTRSK 183
           P+T   +H   FPEEY++ETETGLVK+KT+E+L+   S  +     HN+  +   STRSK
Sbjct: 122 PLTLTQSH---FPEEYQVETETGLVKMKTIESLKSRHSGGT-----HNSKKSKGASTRSK 173

Query: 184 VTTNSQGSSLE--------PNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIF 229
              NS  SS+E          KLN AVE+N+K++E+Y+K++ +KGIKGF  ++F
Sbjct: 174 ---NSLTSSMEEHGEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score =  134 bits (336), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 107/155 (69%), Gaps = 4/155 (2%)

Query: 79  TLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEE 138
           TL++  SN+IE+++T NA EG SET++SLK++GLNL+KKA+PDI  P  N   +  FPEE
Sbjct: 66  TLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAAN-YKNCAFPEE 124

Query: 139 YRLETETGLVKLKTLETLRREDSRVS--STKKEHNNDHTDIHSTRSKV-TTNSQGSSLEP 195
           Y++ET+TGLVK +TL  L R +SR S  S   +  +  T   +T S + + N+  + L+ 
Sbjct: 125 YQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTINGLDG 184

Query: 196 NKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230
            KL  AVEKN+KKI++YQKHKS  G++ F  +IFD
Sbjct: 185 EKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score =  126 bits (317), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 78/151 (51%), Positives = 105/151 (69%), Gaps = 5/151 (3%)

Query: 79  TLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEE 138
           TLK+  SN+IEK++T NA+EG +ETL+SLK  GL+L+KKA+PD   P  ++   + FPEE
Sbjct: 76  TLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDR-SQFPEE 134

Query: 139 YRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHSTRSKVTTNSQGSSLEPNKL 198
           Y++ETETGLVK+KTL++L R D+RVS   K   N + +  S   +     +    +  KL
Sbjct: 135 YQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDE----QRPVGYDEEKL 190

Query: 199 NMAVEKNKKKIEQYQKHKSEKGIKGFFHRIF 229
             AV+KNKKKIE+YQKHK EKGIKGF  R+F
Sbjct: 191 KKAVDKNKKKIEKYQKHKHEKGIKGFMSRLF 221

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score =  119 bits (298), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 93/144 (64%), Gaps = 7/144 (4%)

Query: 92  VTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLK 151
           +T NA EG SET+DSL+ +GLN+ +KA+PD   P  N   +  FPEEY+LET+TGLVK++
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKAVPDYNNPAANFT-NCEFPEEYQLETDTGLVKVQ 59

Query: 152 TLETLRREDSRVS-----STKKEHNNDHTDIHSTRSKVTTNSQGSSLEPNKLNMAVEKNK 206
           TL+ L R +SR S     S +K   +  +  HS  S     S  S L+  KL  AVEKNK
Sbjct: 60  TLQKLNRLESRTSIRSGNSQRKSMRSTPSTDHSI-SPSAGRSSNSGLDAEKLRKAVEKNK 118

Query: 207 KKIEQYQKHKSEKGIKGFFHRIFD 230
           ++I++YQKHK+  G+K F  +IFD
Sbjct: 119 RQIDKYQKHKASGGLKKFLGKIFD 142

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score = 95.1 bits (235), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/232 (32%), Positives = 122/232 (52%), Gaps = 34/232 (14%)

Query: 9   TTDNE-YEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDDILD--DQ 65
           TTD+E ++D+SSF+S +SY P+ F G              DT+  +  ++ DD       
Sbjct: 10  TTDSENFDDVSSFNSDNSYTPQEFIG--------------DTLGKESSTKMDDRASHLSH 55

Query: 66  XXXXXXXXXXXXXTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAP 125
                        T+K  TSN + ++V++N ++   E+ ++LK    N++ +   DI  P
Sbjct: 56  AIKETRSGTSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADIILP 114

Query: 126 VTNSAHDATFPEEYRLETETGLVKLKTLETLRR------EDSRVSSTKKEHNNDHTDIHS 179
            +    ++ FPEEY +ET TGLV +KTLE +++      E+SR S    E       + +
Sbjct: 115 ASMEG-NSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSE-------LKA 166

Query: 180 TRSKVTTNSQG-SSLEPNKLNMAVEKNKKKIEQYQKHKSEKG-IKGFFHRIF 229
           ++S  T  S+    L P KLN AVEKNK+++E+YQ HK+EK  IK    ++F
Sbjct: 167 SKSNNTVKSRNEGGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score = 90.9 bits (224), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 113/237 (47%), Gaps = 43/237 (18%)

Query: 14  YEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDDILDDQXXXXXXXX 73
           +EDISSF S +S+ P+ F G  DS   +   + N T  G  ++                 
Sbjct: 18  FEDISSFDSQNSFAPQEFKGNLDSNNDNDTGVFNKTKSGTSET----------------- 60

Query: 74  XXXXXTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDA 133
                TLK  +SN IEK+VT+NALE  +ET+ +L+E    L K    ++  P T   ++A
Sbjct: 61  ----NTLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENV-LPAT-MENNA 114

Query: 134 TFPEEYRLETETGLVKLKTLETLRREDSR-------------------VSSTKKEHNNDH 174
            FPEEYR+ET+TGLV +KTLE +    S                          E N++ 
Sbjct: 115 AFPEEYRIETKTGLVPIKTLEEMHSNKSNGKNEENEHHNHQHNHHNHHNHHHHHEKNDED 174

Query: 175 TDIHSTRSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKG-IKGFFHRIFD 230
            D+         +     LE   +++ VE+NKK++E++++HK E   +K F ++  D
Sbjct: 175 KDVEQKEKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 87.8 bits (216), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 83/149 (55%), Gaps = 18/149 (12%)

Query: 81  KRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYR 140
           K  T+  +E  V  N  +G ++++DSLK   L+L KKA+P    P+   A  A FPEEY 
Sbjct: 35  KISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPI---AEGAEFPEEYE 91

Query: 141 LETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHSTRSKVTTNSQGSSLEPNKLNM 200
           +ET TGLVK+ TL  L R D+RV++        H+   ST+ K T+       + +KL  
Sbjct: 92  IETRTGLVKVATLHQLNRLDTRVTT--------HSSKKSTKEKNTS----CGYDNDKLQK 139

Query: 201 AVEKNKKKIEQYQKHKSEKGIKGFFHRIF 229
            +E+N+K+I+ Y K   + G K F  ++F
Sbjct: 140 CIERNQKEIDSYHK---KSGFKKFIGKLF 165

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 43/67 (64%), Gaps = 1/67 (1%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL++ G+   +  LPD+ AP T     A FPEEY LET TGLV + TL++L R  
Sbjct: 57  TETVKSLQDMGVT-PEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVATLQSLGRTQ 115

Query: 161 SRVSSTK 167
           S VS T+
Sbjct: 116 SAVSRTR 122

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (65%), Gaps = 1/67 (1%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL+E G+   +  LPD+ AP   ++  A FPEEY LET TGLV + TL++L R  
Sbjct: 51  TETVKSLQEMGVT-PEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATLQSLGRTT 109

Query: 161 SRVSSTK 167
           S V+ T+
Sbjct: 110 SGVTRTR 116

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 1/67 (1%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET  SL++ GL   +  +PD  AP T+ A +A FPEEY LET TGLV + TL +L R  
Sbjct: 48  TETAKSLQDMGLT-SEVPIPDFNAPTTSVAKNAIFPEEYTLETATGLVPVATLHSLGRTP 106

Query: 161 SRVSSTK 167
           + +S T+
Sbjct: 107 TAISRTR 113

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL++ G+N    A+PD+ AP +N   +A FPEEY +ET TGLV + TL++L R  
Sbjct: 52  TETVKSLQDMGMN-ATPAVPDVNAPQSN--RNAIFPEEYTIETTTGLVPVATLQSLGRTS 108

Query: 161 SRVSSTK 167
           + +S T+
Sbjct: 109 TAISRTR 115

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (62%), Gaps = 7/80 (8%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL+E GL+  +K +PD+ AP T++     FPEEY LET TGLVK+ TL +L R  
Sbjct: 45  TETVKSLQEMGLS-SEKPIPDVNAPSTSAG--VIFPEEYTLETPTGLVKIATLVSLGRTG 101

Query: 161 SRV----SSTKKEHNNDHTD 176
           S V    S T+ E++   T 
Sbjct: 102 SAVPRGGSGTEPENDKGETG 121

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 56/99 (56%), Gaps = 6/99 (6%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL+E G+      +PD+ AP T +A    FPEEY +ET TGLV + TL+++ R  
Sbjct: 45  TETVKSLQEMGMT-ATAPVPDVNAPQT-TARPQIFPEEYTMETPTGLVPVATLQSIGRTS 102

Query: 161 SRVSSTKKEH----NNDHTDIHSTRSKVTTNSQGSSLEP 195
           + +S ++       +++ + +  T S    N +G + EP
Sbjct: 103 TAISRSRTRQMERTSSESSSMDGTNSDAEINKEGKASEP 141

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL++ G+  K   +PD+ AP T +   A FPEEY +ET TGLV + TL+++ R  
Sbjct: 51  TETVKSLQDMGMT-KNAPIPDVNAPQT-AKKTAIFPEEYTMETPTGLVPVATLQSIGRTA 108

Query: 161 SRVSSTKKEHNNDHTDIHSTRS 182
           + +S T+    +    + S+ S
Sbjct: 109 TSISRTRTRQMDRSISMRSSHS 130

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 45/67 (67%), Gaps = 2/67 (2%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL+E G+  +   +PD+ AP T +  +A FPEEY +ET TGLV + TL++L R  
Sbjct: 51  TETVKSLQEMGMT-QDAPIPDVNAPQTTT-KNAIFPEEYTMETPTGLVPVATLQSLGRTS 108

Query: 161 SRVSSTK 167
           + +S ++
Sbjct: 109 TAISKSR 115

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 5/106 (4%)

Query: 83  PTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLE 142
           PT+ S      Q      +ET+ SL + G++      P I AP T+    A FPEEY LE
Sbjct: 53  PTNRSSNASTNQRLKLVKTETVKSLIDMGVS-SYIPNPAINAPKTSK--KAIFPEEYTLE 109

Query: 143 TETGLVKLKTLETLRREDSRVSSTKKEH--NNDHTDIHSTRSKVTT 186
           TETGLV + TL +L R ++ +S  +  H  +  +T I S+    TT
Sbjct: 110 TETGLVPVSTLHSLGRTNTNLSRQRTRHTLSRRNTRIASSAQHDTT 155

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (61%), Gaps = 4/86 (4%)

Query: 83  PTSNSIEKMVTQNALEGT-SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRL 141
           P+ N  +  +  N L+ T +ET+ SL++ G++  K  +PD+ AP   S+ +  FPEEY L
Sbjct: 31  PSENGSKSNMAPNQLKLTRTETVKSLQDMGVS-SKAPIPDVNAP--QSSKNKIFPEEYTL 87

Query: 142 ETETGLVKLKTLETLRREDSRVSSTK 167
           ET TGLV + TL ++ R  + +S T+
Sbjct: 88  ETPTGLVPVATLHSIGRTSTAISRTR 113

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 56/91 (61%), Gaps = 7/91 (7%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ +L++ G+  +   +PD+ AP T SA +  FPEEY +ET TGLV + TL++L R  
Sbjct: 52  TETVKTLQDLGVT-RDAPVPDVNAPQT-SARNTIFPEEYTMETTTGLVPVSTLQSLGRTA 109

Query: 161 SRVSSTK-KEHNNDHTDIHSTRSKVTTNSQG 190
           + ++ T+ ++     T   ST    T+NS+G
Sbjct: 110 TSITRTRTRQIERRSTSGFST----TSNSKG 136

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 4/86 (4%)

Query: 83  PTSNSIEKMVTQNALEGT-SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRL 141
           P+ N  +  +  N L+ T +ET+ SL++ G++  K  +PD+ AP   S  +  FPEEY L
Sbjct: 31  PSENGSKSNMAPNQLKLTRTETVKSLQDMGVS-SKAPVPDVNAP--QSGKNKIFPEEYTL 87

Query: 142 ETETGLVKLKTLETLRREDSRVSSTK 167
           ET TGLV + TL ++ R  + +S T+
Sbjct: 88  ETPTGLVPVATLHSIGRTSTAISRTR 113

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL++ G++  K  +PD+ AP   S+ +  FPEEY LET TGLV + TL ++ R  
Sbjct: 50  TETVKSLQDMGVS-SKAPVPDVNAP--QSSKNKIFPEEYTLETPTGLVPVATLHSIGRTS 106

Query: 161 SRVSSTK 167
           + +S T+
Sbjct: 107 TAISRTR 113

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 50/81 (61%), Gaps = 4/81 (4%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL++ G+      +PDI AP   +A +  FPEEY +ET +GLV + TL+++ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP--KTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 161 SRVSSTK-KEHNNDHTDIHST 180
           S +S T+ K+ N   T+  ST
Sbjct: 102 SALSRTRTKQLNRSATNSSST 122

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 50/81 (61%), Gaps = 4/81 (4%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL++ G+      +PDI AP   +A +  FPEEY +ET +GLV + TL+++ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP--QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 161 SRVSSTK-KEHNNDHTDIHST 180
           S +S T+ K+ N   T+  ST
Sbjct: 102 SALSRTRTKQLNRTATNSSST 122

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (62%), Gaps = 2/67 (2%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET  +L++ G+   +  LPDI AP   S   A FPEEY +ET TGLV + TL+++ R  
Sbjct: 50  TETAKTLQDMGMT-SEAPLPDINAP-QGSKKPAIFPEEYTMETPTGLVPVVTLQSIGRNS 107

Query: 161 SRVSSTK 167
           S +S T+
Sbjct: 108 SAISRTR 114

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 4/81 (4%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL++ G+      +PDI AP   +A +  FPEEY +ET +GLV + TL+++ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP--QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 161 SRVSSTK-KEHNNDHTDIHST 180
           S +S T+ ++ N   T+  ST
Sbjct: 102 SALSRTRTRQLNRTGTNSSST 122

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 44/67 (65%), Gaps = 2/67 (2%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ +L++ G+      +PDI AP  +S  +A FPEEY +ET TGLV + TL+++ R  
Sbjct: 46  TETVKTLQDLGVT-SHVPVPDINAP-QSSKKNAIFPEEYTMETTTGLVPVATLQSMGRTA 103

Query: 161 SRVSSTK 167
           S +S T+
Sbjct: 104 SAISRTR 110

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 4/81 (4%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL++ G+      +PDI AP   +A +  FPEEY +ET +GLV + TL+++ R  
Sbjct: 45  TETVKSLQDLGVT-SNAPVPDINAP--QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 161 SRVSSTK-KEHNNDHTDIHST 180
           + +S T+ K+ N   T+  ST
Sbjct: 102 TALSRTRTKQMNRTATNSSST 122

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL++ G++  +  +PD+ AP   S+ +  FPEEY +ET TGLV + TL ++ R  
Sbjct: 50  TETVKSLQDMGVS-SRAPVPDVNAP--QSSKNKIFPEEYTIETPTGLVPVATLHSIGRTS 106

Query: 161 SRVSSTK 167
           + +S T+
Sbjct: 107 TAISRTR 113

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL++ GL      +PD+ AP +N    + FPEEY +ET TGLV + TL +L R  
Sbjct: 45  TETVKSLQDMGLT-SDAPIPDVNAPTSN--KHSIFPEEYTMETPTGLVPVATLHSLGRNS 101

Query: 161 SRVSSTK 167
           + ++ T+
Sbjct: 102 TTITRTR 108

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET  SL+E G++  +  +PDI AP   +     FPEEY +ET TGLV + TL ++ R  
Sbjct: 44  TETAKSLQEMGVS-SEAPIPDINAP--QNVKSPIFPEEYTMETPTGLVPVATLHSIGRTT 100

Query: 161 SRVSSTK 167
           S VS T+
Sbjct: 101 SAVSRTR 107

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 4/82 (4%)

Query: 88  IEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGL 147
           +E+ VT  AL    ET ++L+  G+  +   LPD+ AP   +A    FPEEY +ET +G+
Sbjct: 28  LEQDVTSRALS-RHETAETLQTMGMA-RGTPLPDVVAPTYAAA--PVFPEEYTMETPSGI 83

Query: 148 VKLKTLETLRREDSRVSSTKKE 169
           V L  LE+L R  + VS   +E
Sbjct: 84  VPLAQLESLGRTVTTVSKKGEE 105

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 47/82 (57%), Gaps = 3/82 (3%)

Query: 101 SETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRRED 160
           +ET+ SL++ G+   +  +P + AP T+      FPEEY +ET TGLV + TL++L R  
Sbjct: 48  TETVKSLQDMGMT-SEAPIPGVNAPQTSRVQ--IFPEEYTMETPTGLVPVATLQSLGRSS 104

Query: 161 SRVSSTKKEHNNDHTDIHSTRS 182
             V+ T+    +  +  +++ S
Sbjct: 105 LAVTRTRTRQMDRQSQTNASIS 126

>ZYRO0D08998g Chr4 (771821..774349) [2529 bp, 842 aa] {ON} similar
           to uniprot|P27514 Saccharomyces cerevisiae YNR013C PHO91
           Low-affinity phosphate transporter deletion of pho84
           pho87 pho89 pho90 and pho91 causes synthetic lethality
           transcription independent of Pi and Pho4p activity
           overexpression results in vigorous growth
          Length = 842

 Score = 37.4 bits (85), Expect = 0.027,   Method: Composition-based stats.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 107 LKEDGLNLKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSST 166
           L++D LN +  +L D+  P   SA  A +     LE   G   + +  + R      S +
Sbjct: 97  LEQDLLNNRVDSLEDVY-PRRRSAGSARYSSASSLEAGGGDDDIHSGFSTR------SQS 149

Query: 167 KKEHNNDHTDIHSTRSKVTTNSQGSSLEPNKLNMAVEKN---KKKI 209
             E++N  +DI+  RS+ T N+ GSS + + ++ A+E+    KK+I
Sbjct: 150 HLENDNVGSDIYQARSRTTNNTWGSSSQAHFISPAMERRIILKKRI 195

>KAFR0L01100 Chr12 (206906..208762) [1857 bp, 618 aa] {ON} Anc_7.271
           YER080W
          Length = 618

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 9/74 (12%)

Query: 89  EKMVTQNALEGTSETLDSLKEDGLNLK----KKAL--PDITAPVTNSAHDATFPEEYRLE 142
           EK  T+ ++EG S  ++ L +D +N K    KK +  P+ T  + ++A  A      RL 
Sbjct: 76  EKRTTRFSIEGLSSVVNDLYKDVMNFKTDASKKLIFKPNSTVTLADNASAALLD---RLN 132

Query: 143 TETGLVKLKTLETL 156
            + GLV++KT+ ++
Sbjct: 133 AKEGLVQIKTIASI 146

>Skud_10.362 Chr10 (643130..647875) [4746 bp, 1581 aa] {ON} YJR138W
            (REAL)
          Length = 1581

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 44/111 (39%), Gaps = 6/111 (5%)

Query: 96   ALEGTSETLDSLKEDGLNLKKKALPDITAP-----VTNSAHDATFPEEYRLETETGLVKL 150
             L G  + L   K  G   K   LP    P     V N  ++   PEE R+E    L+  
Sbjct: 1057 VLAGYGDYLIDRKWHGFRAKYVVLPTDIPPNTYSMVINGKNETLNPEEIRVEGLRRLIGS 1116

Query: 151  KTLETLRRE-DSRVSSTKKEHNNDHTDIHSTRSKVTTNSQGSSLEPNKLNM 200
             T   LR E + R+  +K+E        ++       N Q +SLE + +N 
Sbjct: 1117 ITRARLRTEKEKRIKKSKREEIQPEVIFYTGPLYNFINEQQTSLESSAINF 1167

>Kpol_1000.24 s1000 complement(56352..59846,59848..61095) [4743 bp,
            1580 aa] {ON} complement(56352..59846,59848..61095) [4743
            nt, 1581 aa]
          Length = 1580

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 30/72 (41%), Gaps = 5/72 (6%)

Query: 96   ALEGTSETLDSLKEDGLNLKKKALPDITAP-----VTNSAHDATFPEEYRLETETGLVKL 150
             L G SE L+S    G   K   LP    P     V N  ++   PEE RLE    L+ L
Sbjct: 1063 VLAGYSENLESSSWIGFRSKFVVLPADIPPNSYSTVVNGRNEVLNPEELRLEGIRRLIAL 1122

Query: 151  KTLETLRREDSR 162
             +   LR  + R
Sbjct: 1123 ISRSRLRSINER 1134

>Kpol_1025.2 s1025 complement(4571..9094) [4524 bp, 1507 aa] {ON}
            complement(4571..9094) [4524 nt, 1508 aa]
          Length = 1507

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 9/73 (12%)

Query: 124  APVTNSAHDATFPEEYRLETETGLVKLKT-LETLRR--------EDSRVSSTKKEHNNDH 174
            +P + S H+  +PE    E    + K++T L  LR+        E +++  T+     DH
Sbjct: 1396 SPASTSEHEKEYPEMDEDECRQVMSKMRTSLMRLRKGGKGLDRKEWAKILKTELTAIGDH 1455

Query: 175  TDIHSTRSKVTTN 187
             D H T SK TTN
Sbjct: 1456 IDSHKTESKKTTN 1468

>ZYRO0F14036g Chr6 (1153919..1154761) [843 bp, 280 aa] {ON}
           conserved hypothetical protein
          Length = 280

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 2/60 (3%)

Query: 150 LKTLETLR--REDSRVSSTKKEHNNDHTDIHSTRSKVTTNSQGSSLEPNKLNMAVEKNKK 207
           L++L  L   R D     T KEH  D+  +  T +KV  NS     EP KL +   KN K
Sbjct: 48  LRSLNMLEEGRYDLVDDCTFKEHIADYPGVTRTFAKVDPNSCKIEYEPPKLGLQERKNSK 107

>Suva_12.230 Chr12 (364040..368785) [4746 bp, 1581 aa] {ON} YJR138W
            (REAL)
          Length = 1581

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 44/111 (39%), Gaps = 6/111 (5%)

Query: 96   ALEGTSETLDSLKEDGLNLKKKALPDITAP-----VTNSAHDATFPEEYRLETETGLVKL 150
             L G  + L   K  G   K   LP    P     V N  ++   PEE R+E    L+  
Sbjct: 1057 VLAGYGDYLMDRKWHGFRAKYVVLPTDIPPNTYSMVINDKNETLNPEEIRVEGLRRLIGS 1116

Query: 151  KTLETLRRE-DSRVSSTKKEHNNDHTDIHSTRSKVTTNSQGSSLEPNKLNM 200
             T   LR E + ++  TK+E        ++       N Q +SLE + +N 
Sbjct: 1117 ITRARLRTEKEKQIKKTKREEIQPEVMFYTGPLYNFINEQQTSLESSTINF 1167

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.125    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,441,409
Number of extensions: 1119368
Number of successful extensions: 4603
Number of sequences better than 10.0: 207
Number of HSP's gapped: 4564
Number of HSP's successfully gapped: 210
Length of query: 230
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 124
Effective length of database: 41,326,803
Effective search space: 5124523572
Effective search space used: 5124523572
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 64 (29.3 bits)