Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2213.485ON1036103652590.0
Skud_7.4363.485ON1036103649680.0
YGR125W3.485ON1036103649380.0
Suva_7.4133.485ON1037103747340.0
NCAS0E009503.485ON1052105533720.0
NDAI0G009903.485ON1054107333340.0
CAGL0I10626g3.485ON1070104132400.0
ZYRO0C07986g3.485ON1024106631940.0
TDEL0D055303.485ON1031106431930.0
KNAG0B008603.485ON1088108731920.0
KAFR0C019103.485ON1020105131510.0
Kpol_480.183.485ON1057108930740.0
SAKL0F02926g3.485ON1050108530580.0
TPHA0D042103.485ON1049105930070.0
TBLA0C044403.485ON115089729160.0
Kwal_55.212013.485ON1011106029140.0
KLTH0F14674g3.485ON1010105328860.0
KLLA0E04731g3.485ON106086425880.0
AFR304W3.485ON1015104225280.0
TDEL0C012808.99ON7272901407e-08
Suva_16.3228.99ON7425611381e-07
ZYRO0F04796g8.99ON7352881381e-07
NCAS0B048008.99ON7245401372e-07
CAGL0L09207g8.99ON7255231362e-07
Smik_16.2418.99ON7445651344e-07
SAKL0B03124g8.99ON7446141335e-07
Skud_16.2868.99ON7452911327e-07
Kwal_27.110398.99ON7266581319e-07
YPR003C8.99ON7545611273e-06
TBLA0C052708.99ON7765261264e-06
SAKL0H08800gna 1ON6202511211e-05
Ecym_7084na 1ON6892061202e-05
AGR213Cna 1ON6892921192e-05
KLTH0G16764g8.99ON7105571183e-05
NDAI0B022108.99ON7065201157e-05
KLLA0E14059g8.99ON7062971131e-04
Kpol_467.118.99ON7442851131e-04
TPHA0H007208.99ON7871271076e-04
KNAG0D023908.99ON7164031050.001
YML118W (NGL3)8.850ON50567753.5
Suva_13.258.850ON50230743.9
Kpol_1050.181.429ON59674744.7
NDAI0D047304.309ON661134745.0
AGR077C8.271ON848154736.3
Suva_8.3398.753ON1712115727.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.221
         (1036 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  2030   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1918   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1906   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1828   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  1303   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1288   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1252   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...  1234   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...  1234   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...  1234   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1218   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...  1188   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1182   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....  1162   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...  1127   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...  1127   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...  1116   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...  1001   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   978   0.0  
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    59   7e-08
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    58   1e-07
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    58   1e-07
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    57   2e-07
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    57   2e-07
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    56   4e-07
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    56   5e-07
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    55   7e-07
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    55   9e-07
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    54   3e-06
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    53   4e-06
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    51   1e-05
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    51   2e-05
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    50   2e-05
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    50   3e-05
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    49   7e-05
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    48   1e-04
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    48   1e-04
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...    46   6e-04
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    45   0.001
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...    33   3.5  
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...    33   3.9  
Kpol_1050.18 s1050 complement(45297..47087) [1791 bp, 596 aa] {O...    33   4.7  
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    33   5.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...    33   6.3  
Suva_8.339 Chr8 complement(595820..600958) [5139 bp, 1712 aa] {O...    32   7.5  

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 2030 bits (5259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1005/1036 (97%), Positives = 1005/1036 (97%)

Query: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSINKMHRASVSAMSPPLCRSYMSGFFTGGNSP 60
            MGRTIRRRRSNSSLSEAISVSLGINQDSSINKMHRASVSAMSPPLCRSYMSGFFTGGNSP
Sbjct: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSINKMHRASVSAMSPPLCRSYMSGFFTGGNSP 60

Query: 61   MINSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSG 120
            MINSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSG
Sbjct: 61   MINSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSG 120

Query: 121  DRKDDQSMRTXXXXXXXXXXXXXXRLLLSPASSNINDDRNRGLQNGLTSELEDDYEGGYQ 180
            DRKDDQSMRT              RLLLSPASSNINDDRNRGLQNGLTSELEDDYEGGYQ
Sbjct: 121  DRKDDQSMRTIEEDIDEEYSDEYSRLLLSPASSNINDDRNRGLQNGLTSELEDDYEGGYQ 180

Query: 181  SLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240
            SLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS
Sbjct: 181  SLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240

Query: 241  HLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDE 300
            HLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDE
Sbjct: 241  HLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDE 300

Query: 301  IITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360
            IITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT
Sbjct: 301  IITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360

Query: 361  RVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFH 420
            RVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFH
Sbjct: 361  RVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFH 420

Query: 421  FIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480
            FIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF
Sbjct: 421  FIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480

Query: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540
            GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA
Sbjct: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540

Query: 541  DSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEY 600
            DSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEY
Sbjct: 541  DSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEY 600

Query: 601  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660
            LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT
Sbjct: 601  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660

Query: 661  KFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINAD 720
            KFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINAD
Sbjct: 661  KFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINAD 720

Query: 721  NIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEW 780
            NIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEW
Sbjct: 721  NIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEW 780

Query: 781  CENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQXXXXXXXXXXXXXXXXXDPVRNL 840
            CENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQ                 DPVRNL
Sbjct: 781  CENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQNKNINALGNGLNKGNNIDPVRNL 840

Query: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEI 900
            MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEI
Sbjct: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEI 900

Query: 901  QKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFS 960
            QKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFS
Sbjct: 901  QKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFS 960

Query: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCI 1020
            NGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCI
Sbjct: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCI 1020

Query: 1021 KDTRFKELLGYTLVSA 1036
            KDTRFKELLGYTLVSA
Sbjct: 1021 KDTRFKELLGYTLVSA 1036

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1918 bits (4968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 945/1036 (91%), Positives = 975/1036 (94%)

Query: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSINKMHRASVSAMSPPLCRSYMSGFFTGGNSP 60
            MGRTIRRRRSNSSLSEAISVSLGINQDSS NKMHRASVSAMSPPLCRSYMSGFFTGG+SP
Sbjct: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSKNKMHRASVSAMSPPLCRSYMSGFFTGGSSP 60

Query: 61   MINSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSG 120
            M+ +MSDSKLP SNKQHP VIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDS 
Sbjct: 61   MVKNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSD 120

Query: 121  DRKDDQSMRTXXXXXXXXXXXXXXRLLLSPASSNINDDRNRGLQNGLTSELEDDYEGGYQ 180
            DRKDDQSMRT              RLLLSPASSN++D+RNR LQ+G  SELEDDY GGYQ
Sbjct: 121  DRKDDQSMRTIVENIDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQ 180

Query: 181  SLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240
            SLR SHNLR RPRN  + CTSFP KF HYLPAAVLGLLLNILDALSYGMIIFPITEPVFS
Sbjct: 181  SLRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240

Query: 241  HLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDE 300
            HLGPTGISMFYISTIISQAVYSGG SSFPSGIGSEMIEITPFYHTMALAVK+AL G+DDE
Sbjct: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDE 300

Query: 301  IITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360
            IITTTIFCYVISSMLTG VFYVLGKL+LGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT
Sbjct: 301  IITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360

Query: 361  RVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFH 420
            RVAKFEYSWPFF GLFTNYDTLAKWLLPV+LTVILIGTQRYFKNSLVLP+FYILTLVLFH
Sbjct: 361  RVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFH 420

Query: 421  FIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480
            FIVAIIPTLSLDTLR AGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF
Sbjct: 421  FIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480

Query: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540
            GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA
Sbjct: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540

Query: 541  DSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEY 600
            DSSFAGFLLIALTIC+M+IGPVIISFIPICIVGSLIFLLGYELLVEAL+DTWNKLNRFEY
Sbjct: 541  DSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY 600

Query: 601  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660
            LTVVIIVFTMG+FDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT
Sbjct: 601  LTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660

Query: 661  KFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINAD 720
            KFLDGIGEQIYVLKLQN+LFFGTI+SIEEKIEKLLQISNKDA KRRIKYLILDFKNINAD
Sbjct: 661  KFLDGIGEQIYVLKLQNVLFFGTIISIEEKIEKLLQISNKDAKKRRIKYLILDFKNINAD 720

Query: 721  NIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEW 780
            NIDYSAAEGFNRIKRFT TK+IKLIISSI+ERDRIYNAFNNVGLLNDVELFADLNSALEW
Sbjct: 721  NIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780

Query: 781  CENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQXXXXXXXXXXXXXXXXXDPVRNL 840
            CENEFLFQYKQLR KAK+RLEERKQ+++ SA+MAATQ                 D  RNL
Sbjct: 781  CENEFLFQYKQLREKAKKRLEERKQSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNL 840

Query: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEI 900
            MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFK EYK+DEP+LPILLFALKQYRPDIISEI
Sbjct: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEI 900

Query: 901  QKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFS 960
            Q VREKEIKFWAQLCPYFTRRRLASQSLLLHADN+FFLVETGMLKATYELPQGTLYEIFS
Sbjct: 901  QTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960

Query: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCI 1020
            NGTCFGKIIAPGNAMPREQKLTIETETDS+LWVIDSSSLKKMKEENLALYVEV LMVMCI
Sbjct: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCI 1020

Query: 1021 KDTRFKELLGYTLVSA 1036
            KDTRFKELLGYTLVSA
Sbjct: 1021 KDTRFKELLGYTLVSA 1036

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1906 bits (4938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 948/1036 (91%), Positives = 979/1036 (94%)

Query: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSINKMHRASVSAMSPPLCRSYMSGFFTGGNSP 60
            MGRTIRRRRSNSSLSEAISVSLGINQDSS+NKMHRASVSAMSPPLCRSYMSGFFTGGNSP
Sbjct: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSP 60

Query: 61   MINSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSG 120
            MIN++SDSKLP+SNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDII +G
Sbjct: 61   MINNLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNG 120

Query: 121  DRKDDQSMRTXXXXXXXXXXXXXXRLLLSPASSNINDDRNRGLQNGLTSELEDDYEGGYQ 180
            DRKDDQSMRT              RLLLSPASSN++DDRNRGLQN    ELED Y GGYQ
Sbjct: 121  DRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAGGYQ 180

Query: 181  SLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240
            SLR SHNLR RPRN   +CTSFPSKF HYLPAAVLGLLLNILDALSYGMIIFPITEPVFS
Sbjct: 181  SLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240

Query: 241  HLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDE 300
            HLGPTGISMFYISTIISQAVYSGG SSFPSGIGSEMIEITPFYHTMALA+KEALAG+DDE
Sbjct: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDE 300

Query: 301  IITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360
            IITTTIFCYVISSMLTG VFY LGKL+LGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT
Sbjct: 301  IITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360

Query: 361  RVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFH 420
            RVAKFEYSWPFF GLFT+YDTLAKWLLPV+LTV+LIGTQRYFKNSLVLPSFYILTLVLFH
Sbjct: 361  RVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFH 420

Query: 421  FIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480
            FIVAIIPTLSLD LR AGWIFPIANSDSKWYDHY+LFNVHKVHWSLVLQQIPTMMALTFF
Sbjct: 421  FIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFF 480

Query: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540
            GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA
Sbjct: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540

Query: 541  DSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEY 600
            DS FAGFLLIALTICIM+IGPVIISFIPICIVGSLIFLLGYELLVEAL+DTWNKLNRFEY
Sbjct: 541  DSPFAGFLLIALTICIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY 600

Query: 601  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660
            LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVA+STVYRDYVQT
Sbjct: 601  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQT 660

Query: 661  KFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINAD 720
            KFLDGIGEQIYVLKLQNLLFFGTI+SIEEKIE+LLQISNKDATKRRIKYLILDFKNINAD
Sbjct: 661  KFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINAD 720

Query: 721  NIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEW 780
            NIDYSAAEGFNRIKRFTETK+IKLIISSI+ERDRIYNAFNNVGLLNDVELFADLNSALEW
Sbjct: 721  NIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780

Query: 781  CENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQXXXXXXXXXXXXXXXXXDPVRNL 840
            CENEFLFQYKQLR KAKERLEE KQNN+VSAV+AAT+                 D  RNL
Sbjct: 781  CENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNL 840

Query: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEI 900
            MSLPTNTPRNYQ+LSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISE+
Sbjct: 841  MSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEV 900

Query: 901  QKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFS 960
            QKVREKEIKFWAQLCPYFTRRRLASQS LLHADN+FFLVETGMLKATYELPQGTLYEIFS
Sbjct: 901  QKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960

Query: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCI 1020
            NGTCFGKIIAPGNAMPREQKLTIETETDS+LWVIDSSSL K+KE+NLALYVEVALMVMCI
Sbjct: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCI 1020

Query: 1021 KDTRFKELLGYTLVSA 1036
            KDTRFKELLGYTLVSA
Sbjct: 1021 KDTRFKELLGYTLVSA 1036

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1828 bits (4734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 910/1037 (87%), Positives = 960/1037 (92%), Gaps = 1/1037 (0%)

Query: 1    MGRTIRRRRSNSSLSEAISVSLGIN-QDSSINKMHRASVSAMSPPLCRSYMSGFFTGGNS 59
            MGR IRRRRSNSSLSEAI+VSLGIN QDSS NK+HRAS S MSPPLCRSYMSGFFTGG+S
Sbjct: 1    MGRNIRRRRSNSSLSEAITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSS 60

Query: 60   PMINSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDS 119
            PM  +MSD KLP SNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDS
Sbjct: 61   PMNYNMSDPKLPFSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDS 120

Query: 120  GDRKDDQSMRTXXXXXXXXXXXXXXRLLLSPASSNINDDRNRGLQNGLTSELEDDYEGGY 179
             DRKDDQSMRT              RLLLSPASSN++D+RNR LQ   TS+LED + GGY
Sbjct: 121  DDRKDDQSMRTIEENIDEEYADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGY 180

Query: 180  QSLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVF 239
            QS+  SH+LR  PR+  +  TSFPSKF  YLPAAVLGLLLNILDALSYGMIIFPITEPVF
Sbjct: 181  QSVHPSHDLRFGPRSVWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVF 240

Query: 240  SHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDD 299
            SHLGPTGISMFYISTIISQ+VYSGG SSFPSG+GSEMIEITPFYHTMAL +KEAL G DD
Sbjct: 241  SHLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDD 300

Query: 300  EIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVT 359
            EIITTTIFCYVISSMLTG VFYVLGKL+LGKIVGFFPRHILIGCIGGVGYFLIITGIEVT
Sbjct: 301  EIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVT 360

Query: 360  TRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLF 419
            TRVAKFEYSWPF  GLFTNYDTLAKWLLPV+LTV+LIGTQR FKNSLVLP+FYILTLVLF
Sbjct: 361  TRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLF 420

Query: 420  HFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTF 479
            HFIVAIIPTLSLDTLR +GWIFPIA+SDSKWYDHYKLFN+HKVHW+LVLQQIPTMMALTF
Sbjct: 421  HFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTF 480

Query: 480  FGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAG 539
            FGILHVPINVPALAMSLQMDKYDVD+ELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAG
Sbjct: 481  FGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAG 540

Query: 540  ADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFE 599
            ADSSFAGFLL+ALT+CIM+IGPVIISFIPICIVGSLIFLLGYELLVEAL+DTW+KLNRFE
Sbjct: 541  ADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFE 600

Query: 600  YLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQ 659
            YLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQT+NGEYNGNVAKSTVYRDYVQ
Sbjct: 601  YLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQ 660

Query: 660  TKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINA 719
            TKFLDGIGEQIYVLKLQN+LFFGTI+SIEEKIE+LL+ISNKD+TKRRIKYLILDFKNINA
Sbjct: 661  TKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINA 720

Query: 720  DNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALE 779
            DNIDYSAAEGFNRIKRFTETK+IKLIISSI+ERD IYNAFNNVGLLNDVELFADLN ALE
Sbjct: 721  DNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALE 780

Query: 780  WCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQXXXXXXXXXXXXXXXXXDPVRN 839
            WCENEFLFQYKQLR KAK+RLEERKQNN+VSA+MAATQ                 D  R+
Sbjct: 781  WCENEFLFQYKQLREKAKKRLEERKQNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARH 840

Query: 840  LMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISE 899
            LMSLPTNTPRN+QMLSVAQNVF NDEQAVKN KKEYK+DEPVLPILLFALKQYRPDI+SE
Sbjct: 841  LMSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSE 900

Query: 900  IQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIF 959
            +QKVREKEIKFWAQLCPYF+RRRLASQSLLLHADNVFFL+ETGMLKA YELPQG+LYEI 
Sbjct: 901  VQKVREKEIKFWAQLCPYFSRRRLASQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIM 960

Query: 960  SNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMC 1019
            SNGTCFGKIIAPGN MPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEV LM+MC
Sbjct: 961  SNGTCFGKIIAPGNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMC 1020

Query: 1020 IKDTRFKELLGYTLVSA 1036
            IKDTRFKELLGYTLVSA
Sbjct: 1021 IKDTRFKELLGYTLVSA 1037

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 1303 bits (3372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/1055 (64%), Positives = 805/1055 (76%), Gaps = 36/1055 (3%)

Query: 6    RRRRSNSSLSEAISVSLGINQDSSINKMHRASVSAMSPP-LCRSYMSGFFTGGNSPMINS 64
            +++    S+S +ISVSLG+ Q+      +    +  +   + RSY+SGF +   + M + 
Sbjct: 10   KKKNKQQSISGSISVSLGLQQEEEPRDDYFDDENVNNNNYMGRSYVSGFLSVSPALMGSM 69

Query: 65   MSDSK-LPLS----NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDII-- 117
              D + LP++     +   + IH SE LH+QTA +S +F     +     IKDY+ +   
Sbjct: 70   KQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFEDDEDDTR---IKDYITLFQG 126

Query: 118  -DSG---DRKDDQSMRT------------XXXXXXXXXXXXXXRLLLSPASSNINDDRNR 161
             D+G   D+ D    R                           RLL+SP SSNIN + + 
Sbjct: 127  EDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVDESSRLLISPLSSNINPNIDD 186

Query: 162  GLQNGLTSELEDDYEGGYQSLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNI 221
             L   +T E    Y+  Y++  ++ +L        +    FP +FIHYLPAAVLGLLLNI
Sbjct: 187  LLPT-VTGEDVSSYQSIYRT--ATPSLSRNSETIWQNIADFPYQFIHYLPAAVLGLLLNI 243

Query: 222  LDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITP 281
            LDALSYGMIIFPITEP+FSHLGPTG+SMFYISTIISQ +YS G SSFPSGIGSEMIE+TP
Sbjct: 244  LDALSYGMIIFPITEPIFSHLGPTGLSMFYISTIISQTIYSSGWSSFPSGIGSEMIEVTP 303

Query: 282  FYHTMALAVKEALAGDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILI 341
            F+HTMALA+KE L G DDEIITTTIFCYVISSMLTG  FY LGKL LGKIVGFFPRHILI
Sbjct: 304  FFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILI 363

Query: 342  GCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRY 401
            GCIGGVGYFL++TGIEVTTRVAKFEYS PF   LF+++ TL KWLLPV+LTVILI TQR 
Sbjct: 364  GCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDWATLWKWLLPVLLTVILIVTQRC 423

Query: 402  FKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHK 461
            FKNSLVLPSFYILTL+LFHFIVAIIP+L+L+ LR +GWIFPIA S+SKWYDHYKLF+  K
Sbjct: 424  FKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKK 483

Query: 462  VHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLG 521
            VHW+LV +QIPTM+ALTFFGILHVPINVPALAMSL +DKYDVD+ELIAHG SNF SG +G
Sbjct: 484  VHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVG 543

Query: 522  SVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGY 581
            S+QNYLVYTNSVLFIRAGADS+ AG++LI LT  +M IGPVIISFIPICIVGSLIFLLGY
Sbjct: 544  SIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGY 603

Query: 582  ELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTIN 641
            ELLVEAL D W K++ FEY+T+VIIV TMGIFDFVLGIIVGILIACFSFL+DSTKLQTIN
Sbjct: 604  ELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTIN 663

Query: 642  GEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKD 701
            GEY+G VAKSTVYRD +QTKFL+GIGEQIYVLKLQNLLFFGTI+SIEEKI++LL+I +KD
Sbjct: 664  GEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKD 723

Query: 702  ATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNN 761
            +++ RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TKKI+L+ISSI+ERD IY AF+N
Sbjct: 724  SSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDN 783

Query: 762  VGLLNDVELFADLNSALEWCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQXXXX 821
            VGLL  VELF DLNSALEWCENEFLF+YKQLR KAK RL  RKQ   ++A + + +    
Sbjct: 784  VGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSRL-HRKQIIDINASIGSQK---- 838

Query: 822  XXXXXXXXXXXXXDPVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPV 881
                         D  RNLMSLP NTPRN+Q+LSVAQNVF N+EQ VKN K E KD  P 
Sbjct: 839  YQFTAGNDKKSNLDIPRNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPF 898

Query: 882  LPILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVET 941
            LP+LLF LKQYRP IIS  + V+E EIKFW+QLCPYF +  LASQS L+H +N+FF+VET
Sbjct: 899  LPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVET 958

Query: 942  GMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKK 1001
            G+LKAT+ LPQG +YE  SN TC+GKI    N     + LTI  E DSILWVIDS SL K
Sbjct: 959  GILKATFNLPQGNIYETMSNRTCYGKITGQHNESTL-KTLTIRAEIDSILWVIDSGSLIK 1017

Query: 1002 MKEENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            M+ EN  L+ E+ L++M +KD RFKELLGYTLVSA
Sbjct: 1018 MRAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1288 bits (3334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 683/1073 (63%), Positives = 816/1073 (76%), Gaps = 60/1073 (5%)

Query: 5    IRRRRSN-SSLSEAISVSLGI-NQDSSINKMHRA-------SVSAMSPPLCRSYMSGFFT 55
            +RR+++N  S+S+ ISVSLG+ NQD  I +           ++S  S  L RSY+SGF +
Sbjct: 1    MRRQKNNRHSISDTISVSLGLQNQDPQILQQPNGGPTVTLGNMSDTSNYLGRSYVSGFLS 60

Query: 56   GGNSPMIN-SMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYM 114
               SP IN   +++ LP++N+   K IH S+NLHRQTA +S +F +    E+   +K+Y+
Sbjct: 61   A--SPAINHDNNNNTLPIANQHLNKSIHASQNLHRQTAAISEDFNNDPTFEDDINMKEYI 118

Query: 115  D-----------------IIDSGDRKDDQSMRTXXXXXXXXXXXXXXRLLLSPASSNIND 157
                               ID+ DR D+                   RLLLSP  S    
Sbjct: 119  SNLEDDATGNNGKRYTAYYIDNEDRIDNILTEEAEPVTDFYPQDENSRLLLSPIPS---- 174

Query: 158  DRNRGLQNGLTSELEDDYE-------GGYQSLR----SSHNLRSRPRNFRRLCTSFPSKF 206
            D     +N L S  E + E         YQS+R     S    S P   + + T  PS+ 
Sbjct: 175  DSLLAGENLLPSISEQEQETAQRRRTSAYQSIRHRNSESTEYSSIPTWRKYIAT--PSEI 232

Query: 207  IHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGCS 266
            I YLPA++LGLLL ILDALSYGMIIFPITEP+FSHLGPTGISMFYISTIISQ+++SGG S
Sbjct: 233  IQYLPASILGLLLTILDALSYGMIIFPITEPIFSHLGPTGISMFYISTIISQSIFSGGWS 292

Query: 267  SFPSGIGSEMIEITPFYHTMALAVKEALA-GDDDEIITTTIFCYVISSMLTGTVFYVLGK 325
            SFP GIGSEMIE+TPF+HTMA A+K+AL  G +D+IITTT+FCYVISSMLTG  FY LGK
Sbjct: 293  SFPCGIGSEMIEVTPFFHTMAFAIKDALPEGSNDDIITTTLFCYVISSMLTGLTFYSLGK 352

Query: 326  LQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKW 385
            L LGKIVGFFPRHILIGCIGGVGYFLIITGIEV+TRVAKF+Y+ PF   LFT+  TL +W
Sbjct: 353  LHLGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQYTIPFITHLFTDVVTLWQW 412

Query: 386  LLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIAN 445
            LLP +LTVILI  Q+  +NSLVLPSFYILTL+LFHF+VAIIP+LSL+ LR +GWIFP A 
Sbjct: 413  LLPTLLTVILIIAQKCAQNSLVLPSFYILTLILFHFMVAIIPSLSLNQLRDSGWIFPQAA 472

Query: 446  SDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDR 505
            +DSKWYDHYKLFN+HKVHW+L+L+QIPTM+ALTFFGILHVPINVPALAMSLQMD+YDVD+
Sbjct: 473  TDSKWYDHYKLFNLHKVHWTLILKQIPTMLALTFFGILHVPINVPALAMSLQMDRYDVDK 532

Query: 506  ELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIIS 565
            ELIAHG SNF SG+ GS+QNYLVYTNSVLFIRAGADS+ AG +LI LTI IM+IGPVIIS
Sbjct: 533  ELIAHGVSNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAGHILIVLTIIIMIIGPVIIS 592

Query: 566  FIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILI 625
            FIPICIVGSLIFLLGYELLVEAL+D   K+++FEY+T+VIIVFTMGIFDFVLG+IVGILI
Sbjct: 593  FIPICIVGSLIFLLGYELLVEALVDPLGKISKFEYITIVIIVFTMGIFDFVLGVIVGILI 652

Query: 626  ACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIL 685
            ACFSFL+DSTKLQTINGE++G VAKSTVYRD +QTKFL+GIGEQIYVLKLQNLLFFGTI+
Sbjct: 653  ACFSFLIDSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTII 712

Query: 686  SIEEKIEKLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLI 745
            SIEEKI+KLL+IS+ D++K RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TK+I+LI
Sbjct: 713  SIEEKIDKLLEISDMDSSKHRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIRLI 772

Query: 746  ISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRIKAKERLEERKQ 805
            ISSIRERD IYNAFNNVGLL  VELF DLNSALEWCENEFLF+YK LR K +++ + +  
Sbjct: 773  ISSIRERDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFLFKYKTLREKTRQKRKNKID 832

Query: 806  NNIVSAVMAATQXXXXXXXXXXXXXXXXXDPVRNLMSLPTNTPRNYQMLSVAQNVFVNDE 865
             N+       T+                 +  RN+MSLP NTPRN QMLSVAQNVF N+E
Sbjct: 833  INLAITNGNPTE-----------ERNMHLEIPRNIMSLPMNTPRNNQMLSVAQNVFRNEE 881

Query: 866  QAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFTRRRLAS 925
            QA K  K+++K++  VLP+LLF LKQYRP I+S  + + EKEIKFW+QLCPY + R L +
Sbjct: 882  QAAKALKQQFKNEPSVLPLLLFVLKQYRPRIVSNDKSIEEKEIKFWSQLCPYLSERFLVA 941

Query: 926  QSLLLHADNVFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMP--REQKLTI 983
            QS L H +N FF+VE+G+LKAT+ LP GTLYE  SN TC+GKI+   N      EQ LTI
Sbjct: 942  QSTLKHNNNFFFIVESGILKATFTLPSGTLYETMSNRTCYGKILGSNNETTVLNEQDLTI 1001

Query: 984  ETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            +TETD  LWVID  +L +M+ ENL LY+E+ L++M I+DTRFKELLGYTLVSA
Sbjct: 1002 KTETDCNLWVIDMDALTRMRAENLELYIELVLLIMSIRDTRFKELLGYTLVSA 1054

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1252 bits (3240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/1041 (60%), Positives = 769/1041 (73%), Gaps = 37/1041 (3%)

Query: 24   INQDSSINKMHRASVSAMSPP-------LCRSYMSGFFTGGNSPMINSMSDSKLPLSNKQ 76
            +N+ +S+N   R +   +  P       L RSY+SG      S +      + LP+SNK 
Sbjct: 39   LNESNSLNVNARPNTKNVGIPNNDTNTFLGRSYVSGIL---GSSLPQGGERNTLPVSNKF 95

Query: 77   HPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSG--------DRKD-DQS 127
              + IH    LHRQTA ++ EF   ++ E+  ++K+Y++++D          +R+D D  
Sbjct: 96   GSRAIHEQNKLHRQTAAIAEEFDDGTIGESPSSLKEYLNLLDEAQEEELDLRNRRDLDND 155

Query: 128  MRTXXXXXXXXXXXXXXR--------LLLSPASSNINDDRNR--GLQNGLTSELEDDYEG 177
            + T                        LL+P+SSN ND+       +N L++    + E 
Sbjct: 156  LITDNKTPVSINLKRATDPELEQQTVALLTPSSSN-NDNYGSVSPEENFLSATSNYEQES 214

Query: 178  GYQSLR--SSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPIT 235
             YQS+    S   R  P +          +  +Y+PAA+LGLLLNILDALSYGMIIFPIT
Sbjct: 215  TYQSITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPAAILGLLLNILDALSYGMIIFPIT 274

Query: 236  EPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALA 295
            EP+F+ LGPTGISMFYISTIISQ +YS G SSFPSGIGSEMIEITPFYHTMALA+ +AL 
Sbjct: 275  EPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALP 334

Query: 296  GDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITG 355
            G DDEIITTTIFCYVISS++TG  FY+LGKL+LGKIVGFFPRHILIGCIGGVGYFLIITG
Sbjct: 335  GRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITG 394

Query: 356  IEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILT 415
            +EVTTR+AKFEYS PF   LF +   L KWLLP ILT+ILI TQ+ FKNSLVLPSFYI+T
Sbjct: 395  LEVTTRIAKFEYSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYIIT 454

Query: 416  LVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMM 475
            L+LFHF+VAI P LSL  LR  GWIFP     SKWYDHY+ F++ K HWSLV++QIPTM+
Sbjct: 455  LILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTML 514

Query: 476  ALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLF 535
            ALTFFGILHVPINVPALAMSLQMDKYDVD+ELIAHGYSNFFSGL GSVQNYLVYTNSVLF
Sbjct: 515  ALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLF 574

Query: 536  IRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKL 595
            IRAGADS+ AG++LI LTI +M+IGPVIISFIPICIVGSLIFLLGYELLVEA+ID + K+
Sbjct: 575  IRAGADSAIAGYVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKV 634

Query: 596  NRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYR 655
              FEY T+ IIV TMGIFDFVLGI+VGILIACFSFLVDSTKLQT+NGE++G VAKSTVYR
Sbjct: 635  TTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYR 694

Query: 656  DYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFK 715
            D+ QT+FL  IGEQIYVLKLQN+LFFGTI+SIEEKIE+LL+IS+ D +K RIK+LILDFK
Sbjct: 695  DFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFK 754

Query: 716  NINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLN 775
            NINADNIDYSAAEGFNRIKR+TE K+IKLIIS+IRE DRIY+ FN VGLL D+ELF DLN
Sbjct: 755  NINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLN 814

Query: 776  SALEWCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQXXXXXXXXXXXXXXXXXD 835
            SALEWCENEFL+QYK+LR KA+ +L+ R +N     + AA                    
Sbjct: 815  SALEWCENEFLYQYKELREKARNKLQRRSKN-----INAAIGNQLRRYDQTNKNQGPTSS 869

Query: 836  PVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPD 895
             ++NLMSL  NTPRNYQ++S AQ  F N++Q       + K  +P+L +LLFALK YRP+
Sbjct: 870  LMQNLMSLSNNTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPLLKVLLFALKLYRPN 929

Query: 896  IISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTL 955
            I+S   + R  E++FW QLCPYFTR+   + +  LH +N FFLV+ G+LK  Y LP G++
Sbjct: 930  IVSMDTEKRTDEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPAGSV 989

Query: 956  YEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVAL 1015
            YE  SNGTC+GKI++  +     Q L ++ ETD+ILW+ID  S++ MK +N+ LY E+ L
Sbjct: 990  YETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVL 1049

Query: 1016 MVMCIKDTRFKELLGYTLVSA 1036
            +++ I+DTRFKELLGYTLVSA
Sbjct: 1050 LILAIRDTRFKELLGYTLVSA 1070

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score = 1234 bits (3194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/1066 (59%), Positives = 776/1066 (72%), Gaps = 83/1066 (7%)

Query: 6    RRRRSNSSLSEAISVSLGINQD-------------------SSINKMHRASVSAMSPPL- 45
            R  R+  S+S AISVSLG+N+                      IN+   +S+  +SPP  
Sbjct: 7    RPSRNRQSISGAISVSLGLNRQVHRNSDGEFTNYNNTNNNGGRINQNDSSSIEIVSPPFY 66

Query: 46   ------CRSYMSGFFTGGNSPMIN----SMSDSKLPLSNKQHPKVIHGSENLHRQTAQLS 95
                   RSY+ G F    SP +N    +   S LP+ ++   K IHGS+ +HRQTA+LS
Sbjct: 67   NSNNYAGRSYLGGGFLSA-SPKMNLQQRNDDSSVLPI-DRSRSKSIHGSQIIHRQTAELS 124

Query: 96   NEFC--SSSVEENSPTIKDYMDIIDSGDRKDDQSMRTXXXXXXXXXXXXXXRLLLSPASS 153
            N F   ++ +EE    +++  D ++                                   
Sbjct: 125  NNFSDDTTGMEE----VRNRYDAME----------------------------------- 145

Query: 154  NINDDRNRGLQNGLTSELEDDYEGGYQSLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAA 213
                D N  L + +T +      GG     +++N     R        F    +HY P+A
Sbjct: 146  ----DENSSLHHYMTHQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQDVLHYFPSA 201

Query: 214  VLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIG 273
            VLGLLLNILD LSYGMIIFPITEP+FSHLG TG+SMFYISTIISQ +YSGG SSF SGIG
Sbjct: 202  VLGLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIG 261

Query: 274  SEMIEITPFYHTMALAVKEALAGDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVG 333
            SEMIE+TPF+HTMA A+++A+ G DD+IITTTIFCY ISS++TG  FY+LGKL+LGKIVG
Sbjct: 262  SEMIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVG 321

Query: 334  FFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTV 393
            FFPRHILIGCIGGVGYFL+ITG+ VTTR+AK EY+W F   LF + D L KWLLPV+LT+
Sbjct: 322  FFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTI 381

Query: 394  ILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDH 453
            +L+ TQ+ F+NSLVLPSFYI+TL+LFHF+VAI+P++SLD LR  GWIFP A S  +W+DH
Sbjct: 382  LLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDH 441

Query: 454  YKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYS 513
            YKLF+ HKVHW+LVL QIPTM+ALTFFGILHVPINVPALA+SL MDK+DVD+ELIAHGYS
Sbjct: 442  YKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYS 501

Query: 514  NFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVG 573
            NF SG++GS+QNYLVYTNSVLFIRAGADS FAG++L  LT  +M+IGPVI+SFIPICIVG
Sbjct: 502  NFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVG 561

Query: 574  SLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVD 633
            SLIFLLGYELLVEAL+DT  K+  FEY+T+VIIV TMGI+DFVLG+IVGILIACFSFLVD
Sbjct: 562  SLIFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVD 621

Query: 634  STKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEK 693
            STKLQTINGE++G VA+STV RDYVQ+ FL+G+GEQIYVLKLQN+LFFGTI+SIEEKI+K
Sbjct: 622  STKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDK 681

Query: 694  LLQISN-KDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRER 752
            LL+I++ K ++KRRIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TK+IKLIISSI+ER
Sbjct: 682  LLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKER 741

Query: 753  DRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRIKAKERLEERKQNNIVSAV 812
            D IYN F+NVGLL+DVELF DLN ALEWCENEFL +YK+LR +A+E+++     N+ SA+
Sbjct: 742  DHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSY--NVTSAI 799

Query: 813  MAATQXXXXXXXXXXXXXXXXXDPVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFK 872
             AA                      RNL SLP NTPRN+QMLSVAQN+F NDE+ V   +
Sbjct: 800  EAAAAKKVPTDNNQISKKNLSLLNFRNLSSLPMNTPRNHQMLSVAQNMF-NDEEDVDALE 858

Query: 873  KEYKDD--EPVLPILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLL 930
             E  +D  +PVLP+LLFALK YR +I S    +RE+E + W+QL PYF +RRL +QS+LL
Sbjct: 859  DESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILL 918

Query: 931  HADNVFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSI 990
            H  + FF+VE+G+LK   +LPQG +YE  SN TC G I+        E K+TI TETD+ 
Sbjct: 919  HNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTC 978

Query: 991  LWVIDSSSLKKMKEENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            LW+ID   L+K++ ENL LY E+ L+ + IK  RF++LLGYTLVSA
Sbjct: 979  LWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score = 1234 bits (3193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/1064 (61%), Positives = 804/1064 (75%), Gaps = 77/1064 (7%)

Query: 7    RRRSNSSLSEAISVSLGINQDSSINKMHRASVSA---------MSPP---LCRSYMSGFF 54
            R R   S+SEAISVSLG+   ++    H  + S          MSP    L RSY+SGF 
Sbjct: 11   RNRGRHSISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFL 70

Query: 55   TGGNSPM-INSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDY 113
            +   SP   NS+   +LP++ +   K IH ++NLHRQTA+L  +F   +VE+N+  I+DY
Sbjct: 71   SC--SPYGSNSLESDRLPIA-RMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNN--IQDY 125

Query: 114  ---------MDIIDSGDRKDDQSMRTXXXXXXXXXXXXXXRLLLSPASSNINDDRNRGLQ 164
                     M+I D+ +R  DQ                    L +P   N  D   RG  
Sbjct: 126  VSATEEPRPMEISDA-ERMYDQEDE-----------------LRNPVHVNTED---RG-- 162

Query: 165  NGLTSELEDDYE-------GGYQSLRSS--HNLRSRPRN--FRRLCTSFPSKFIHYLPAA 213
                 ++ED YE       GGY+++ +S    LR+  R+  +R+  +S  SK +HYLPA 
Sbjct: 163  ----DDIEDVYESLVTGAHGGYRAIPTSPGGGLRTSSRSALWRQFMSS-SSKLVHYLPAT 217

Query: 214  VLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIG 273
            +LGLLLN+LD LSYGMIIFPITEP+FSHLGP+G+SMFY+STIISQ +YS G S+FP+G+G
Sbjct: 218  ILGLLLNVLDGLSYGMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVG 277

Query: 274  SEMIEITPFYHTMALAVKEALAGDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVG 333
            SEMIE+TPF+H+MALA+K+AL G DDEI+TTTIFCYVISS++TG  FYVLGK++LGKIVG
Sbjct: 278  SEMIEVTPFFHSMALAIKDALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVG 337

Query: 334  FFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTV 393
            FFPRHILIGCIGGVGYFL++TG+EVTTRVAK EY+WPF   +FT+  TL KW+LPV+LTV
Sbjct: 338  FFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSTLVKWVLPVLLTV 397

Query: 394  ILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDH 453
            +LI TQR+F+NSLVLP+FYI TLV FHF+VAIIP +SL  LR  GWIFP+A S  +WYDH
Sbjct: 398  LLIVTQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDH 457

Query: 454  YKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYS 513
            YKLF  H+VHW L+ +Q PTM+AL+FFGILHVPINVPALA+SLQMDKYDVD+ELIAHGYS
Sbjct: 458  YKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYS 517

Query: 514  NFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVG 573
            N  SG LGS+QNYLVYTNS+LFIRAGADS+ AG+LL  LT  +M+IGPVIIS+IPICIVG
Sbjct: 518  NLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVG 577

Query: 574  SLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVD 633
            SLIFLLGYELL EALI+T  K+  FEY+T+ IIV TMGIFDFVLG+IVGILIACFSFLVD
Sbjct: 578  SLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVD 637

Query: 634  STKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEK 693
            STKLQTINGEY+G +AKSTVYRDYVQ++FLDGIGEQIYVLKLQ+LLFFGTI+SIEEKI K
Sbjct: 638  STKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINK 697

Query: 694  LLQIS-NKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRER 752
            LL+IS ++  +KRRIK LILD KNINADNIDYSAAEGFNRIKRFT++K I+LIISSI E 
Sbjct: 698  LLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISET 757

Query: 753  DRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRIKAKERLEERKQNNIVSAV 812
            D IY AF+ V LL+DVELF DLN ALEWCENE LF+YK+LR KA++RL    QN +  A 
Sbjct: 758  DHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARDRL----QNKMQMAN 813

Query: 813  MAATQXXXXXXXXXXXXXXXXXDPVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFK 872
            +AA                     ++NLMSLP NTPRN QMLSVAQ VF N+++ V + K
Sbjct: 814  LAANNDTKAIDGVPKSHH------MQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLK 867

Query: 873  KEYKDDEPVLPILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHA 932
              YK+  PVLP+LLFALK YRP I+SE   V+  E++ W++LCPYFTRRRLASQS+LLH 
Sbjct: 868  VNYKELPPVLPLLLFALKPYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHN 927

Query: 933  DNVFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILW 992
             ++FF++ETG+LK  Y+LPQG +YE  SN TC+G ++ PG     E K+TI+TET+ +LW
Sbjct: 928  SDIFFVMETGILKIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLW 987

Query: 993  VIDSSSLKKMKEENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            VIDSS L ++K+ENL+LY E+ L++  +K+ R++++LGYTLVSA
Sbjct: 988  VIDSSILARLKQENLSLYTELILLIATVKEQRYRQILGYTLVSA 1031

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score = 1234 bits (3192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1087 (59%), Positives = 793/1087 (72%), Gaps = 65/1087 (5%)

Query: 7    RRRSNSSLSEAISVSLGI-NQDS--SINKMHRASVSAMSPPLCRSYMSGFFTGGNSPMIN 63
            +R +  S+SE+ISVSLG+ N D+  S N+     +   S  L RSY+SG ++       N
Sbjct: 10   KRPARQSISESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLWSPTQRN--N 67

Query: 64   SMSDSKLPLSNKQ-HPKVIHGSENLHRQTAQLSNEFCSSSVEENSPT--IKDYMDIIDSG 120
                  LP SN+Q + K IH S+ LHRQT  +   F  S+ +E S    + +Y+D+++  
Sbjct: 68   KSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDLVEHN 127

Query: 121  DRKD------DQ-----------------SMRTXXXXXXXXXXXXXXRLLLSPASS---N 154
            +RK       DQ                    T              RLLL+P SS    
Sbjct: 128  ERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTPVSSLSVA 187

Query: 155  IND----------DRNRGLQNGLTSELEDDYEGGYQSLRS--SHNLRSRPRNFRRL--CT 200
            I+D           R R   NG+ S     Y     +L S  S  ++  P    +    +
Sbjct: 188  ISDASSLTPEDYNGRARSPLNGINST----YGSQIPTLSSYSSAGMKIGPPITSKWDYIS 243

Query: 201  SFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAV 260
            +     +HYLPA++LGLLLNILDALSYGMIIFPITEP+FS LGP+G+SMFYIST+ISQ  
Sbjct: 244  ALSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGLSMFYISTVISQFT 303

Query: 261  YSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGD-DDEIITTTIFCYVISSMLTGTV 319
            YS G SSFP GIGSEMIE+TPF+HTMAL + + L  +  +EIITTTIFCYVISSM TG  
Sbjct: 304  YSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMFTGLT 363

Query: 320  FYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNY 379
            F+ LGKL+LGK+VGFFPRHILIGCIGGVGYFL+ITGIEV TR+AKFEYS PF L LFT+ 
Sbjct: 364  FFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLFTDE 423

Query: 380  DTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGW 439
             TL +WLLP +LT+ILI TQ  F+NSLVLPSFYILTL+LFHFIVAI+P LSL  LR +GW
Sbjct: 424  KTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNSGW 483

Query: 440  IFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMD 499
            IFP+A S+  WYDHYK FN   VHW+LV++QIPTMMALTFFGILHVPINVPALAMSLQMD
Sbjct: 484  IFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSLQMD 543

Query: 500  KYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMI 559
            KYDVDRELIAHGYSNFFSGL GS++NYLVYTNSVLFIRAGADS+ AG++LI LTI +M+I
Sbjct: 544  KYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYILIVLTIIVMLI 603

Query: 560  GPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGI 619
            GPVIISFIPICIVGSLIFLLGYELL+EAL+DTW KLN FEY+TV II+ TMGIFDFVLGI
Sbjct: 604  GPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGI 663

Query: 620  IVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLL 679
            IVGILIACF FL+DST LQT+NGE++G VAKSTVYRD +QT FLDG+GEQIYVLKLQNLL
Sbjct: 664  IVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQNLL 723

Query: 680  FFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTET 739
            FFGTI+SIEEKI+KLL+ISN D++KRRIKYLILDFKNIN DNIDYSAAEGFNRI+RFT+T
Sbjct: 724  FFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRFTQT 783

Query: 740  KKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRIKAKER 799
            K I+LIISSIRE+D IY AFNNVGLL DVELF DLNS+LEWCENE L  Y +LR KAK R
Sbjct: 784  KGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKAR 843

Query: 800  LEERKQNNIVSAVMA---ATQXXXXXXXXXXXXXXXXXDPVRNLMSLPTNTPRNYQMLSV 856
            L  RK NN  ++V++    +                    + NLMSLPTNTPRN+QML+V
Sbjct: 844  L--RKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQMLTV 901

Query: 857  AQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEIQKVREKEIKFWAQLCP 916
            AQ+VF NDEQ V + +K+ K  +P+LP+LL  LKQYRPDI S  +  R+KEI  W++LCP
Sbjct: 902  AQDVFKNDEQTVSSLRKQLKTKDPLLPLLLLTLKQYRPDIGSNDKLARDKEIAIWSRLCP 961

Query: 917  YFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAM- 975
            YF ++ + +Q+ L H + +FFLV+TG+LKA ++LPQG +YE  +N TC+GKII  G  + 
Sbjct: 962  YFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTVD 1021

Query: 976  ------PREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCIKDTRFKELL 1029
                  P   KL I TETDS LWVID++++ +++ E+  L++++AL+VM IKD RFK+LL
Sbjct: 1022 DADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDLL 1081

Query: 1030 GYTLVSA 1036
            G+ L+SA
Sbjct: 1082 GHALISA 1088

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1218 bits (3151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/1051 (60%), Positives = 767/1051 (72%), Gaps = 62/1051 (5%)

Query: 7    RRRSNSSLSEAISVSLGI-NQDSSINKMHRASVSAMSPPLCRSYMSGFFTGGNSPMINSM 65
            R     SLS++IS SLG+ +Q+S+I        ++ S  L RSYM G         +  +
Sbjct: 11   RASKRLSLSDSISRSLGLQDQESNIAGTDNELSNSKSNYLSRSYMYGLLPSATP--VEEL 68

Query: 66   SDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSGDRKDD 125
              + LPLSN    K IH S  LH+QTA +  +F     E +  ++KDY+D I++ DR + 
Sbjct: 69   ETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFN----ESDEGSMKDYLDFIENTDRDNI 124

Query: 126  QSMRTXXXXXXXXXXXX--------XXRLLLSPASSNINDDRNRGLQNGLTSELEDDYEG 177
               +                       RLLL+P+SSN              S + +    
Sbjct: 125  NEHKESLPVTVVLSTPADEVEEQDESSRLLLTPSSSNAE-----------VSSIAEGLRH 173

Query: 178  GYQSLRSSHN-----LRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIF 232
             Y S+ S+ +        +        ++F    + Y PA+VLGLLLNILDALSYGMIIF
Sbjct: 174  HYSSIESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIF 233

Query: 233  PITEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKE 292
            PI+EP+FSHLGPTG+SMFYISTII Q +YS G SSFPS IGSEMIEITPF+HTMA A+  
Sbjct: 234  PISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMR 293

Query: 293  ALAGDD--DEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYF 350
            +L G++  D IITTTIFCYVISSM TG  F  LGKL+LGKIVGFFPRHILIGCIGGVGYF
Sbjct: 294  SLPGEENQDAIITTTIFCYVISSMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYF 353

Query: 351  LIITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPS 410
            L+ITGIEVTTR+AKFEYS P    LFT+   L KWL P +LTV+LI TQ+ FK SLVLPS
Sbjct: 354  LLITGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPS 413

Query: 411  FYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQ 470
            FYI TL+LFHFIVAIIP LSL  LR AGWIF     +S WYDHYKLF+ HKVHW LV +Q
Sbjct: 414  FYIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQ 473

Query: 471  IPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYT 530
            IPTM+ALTFFGILHVPINVPALAMS+QMDKYDVD+ELIAHG SN  SG+ GS+QNYLVYT
Sbjct: 474  IPTMLALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYT 533

Query: 531  NSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALID 590
            NSVLFIRAGADS FAG+LLI LTI +M+IGPVIISFIPICIVGSLIFLLGYELLVEAL+D
Sbjct: 534  NSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLD 593

Query: 591  TWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAK 650
            TW+KL  FEY+TVV+IV TMGI DFVLGIIVGILIACF FL+DS+KLQTINGE++G VAK
Sbjct: 594  TWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAK 653

Query: 651  STVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYL 710
            STV RD +Q+KFL+GIG+QIYVLKLQNLLFFGTI+SIEEKI+KLL++S+++++KR+IKYL
Sbjct: 654  STVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYL 713

Query: 711  ILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVEL 770
            ILDF+NINADNIDYSAAEGFNRIKR TE+K I+LIISSI+ RDRIYN+FN VGLL  VEL
Sbjct: 714  ILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVEL 773

Query: 771  FADLNSALEWCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQXXXXXXXXXXXXX 830
            F DLN ALEWCENEFL+QYK +R       E  K  N+ +A  ++               
Sbjct: 774  FNDLNGALEWCENEFLYQYKMIR-------ERIKIKNVKTATHSSDGNLSKP-------- 818

Query: 831  XXXXDPVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALK 890
                    + M+L  NTPRNYQ+ SVAQN+F N+EQ V   K  ++D  PVLP+LLFALK
Sbjct: 819  --------SAMTLSINTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALK 870

Query: 891  QYRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYEL 950
            QYRPDI+S  +  + KEI+FW+QL PYF+++R+ASQS+L H +N+FFLVE G+LK T++L
Sbjct: 871  QYRPDIVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDL 930

Query: 951  PQGTLYEIFSNGTCFGKI-----IAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEE 1005
            PQG +YE  S   C+GKI     ++  +A P  Q + I+TE D+++W+IDSS+LKKMK+E
Sbjct: 931  PQGKVYETMSKRACYGKIMGKIPVSEADA-PSSQAMIIKTEADTVIWIIDSSALKKMKDE 989

Query: 1006 NLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            N+ LY+E+ L+VM IKD RFK LLG+ LVS 
Sbjct: 990  NIELYLELVLLVMTIKDIRFKSLLGHALVST 1020

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score = 1188 bits (3074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/1089 (57%), Positives = 782/1089 (71%), Gaps = 94/1089 (8%)

Query: 2    GRTIRRRRSNSSLSEAISVSLGINQD----------------SSINKMHRASVSAMS-PP 44
            G+    RR   S SEA+SVSLG+++                 S  N    +SVS      
Sbjct: 9    GQDSSNRRVRPSFSEALSVSLGLHEQGIGAGRTRSNLAPNSYSGYNDNTTSSVSNREFGR 68

Query: 45   LCRSYMSGFFTGGNSPMIN-SMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSV 103
            + RSY     +   S  +N S +D  LP+  K   K I G + LHRQTA++SN+F  +S+
Sbjct: 69   IGRSYAGSISSNSPSLYLNTSRTDELLPI-RKMPSKSILGPDALHRQTAEISNDFNDTSM 127

Query: 104  EENSPTIKDYMDIIDSGDRK---------------------DDQSMRTXXXXXXXXXXXX 142
            +E    IK Y+++++   RK                     + +S  +            
Sbjct: 128  DE--AKIKRYIELLN---RKQIEAEEEGEESAVHLRPHTFIEGKSFLSPIGSSASQLDGL 182

Query: 143  XXRLLLSPASSNINDDRNRGLQNGLTSELEDDYEGGYQSLRSSHNLRSRPRNFRRLCTSF 202
              R LL+P+SS + +              E D E  Y  + + +N   R ++     +SF
Sbjct: 183  EQRALLTPSSSIVGN--------------EFDLESTYDEINNDYNSILRIQSRELTSSSF 228

Query: 203  PSK---FIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQA 259
             +K    ++YLPAA+LGLLLNILDALSYGMIIFPITEP+FS LGPTGISMFYISTI+ Q 
Sbjct: 229  ATKGLELLNYLPAAILGLLLNILDALSYGMIIFPITEPLFSGLGPTGISMFYISTIVCQL 288

Query: 260  VYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDEIITTTIFCYVISSMLTGTV 319
            V SGG SSFP GIGSEMIEITPFYHTMA A+K+AL   D+E+ITTTIFCYVISS++TG V
Sbjct: 289  VLSGGFSSFPCGIGSEMIEITPFYHTMAFAIKDALPNQDNEVITTTIFCYVISSVVTGLV 348

Query: 320  FYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNY 379
            F++LGKL++GKIVGFFPRHILIGCIGGVGYFLIITGIEV+TR+ KFEY+W F L L TN 
Sbjct: 349  FFMLGKLKMGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRIGKFEYNWEFLLSLLTNL 408

Query: 380  DTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGW 439
            DTL KWLLP +LT+ LI  QR  +NSLVLPSFYILT++LFHFIVAI+P LSLD LR  GW
Sbjct: 409  DTLGKWLLPTLLTLSLILIQRQVQNSLVLPSFYILTIILFHFIVAILPNLSLDHLRENGW 468

Query: 440  IFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMD 499
            IFP+ +S + WYDHYK FN+H +HW LVL+QIPTM+ALTFFGILHVPINVPALAMSL MD
Sbjct: 469  IFPVTDSKNSWYDHYKYFNLHDIHWGLVLKQIPTMLALTFFGILHVPINVPALAMSLHMD 528

Query: 500  KYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMI 559
            KYDVDRELIAHGYSN  SGLLGSVQNYLVYTNSVLFIRAGADSS AGFLL+ALT+ +M+ 
Sbjct: 529  KYDVDRELIAHGYSNLISGLLGSVQNYLVYTNSVLFIRAGADSSSAGFLLVALTVVVMVA 588

Query: 560  GPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGI 619
            G VI+SFIP+CIVGSLIFLLGYEL+VEAL+DT   +  FEY+T++IIVF MGI+DFVLGI
Sbjct: 589  GSVIVSFIPVCIVGSLIFLLGYELMVEALVDTIGTVTSFEYITILIIVFIMGIYDFVLGI 648

Query: 620  IVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLL 679
            IVGILIAC SF+VD TKL+TINGEY+G VAKSTVYRDY+QTKFL+GI +QIY+LKLQN+L
Sbjct: 649  IVGILIACLSFMVDGTKLETINGEYDGQVAKSTVYRDYIQTKFLNGIRQQIYLLKLQNVL 708

Query: 680  FFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTET 739
            FFGTI+SIEEKI+KLL+IS+KD +KRRIKYLILDFKNINADNIDYSAAEGFNRIKRFT+ 
Sbjct: 709  FFGTIISIEEKIDKLLEISDKDPSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQG 768

Query: 740  KKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRIKAKER 799
            K+I+LIISSI+E+D+IY+ FN V LL DVELF DLNSALEWCENEFL+QY QL  KAK+R
Sbjct: 769  KRIQLIISSIKEKDKIYSVFNMVRLLEDVELFDDLNSALEWCENEFLYQYMQLHEKAKDR 828

Query: 800  LEER------------KQNNIVSAVMAATQXXXXXXXXXXXXXXXXXDPVRNLMSLPTNT 847
            + +R             +N   S + AA Q                    + LMSLP NT
Sbjct: 829  IHKRISISKDSGSTYFSRNRSDSGLSAADQ--------------------QMLMSLPINT 868

Query: 848  PRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEIQKVREKE 907
            PRN Q+LSVA+ VF N+ Q    FK   + D+PVL +LL++++ +RPD+ SE   +REKE
Sbjct: 869  PRNNQVLSVARKVFKNEAQTASKFKTHNETDKPVLSLLLYSIRLFRPDVFSEDVSIREKE 928

Query: 908  IKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFSNGTCFGK 967
            I FW QL PYF R    + S L+++ N FF+VE+G+++ T++LPQG + E  SN TC+GK
Sbjct: 929  INFWGQLSPYFRRSLFPTGSTLVNSSNFFFVVESGVVRVTHDLPQGIVSETMSNRTCYGK 988

Query: 968  IIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCIKDTRFKE 1027
            ++     +    K+  +TET+SI+W+ID  ++ ++K+ENL LY E+ L+VM I++ R+K 
Sbjct: 989  VVGHRGTVTNLPKIIFKTETESIIWMIDDDTMSRIKKENLNLYTELLLLVMTIREYRYKG 1048

Query: 1028 LLGYTLVSA 1036
            L+GYTLVSA
Sbjct: 1049 LIGYTLVSA 1057

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1182 bits (3058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1085 (57%), Positives = 777/1085 (71%), Gaps = 94/1085 (8%)

Query: 8    RRSNSSLSEAISVSLGINQDSSINKMHRASVSAMSPP------LCRSYMSGFFTGGNSPM 61
            +++  S+SEAI++SLG++ D+          S+M+P       L RSY+ G F+  +   
Sbjct: 4    KKNRKSISEAITISLGLHSDNIKQPSQANRRSSMNPENSSNYYLGRSYV-GSFSSPSFLQ 62

Query: 62   INSMSDSKLPLS-NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSG 120
              S +D+   LS +K   K IH S  LHRQTA LSN F     +++S    D +D+  S 
Sbjct: 63   RESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNF-----DDSSDGKSDEIDVAASQ 117

Query: 121  DRKDDQSMR------------------------TXXXXXXXXXXXXXXRLLLSPASSNIN 156
            + +++   R                        +                LLSP S+   
Sbjct: 118  EFQNEALQRELSLENGSYSNSNNNNNNNNQIAYSEDAITQENNGLNECTRLLSPTSAAAT 177

Query: 157  DDRNRGLQNGLTSELEDDYEGGYQSLRSSHNLRS---------------------RP--R 193
            D         L+       +  Y SL + H+  S                     +P  R
Sbjct: 178  DLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQPVVR 237

Query: 194  NFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIS 253
            ++      +  K ++Y+PA +LGLLLN+LDALSYGMIIFPITEPVFSHLGPTG+SMFY+S
Sbjct: 238  SYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVS 297

Query: 254  TIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDEIITTTIFCYVISS 313
            TI+SQ VYS G S+F +GIGSEMIEITPF+HTMAL++  +L G DDEII+TTI CY +SS
Sbjct: 298  TILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSS 357

Query: 314  MLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFL 373
            + TG  F++LGKL+LGKIVGFFPRHILIGC+GGVGYFL+ITGIEV TRV+KFEYSWPF  
Sbjct: 358  IFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLR 417

Query: 374  GLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDT 433
             LF N + L KW+LP+ILT+ LI TQ YF NSLVLPSFYI+TL LFHF+VAI+P LSL++
Sbjct: 418  ELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNS 477

Query: 434  LRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALA 493
            LR +GWIFP+A S + WYD YKL++   VHW+LVL+Q+PTM+ALTFFGILHVPINVPALA
Sbjct: 478  LRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALA 537

Query: 494  MSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALT 553
            MS+ MDK+DVD+ELIAHGYSN  SG  GS+QNYLVYTNS LFIRAG+DSS+AGFLL   T
Sbjct: 538  MSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGT 597

Query: 554  ICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIF 613
              +M+IGPVIISFIPICIVGSLIFLLGYEL+ EAL DTW KLNRFEY+T+VIIVFTMG+F
Sbjct: 598  FVVMIIGPVIISFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVF 657

Query: 614  DFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVL 673
            DFVLGIIVGILIACFSFLVDSTKLQTINGE+NG VA+STVYRDY+QTKFL+ +GEQI+VL
Sbjct: 658  DFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVL 717

Query: 674  KLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRI 733
            KLQNLLFFGTI+SIEEKI+ LL+IS+KD++++RIKYLILDFKNINADNIDYSAAEGFNRI
Sbjct: 718  KLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRI 777

Query: 734  KRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLR 793
            KRFTETK+I+LIISSI E+DRIYNAFN VGLL DVELFADLNSALEWCENEFL QYKQ+R
Sbjct: 778  KRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIR 837

Query: 794  IKAKERLE-ERKQNNIVSAVMAATQXXXXXXXXXXXXXXXXXDPVRNLMSLPTNTPRNYQ 852
             + K +L+ ++KQ   +S  +                             LP NTPRN Q
Sbjct: 838  TRTKAKLQAQKKQEKHLSKSL-----------------------------LPINTPRNNQ 868

Query: 853  MLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEIQKVREKEIKFWA 912
            +++VAQ +F  DEQ V + + +Y+  EPVLP+LL ALK++RP I+S  + V++ E  FW+
Sbjct: 869  IVTVAQKIF-PDEQNVTHLRTQYQKREPVLPLLLVALKKFRPQIMSYDKDVKQAEEDFWS 927

Query: 913  QLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPG 972
            +LCPYF R+R A  SLLLH +N+FFLVE+GMLK TY+L QG  YE  S+ TC+G+I   G
Sbjct: 928  KLCPYFVRKRFAPGSLLLHNNNLFFLVESGMLKITYDLHQGQFYETMSSKTCYGRI--SG 985

Query: 973  NA-MPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCIKDTRFKELLGY 1031
            NA       + I+TETD  +W+ID+++L  +KE+NLALY E+ L+VM I   R KELLGY
Sbjct: 986  NAEFTTNLYVNIKTETDCAVWIIDATNLANLKEKNLALYAELLLVVMSINQYRSKELLGY 1045

Query: 1032 TLVSA 1036
            +LVS+
Sbjct: 1046 SLVSS 1050

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score = 1162 bits (3007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/1059 (56%), Positives = 758/1059 (71%), Gaps = 43/1059 (4%)

Query: 6    RRRRSNSSLSEAISVSLGINQDSSINKMHRASV--------------SAMSPPLCRSY-- 49
            + RR +SS SEA+SVSLG+ +  ++    RA+V              ++++ P   S   
Sbjct: 6    KERRVSSSFSEALSVSLGLQEQGNLRSTERANVKRNAIFDEFPLESTNSLTLPDSMSMKN 65

Query: 50   ----MSGFFTGGNSPMINSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEE 105
                ++      NS      +DS  P  NK   K I  ++ LHRQTA+LS  F  S+  +
Sbjct: 66   NTVNINDKLVPDNSKNRTFYNDSIYPPENKTSMKSITVADILHRQTAELSKTFYDSNFTD 125

Query: 106  NSPTIKDYMDIIDSGDRKDDQSMRTXXXXXXXXXXXXXXRLLL-SPASSNINDDRNRGLQ 164
                +KDY+DIID+     ++S                 RL + +  S NI DD    L 
Sbjct: 126  KD--VKDYIDIIDNDVATSNESDSNSTPEPYLGDEYDQHRLAIRTQKSPNIADDEQSRLL 183

Query: 165  NGLTSEL--EDDYEGGYQSLRSSH-NLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNI 221
               +S +  E D E  Y        +  S  R        F S+ +HY PAAVLGLLLNI
Sbjct: 184  TPSSSIIGAELDLEAHYDEFEPVRMDASSINRQNESKLIDF-SQILHYFPAAVLGLLLNI 242

Query: 222  LDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITP 281
            LDALSYGMIIFPITEP+F+++G  GISMFYIS+II Q + SGG SSFP+GIGSEMIEITP
Sbjct: 243  LDALSYGMIIFPITEPIFANMGTAGISMFYISSIICQYILSGGFSSFPTGIGSEMIEITP 302

Query: 282  FYHTMALAVKEALAGDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILI 341
            FYHTMALA+K +L   + EII+TTIFCYVISS++TG VFY LGKL+LGKIV FFPRHILI
Sbjct: 303  FYHTMALAIKNSLDVQE-EIISTTIFCYVISSLVTGLVFYSLGKLKLGKIVAFFPRHILI 361

Query: 342  GCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRY 401
            GCIGGVGYFL++TG+EVTTRVAK EYSW F   L ++++ + KWL P++LT ILI TQ +
Sbjct: 362  GCIGGVGYFLVVTGLEVTTRVAKVEYSWEFLSYLLSDFNIIGKWLTPILLTTILIFTQHH 421

Query: 402  FKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHK 461
            F+NSLVLPSFYI+T++LFHFIVA++P LSL+ LR +GWIFP+ NS+ KW+DHYK FNV+ 
Sbjct: 422  FQNSLVLPSFYIITIILFHFIVALVPMLSLNKLRDSGWIFPLTNSNDKWFDHYKYFNVYN 481

Query: 462  VHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLG 521
            V W L+L+Q+PTM+ALTFFGILHVPINVPALAMSL +DK+DVDRE IAHGYSNF SGL G
Sbjct: 482  VSWVLILKQMPTMLALTFFGILHVPINVPALAMSLNIDKFDVDREFIAHGYSNFLSGLFG 541

Query: 522  SVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGY 581
            SVQNYLVYTNSVLFIRAGADS  AG+LLI LT  +M+IGPVIISFIPICIVGSLIFLLGY
Sbjct: 542  SVQNYLVYTNSVLFIRAGADSPIAGYLLIVLTAIVMLIGPVIISFIPICIVGSLIFLLGY 601

Query: 582  ELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTIN 641
            ELL+EAL+DT  K+  FEY T++IIVFTMGI+DFVLGIIVGIL+AC  F+VD TKLQTIN
Sbjct: 602  ELLIEALLDTVGKVTFFEYTTIIIIVFTMGIYDFVLGIIVGILLACIKFMVDGTKLQTIN 661

Query: 642  GEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKD 701
             EY+G +AKSTVYRD++Q+KFLDGIGEQIY++KLQN+LFFGTI+SIEEKI+ LLQ+S+ D
Sbjct: 662  TEYDGTIAKSTVYRDFIQSKFLDGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQLSDSD 721

Query: 702  ATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNN 761
            ++K RI+YLILDFKNIN DNIDYSAAEGFNRIKRFT  + IKLIISSI   D+IY AFN 
Sbjct: 722  SSKHRIRYLILDFKNINDDNIDYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIYKAFNK 781

Query: 762  VGLLNDVELFADLNSALEWCENEFLFQYKQLRIKAKERLEER----KQNNIVSAVMAATQ 817
            +GLL D+ELF+DLN+ LEWCEN++L +Y++L  KAK+RL  R    +  NI S  + +T 
Sbjct: 782  IGLLQDIELFSDLNNGLEWCENKYLEKYRELHEKAKKRLHSRMSILQDKNISSRQINSTS 841

Query: 818  XXXXXXXXXXXXXXXXXDPVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKD 877
                                + LMSLP NTPRN+Q+LSVA+NVF N+ QAV  FK     
Sbjct: 842  SDGNEYQSS-----------QRLMSLPLNTPRNHQLLSVARNVFKNETQAVSRFKNLDNG 890

Query: 878  DEPVLPILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFF 937
            ++    +LL +++++RPD+ SE + +R +EIKFW QL PYF +  + + S  L+ +N FF
Sbjct: 891  EDAFTQLLLQSIRRFRPDVFSESKDIRAQEIKFWTQLAPYFNKIFVETNSTFLNENNFFF 950

Query: 938  LVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSS 997
            L+++G++K T++L  G L E   + T +G + +  N   +  K+T   ET S++W+IDS 
Sbjct: 951  LLDSGVIKVTHDLAPGKLSETMLSRTSYGILSSKNNRTYKTHKVTFIPETKSVIWLIDSE 1010

Query: 998  SLKKMKEENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
             LKKM++ENL LY E+ L++M I D RFK LLGYTLV+A
Sbjct: 1011 GLKKMEKENLKLYSELTLLIMSISDYRFKALLGYTLVNA 1049

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score = 1127 bits (2916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/897 (62%), Positives = 689/897 (76%), Gaps = 17/897 (1%)

Query: 145  RLLLSPASSNINDDRN----RGLQNGLTSELEDDYEGGYQSLRSSHNLRSRPRNFRRLCT 200
            RLL +P+ S I DD N        N  +++LE++         ++   +S   +F+ + T
Sbjct: 266  RLLPTPSPS-IYDDENALFFSSSNNYDSTDLENNNYISSSIPTTTDVTQSTSLSFKDMLT 324

Query: 201  SFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAV 260
                + +H +PA +LGLLLNILDALSYGMI+FPIT+ VF HLGPTG+SMFYISTIISQ V
Sbjct: 325  KHSLQILHDIPACILGLLLNILDALSYGMILFPITDSVFGHLGPTGLSMFYISTIISQLV 384

Query: 261  YSGGCSSFPSGIGSEMIEITPFYHTMALAVKEAL-AGDDDEIITTTIFCYVISSMLTGTV 319
            YSGG S+FPSG+G EMIEI PF+HTMAL VK ++ + D +EIITTTIFCYVIS + TG V
Sbjct: 385  YSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTTIFCYVISCIFTGIV 444

Query: 320  FYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNY 379
            F+ LGK +LGK+VGFFPRHILIGCIGGVGYFLI+TGIEVTTRV K EYS  F L + TN 
Sbjct: 445  FFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLEYSLEFLLSVITNM 504

Query: 380  DTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGW 439
             TL K +LP+ L+V+L   Q+ + +SL+LPSFYI+T + FHFIVA++P LSLD+LRA GW
Sbjct: 505  STLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALVPNLSLDSLRATGW 564

Query: 440  IFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMD 499
            IFP+A S   WY HYK FN    HW LV +QIPTM ALTFFGILHVPINVPALAMS+QMD
Sbjct: 565  IFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVPINVPALAMSVQMD 624

Query: 500  KYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMI 559
            KYDVD+ELIAHGYSN  SGL GSVQNYLVYTNSVLFIRAG +++ AG +L   T  I+ I
Sbjct: 625  KYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFI 684

Query: 560  GPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGI 619
            GPVIISFIP+CIVGSLIFLLG+EL+VEAL+DTW K+ +FEY+T++IIVFTMGI+DFVLGI
Sbjct: 685  GPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMGIYDFVLGI 744

Query: 620  IVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLL 679
            +VGILIACFSFLVDSTKLQT+NGE+NG VAKSTVYRDYVQ++FL GI EQIYVLKLQN+L
Sbjct: 745  LVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQIYVLKLQNVL 804

Query: 680  FFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTET 739
            FFGTI+SIEEKI+ LL+IS+ D++KRRIKYLILD KN+N+DNIDYSAAEGFNRIKRFT++
Sbjct: 805  FFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNSDNIDYSAAEGFNRIKRFTQS 864

Query: 740  KKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRIKAKER 799
            K+I+LIISSI++ D+IY  FNNV LL +VELF+DLN ALEWCENEFL+QY+Q+       
Sbjct: 865  KRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDLNGALEWCENEFLYQYRQV------- 917

Query: 800  LEERKQNNIVSAVMAATQXXXXXXXXXXXXXXXXXDPVRNLMSLPTNTPRNYQMLSVAQN 859
                K      A   AT                  +  ++  +LP NTPRN+QM+SVA+N
Sbjct: 918  ----KNKARARAKRKATSRDVVRTGYLSTSVSNTLNDRKSSGNLPINTPRNHQMVSVAKN 973

Query: 860  VFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFT 919
            +F N EQ V++F        PVL +L+FALKQYR DI S+  KVR+KE++FW+QLCPYFT
Sbjct: 974  IFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDKEVEFWSQLCPYFT 1033

Query: 920  RRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQ 979
            ++ LA+++ LLH +NVFF+VE+G+LK  + LPQG++YE  SN TC+G+I+  G       
Sbjct: 1034 KQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYGRILGKGYLKKSTS 1093

Query: 980  KLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
             L I+ ETD I+W+I+S  L KMK ENL LY E+ L+VM +KD RF  LLGY L+SA
Sbjct: 1094 PLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLLVMSVKDDRFNNLLGYALISA 1150

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 37/62 (59%), Gaps = 11/62 (17%)

Query: 48  SYMSGFFTGGNSPMINSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENS 107
           S  + +FT G    +NS +D  LP+ N      IHGS+NLH++TA++SNEF       NS
Sbjct: 105 SNSNNYFTHG----LNSNND-HLPVINPFPKSSIHGSDNLHKRTAEISNEF------NNS 153

Query: 108 PT 109
           PT
Sbjct: 154 PT 155

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score = 1127 bits (2914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/1060 (56%), Positives = 749/1060 (70%), Gaps = 83/1060 (7%)

Query: 7    RRRSNSSLSEAISVSLGINQDSS-------INKMHRASVSAMSPP---LCRSYMSGFFTG 56
            R ++  S+SEAISVSLG+   S+       I + +  S +    P   L RSY++     
Sbjct: 5    RPKNKPSISEAISVSLGLQSQSNSDQDSSYIPRANPFSHTGDGSPHYYLGRSYVANL--- 61

Query: 57   GNSPMINSMSDS---KLPLSNK-QHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKD 112
             + P +  +      +LPLS + +  + IH S +L RQTA LSNEF      E++   +D
Sbjct: 62   -SPPPLARLPGGLPGELPLSYRPEQSQSIHQSVSLRRQTAALSNEF------EDTFEFED 114

Query: 113  YMDIIDSGDRKDDQSMRTXXXXXXXXXXXXXXRLLLSPASS------NINDDRNRGLQNG 166
             +    +G  +DD    T                L+SP SS      +IN+  N  L   
Sbjct: 115  QL----AGVSEDDGHSTTAEEPSMNGT-------LISPVSSVPDTPIDINEPSNALLPPN 163

Query: 167  LTSELE----DDYEGGYQSLRS------SHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLG 216
               +LE    D YE  Y SL+S      +HN+     + R        + ++Y+PA +LG
Sbjct: 164  AEHDLEYGSIDGYEHQYVSLQSRRSGANTHNI-GPDASLREKMMFTARRMVNYMPAVILG 222

Query: 217  LLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEM 276
            LLLNILDALSYGMIIFPITEP+FSHLGPTG+SMFY+S+IISQ +YSGG S+F + +GSEM
Sbjct: 223  LLLNILDALSYGMIIFPITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEM 282

Query: 277  IEITPFYHTMALAVKEALAGDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFP 336
            IEITPFYH MA ++   L G+ D +++TTI CY +SS++TG VF++LG+L+LGKIVGFFP
Sbjct: 283  IEITPFYHAMAASIVAGLPGEKDRVLSTTIVCYALSSIITGLVFFLLGRLRLGKIVGFFP 342

Query: 337  RHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILI 396
            RHILIGCIGGVGYFL+ITG+EVTTRVAKFEYS+ F   LFTN + L KW LP ++ V+L+
Sbjct: 343  RHILIGCIGGVGYFLLITGLEVTTRVAKFEYSFEFLSSLFTNIEVLGKWGLPALMAVLLV 402

Query: 397  GTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKL 456
              Q  F NSLVLP+FYI  L+LFHFIVA+IP+LSLD LR +GWIFP  +S   W+D Y L
Sbjct: 403  VVQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTL 462

Query: 457  FNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFF 516
            +N   V W ++L+QIPTM+ALTFFGILHVPINVPALAMS+ +DK DVD+ELIAHGYSNF 
Sbjct: 463  YNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFL 522

Query: 517  SGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLI 576
            SG++GSVQNYLVYTNSVLFIRAG D + AG +L A T  IM++GPVI+++IP+CIVGSLI
Sbjct: 523  SGIMGSVQNYLVYTNSVLFIRAGGDDALAGLMLAAATFGIMIVGPVIVAYIPVCIVGSLI 582

Query: 577  FLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK 636
            FLLGYELL EAL DTW KLN FEY TVV IVFTMG FDFVLGIIVGILIACFSFLVDSTK
Sbjct: 583  FLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTK 642

Query: 637  LQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQ 696
            LQT+NGE++G VA+STV RDY+QT+FL+ IGEQI+VLKLQNLLFFGTILSIEEKI+KLL+
Sbjct: 643  LQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLE 702

Query: 697  ISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIY 756
            +S+KD++K+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +K+I LIISSI+  DRIY
Sbjct: 703  LSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIY 762

Query: 757  NAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAAT 816
             AFN VG+L  VELF DLNSALEWCENEFL Q+K LR K K +   +KQ+  +S V    
Sbjct: 763  RAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLRNKTKLK-AGKKQDRRMSKV---- 817

Query: 817  QXXXXXXXXXXXXXXXXXDPVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYK 876
                                      LP NTPRN Q +SVAQ +F  DEQ++ + K  Y+
Sbjct: 818  -------------------------PLPFNTPRNNQFVSVAQKLF-TDEQSMTHLKSSYR 851

Query: 877  DDEPVLPILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVF 936
            +  PVLP+LL AL+++RP I+S  + V+E E + W+ LC YF ++RLA+ SLLLH DN+F
Sbjct: 852  ERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIF 911

Query: 937  FLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDS 996
            F++ETGM+K TY L QG LYE  S  TC+G++  P N       + +E ETD  LW+ID 
Sbjct: 912  FVIETGMVKVTYNLRQGQLYETMSGKTCYGRMSIPNNNNNPISCVEVEMETDCSLWIIDD 971

Query: 997  SSLKKMKEENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            + L K+K ENL LY EV L+ +CI   R KELLG+ LVS+
Sbjct: 972  AGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score = 1116 bits (2886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/1053 (55%), Positives = 741/1053 (70%), Gaps = 70/1053 (6%)

Query: 7    RRRSNSSLSEAISVSLGINQDS-------SINKMHRASVSAMSPP---LCRSYMSGFFTG 56
            R R+  SLSEAISVSLG+           S+ + +  S  A   P   L RSY++     
Sbjct: 5    RPRNKHSLSEAISVSLGLQSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVANL--- 61

Query: 57   GNSPMINSMSDSKLPLSNK--QHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYM 114
               P+      S  P S+   +  + IH S +L RQTA LSNEF  +   E+        
Sbjct: 62   SPPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFED-----QLE 116

Query: 115  DIIDSGDRK-DDQSMRTXXXXXXXXX--------XXXXXRLLLSPASSNINDDRNRGLQN 165
            D+ ++G+    D+S+                         LLL P       +  R L+ 
Sbjct: 117  DLAENGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPP-------NTQRDLEY 169

Query: 166  GLTSELEDDYEGGYQSLRSSHNLRS-RPRNFRRLCTSFP-SKFIHYLPAAVLGLLLNILD 223
            G   E +  Y    QS R+  N R+  P    R  T F   +  +Y+PA +LGLLLNILD
Sbjct: 170  GSIDEFDHQYVS-LQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVILGLLLNILD 228

Query: 224  ALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFY 283
            ALSYGMIIFPITEP+FSHLGP+G+SMFY+S+++SQ VYS G S+F + +GSEMIEITPFY
Sbjct: 229  ALSYGMIIFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFY 288

Query: 284  HTMALAVKEALAGDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGC 343
            H+MA ++  ++ G+ D ++TTTI CY +SS++TG VF++LG+L+LGKIVGFFPRHILIGC
Sbjct: 289  HSMAASIMASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGC 348

Query: 344  IGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFK 403
            IGGVGYFL+ITG EVTTR +KFEYS+ F   L T+ + L KW LP ++ V+L+  QR  K
Sbjct: 349  IGGVGYFLVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACK 408

Query: 404  NSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVH 463
            NSLVLP+FYI  L+LFHFIVA+IP+LSL +LR +GW+FP   +   W+D YKL+N   V 
Sbjct: 409  NSLVLPTFYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVS 468

Query: 464  WSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSV 523
            W LVL+Q+PTM+ALTFFGILHVPINVPALAMS+ +DK DVD+ELIAHGYSNF SG++GSV
Sbjct: 469  WPLVLKQVPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSV 528

Query: 524  QNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYEL 583
            QNYLVYTNS+LFI+AGAD S AG +L A T  IM+IGPVI+++IP+CIVGSLIFLLGYEL
Sbjct: 529  QNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYEL 588

Query: 584  LVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGE 643
            L EAL+DTW KLN FEY TVV IVFTMG FDFVLGIIVGILIACFSFLVDSTKLQTINGE
Sbjct: 589  LKEALVDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGE 648

Query: 644  YNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDAT 703
            ++G VA+STV RDY+QT+FL+ IGEQI+VLKLQNLLFFGTI+SIEEKI+KLL++S+KDA+
Sbjct: 649  FDGQVARSTVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDAS 708

Query: 704  KRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVG 763
            K+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +K+I LIISSI+  DRIY AFN VG
Sbjct: 709  KKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVG 768

Query: 764  LLNDVELFADLNSALEWCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQXXXXXX 823
             L+ VELF DLNSALEWCENEFL Q++ LR K K +   +++  +               
Sbjct: 769  TLDGVELFDDLNSALEWCENEFLRQFRDLRNKTKLKAVRKQERQLSKG------------ 816

Query: 824  XXXXXXXXXXXDPVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLP 883
                              +LP NTPRN   +SVAQ +F  DEQ++ + K  YK+  PVL 
Sbjct: 817  ------------------ALPFNTPRNNHFVSVAQKLFT-DEQSMPHLKTHYKEKTPVLH 857

Query: 884  ILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGM 943
            +LL AL++YRP+I+S  + V+E E K W++L  +F +RRLA+QSLL H +N+F +VE+GM
Sbjct: 858  LLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGM 917

Query: 944  LKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMK 1003
            +K TY L QG LYEI S  TC+G+I AP ++      + I+ ETD  LW++D ++L K+K
Sbjct: 918  VKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDEANLAKLK 977

Query: 1004 EENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            +ENLALY E+ L+ +C+   R KELLG+ LVS+
Sbjct: 978  KENLALYTELLLVTLCMNQDRLKELLGHCLVSS 1010

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/864 (58%), Positives = 638/864 (73%), Gaps = 47/864 (5%)

Query: 177  GGY--QSLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPI 234
            GG+  Q  RSS +   + R+          +   Y PA  LGLLLNILDALSYGMIIFPI
Sbjct: 238  GGFTSQGFRSSMSHYDKARDLML-------RIFQYTPAVGLGLLLNILDALSYGMIIFPI 290

Query: 235  TEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEAL 294
            TEP+FSHLGPTG+SMFY+ST+I Q  +S G SSFPS IGSEMIEITPF+HTMAL++  ++
Sbjct: 291  TEPLFSHLGPTGLSMFYVSTVICQLCFSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSI 350

Query: 295  A-GDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLII 353
              G+D+++I+TTI CY +SS++TG  F++LGK++LGKIVGFFPRHILIGCIGGVGYFLII
Sbjct: 351  PEGNDNKVISTTIVCYALSSIITGLTFFLLGKMRLGKIVGFFPRHILIGCIGGVGYFLII 410

Query: 354  TGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYI 413
            TG+EV TRV +F+YSW F   LFT++D L KWL PVILT+ILI  Q    NSLVLPSFYI
Sbjct: 411  TGLEVCTRVPEFKYSWQFLSSLFTDFDILLKWLTPVILTLILISVQSRIHNSLVLPSFYI 470

Query: 414  LTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPT 473
            +TL+LFHF+VA++P+LSLD LR  GWIF   N+   WYD YKL++   V WSL+ +Q+PT
Sbjct: 471  ITLLLFHFVVALVPSLSLDKLRDFGWIFAKVNAKENWYDFYKLYDFKNVQWSLIPKQVPT 530

Query: 474  MMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSV 533
            M+ALTFFGILHVPINVPALAMSL +DKYDVD+ELIAHGYSN  SG LGS+QNYLVYTNSV
Sbjct: 531  MLALTFFGILHVPINVPALAMSLNVDKYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSV 590

Query: 534  LFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWN 593
            LFIRAGADS  AG +L   T  +M+IGPVIISFIPICIVGSLIFLLGYEL+ EA+IDTW 
Sbjct: 591  LFIRAGADSPIAGIMLTIGTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWG 650

Query: 594  KLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTV 653
            KL  FEYLT+ IIV TMG+ DFV+GIIVGIL+ACFSFLV+ST+LQTINGEY+G VAKSTV
Sbjct: 651  KLQPFEYLTIWIIVITMGVVDFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTV 710

Query: 654  YRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILD 713
            YRDY+Q+KFL  IGEQIYVLKLQN+LFFGTI+SIEEK+  LL+I   D++K+RIKYLILD
Sbjct: 711  YRDYIQSKFLRNIGEQIYVLKLQNILFFGTIISIEEKVNSLLEICESDSSKKRIKYLILD 770

Query: 714  FKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFAD 773
            FKNI A +IDYSAAEGFNRIKRF E ++I LIISSI + D+IY AF+ V L  +VELF+D
Sbjct: 771  FKNIRAKSIDYSAAEGFNRIKRFLEKERIHLIISSIDKEDQIYLAFDKVRLFENVELFSD 830

Query: 774  LNSALEWCENEFLFQYKQLRIKAKER-LEERKQNNIVSAVMAATQXXXXXXXXXXXXXXX 832
            LN ALEWCENEFL +YK++R K + R L + K++                          
Sbjct: 831  LNGALEWCENEFLMRYKRIRTKTRARKLAQLKKS-------------------------- 864

Query: 833  XXDPVRNLMS-LPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQ 891
                 +N MS LP NTPRN+Q +S  +N++  +E  ++    E K+ +  LPI L ++++
Sbjct: 865  -----QNRMSKLPVNTPRNHQFVSEVRNIYT-EEMEIQKLSNELKERQQFLPIFLMSIRK 918

Query: 892  YRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELP 951
            +R  I S  +  R  E+  W +L  YF +++    + + H +N+F +VE+G+L  T+ L 
Sbjct: 919  FRNAIQSPNELKRTNELDLWKRLISYFQQKKFPPNTEIRHRNNMFIVVESGVLNLTHHLI 978

Query: 952  QGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYV 1011
            QG  YE  S  T +G +I+  N+ P    ++I T+T+ +L  ID+ SL  +K  +  L+ 
Sbjct: 979  QGEFYETMSPKTAYG-VISNVNSDPL--AVSITTDTECVLRYIDAESLADLKLTDPELFT 1035

Query: 1012 EVALMVMCIKDTRFKELLGYTLVS 1035
            E+ ++VM I   RF+ELLGY+L+S
Sbjct: 1036 ELLILVMAIHRDRFRELLGYSLIS 1059

 Score = 32.3 bits (72), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 69 KLPLSNKQHPKVIHGSENLHRQTAQLSNEF 98
          K P S+ +  K+IH S NLH+QTA LSN F
Sbjct: 70 KSPFSS-EGSKLIHESGNLHKQTAFLSNTF 98

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/1042 (51%), Positives = 682/1042 (65%), Gaps = 59/1042 (5%)

Query: 13   SLSEAISVSLGINQDSSINKMHRASVSAMSPPLCR--SYMSGFFTGGNSPMINSMS---- 66
            S+SEA+++ L I    S        VS   P L R  +Y+   + G  S   + MS    
Sbjct: 15   SISEALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVGSFSNSGSLMSREAG 74

Query: 67   ----DSK-LPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSGD 121
                DS  LP    Q    +H   +LHRQTA L ++   S   +  P  ++ +    +  
Sbjct: 75   AAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDD---SRAYDGGPEEEEALVFEGNMI 131

Query: 122  RKDDQSMRTXXXXXXXXXXXXXXRLLLSPASSNIND---DRNRGLQNGLTSELEDDYEGG 178
             ++    R                 +L      ++D   D+  G +  L S +  DY   
Sbjct: 132  LQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLFL-SPITTDYIHS 190

Query: 179  YQSL---RSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPIT 235
            Y ++   +S+    SR          + ++ + Y+PA +LGLLLNILDALSYGMIIFPI 
Sbjct: 191  YGAINEEQSASETASRAETGPSPLRLWGTRTVRYIPAVILGLLLNILDALSYGMIIFPIA 250

Query: 236  EPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALA 295
            EP+FSHLGP G+SMFY+STIISQ VYSGG SSF  G GSEMIE+TPF+HTMAL++K +L+
Sbjct: 251  EPIFSHLGPHGLSMFYVSTIISQLVYSGGFSSFGYGTGSEMIEVTPFFHTMALSIKNSLS 310

Query: 296  GD-DDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIIT 354
             +  D+IITTTI CY +S+++TG VF  LGKL+LGK+V FFP HILIGCIGGV YFLIIT
Sbjct: 311  AEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIIT 370

Query: 355  GIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYIL 414
            GIEV+TRV KFEYS  F   LF + D LAKWL+P +L V +I  QR   NS++LP FY+ 
Sbjct: 371  GIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLS 430

Query: 415  TLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTM 474
               LFHFIVA+IP+LSLDTLR  GWIFP+  S  +WYD+ +L+N  ++HW LVL +IPTM
Sbjct: 431  AFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTM 490

Query: 475  MALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVL 534
            +ALTFFGILHVPINVPALA+S  +DK DVD+ELIAHGYSN FSG  GS+QNYLVYTNSVL
Sbjct: 491  LALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVL 550

Query: 535  FIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNK 594
            FIRAGADS +AGFLL   T   M  GP IIS IP+CIV SLIFLLGYELL E L D++N+
Sbjct: 551  FIRAGADSRYAGFLLAIATFMTMTAGPWIISIIPVCIVSSLIFLLGYELLKEVLYDSYNR 610

Query: 595  LNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVY 654
            L+ FEY+TVVII+ TMGIFDFVLGIIVG+L+ACFSFLV+ST+ +TI+ E++G VAKS  +
Sbjct: 611  LSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACH 670

Query: 655  RDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDF 714
            RDY+Q+ FL+ + EQIYVLKLQN LFFGTI+SIEEKI  LL+  N    K+ IKYLILDF
Sbjct: 671  RDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLE-PNGSEYKKIIKYLILDF 729

Query: 715  KNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADL 774
            K+IN DNIDYSAAEGFNRIKR  E K+IKLI+SSI E D+IY  F+ +GLL DVELF DL
Sbjct: 730  KHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDL 789

Query: 775  NSALEWCENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQXXXXXXXXXXXXXXXXX 834
            NSALEWCENE L +Y+ L  +A      R+  +IV       +                 
Sbjct: 790  NSALEWCENELLCEYRSLLSRAHRVKVRRRSKDIVPKAQIPLE----------------- 832

Query: 835  DPVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRP 894
                       NTPRN Q+++ AQ V+  ++Q  K   K YK   P L +LL ALK YR 
Sbjct: 833  -----------NTPRNAQIMTAAQAVYSGEQQLNKTLSK-YKASHPALALLLVALKTYR- 879

Query: 895  DIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGT 954
               S       KEI+ W  LCPYF R+  + Q+ +    ++FF+VE+G+LK TY LPQG+
Sbjct: 880  ---SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGS 936

Query: 955  LYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVA 1014
            L E  ++ TC+G I  PG+         + TET+ +LW+ID+  L+K++EENL LY E+ 
Sbjct: 937  LQEAIASKTCYGNISGPGSL---SYSSVVRTETECVLWMIDAPGLQKLQEENLPLYTELL 993

Query: 1015 LMVMCIKDTRFKELLGYTLVSA 1036
            ++ + +   RFKELLG++L++ 
Sbjct: 994  VVYISVIQHRFKELLGHSLING 1015

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 129/290 (44%), Gaps = 33/290 (11%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVI 563
           +REL+A G  N  + +LG++  +  Y  S +   +GA +  +G  +  + +  +      
Sbjct: 385 NRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQ 444

Query: 564 ISFIPICIVGSLIFLLGYELLVEALID---TWNKLNRFEYLTVVIIVFTMGIFDFVLGII 620
           I +IP+CI+  +  ++G  LL EA  D    +N     E L   + V T   +   +G+ 
Sbjct: 445 IRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMGVC 504

Query: 621 VGILIACFSFLVDSTKL------------QTING-EYNGNVAKSTVYRDYVQTKFLDGIG 667
           +G   +  S +  S K             Q IN  EY   ++ +T   D    + L+G  
Sbjct: 505 IGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEY---LSSATHPDDLPNIEELEG-- 559

Query: 668 EQIYVLKLQNLLFFGTILSIEEKIEKLLQISN-------KDATKRR-IKYLILDFKNINA 719
               V+K+   L F  +  ++E++ +L +  +       K + +R  IKYL+ D   +  
Sbjct: 560 --CLVVKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMTF 617

Query: 720 DNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVE 769
             +D SAA+    I +    +++K+ ++ +   +++ +      +LN VE
Sbjct: 618 --MDSSAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVE 665

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 113/561 (20%), Positives = 224/561 (39%), Gaps = 62/561 (11%)

Query: 261 YSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDEI----------IT------T 304
           Y+   +  P   G   + I+PF + +  +V + + G +  I          IT      +
Sbjct: 130 YTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKDNVS 189

Query: 305 TIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 364
            I   ++ + ++G +    G  + G +     + +L G I  VG  +II  +    ++ K
Sbjct: 190 LIDISIVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDK 249

Query: 365 F------EYSWPFFLGLFTNYDTLAKWLLPVIL----TVILIGTQRYFKNSLVL--PSFY 412
           F       Y  PF   LF      A++  P  +      I++   R  K  L+    S  
Sbjct: 250 FLVSLPQHYHTPFEKVLFLIDYAPAQYHKPTAIFSGCCFIILIVMRLLKKKLMKRHKSAV 309

Query: 413 ILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIP 472
               +L   IV I+ ++ L +L+    I  + +     +D  K    H     L+     
Sbjct: 310 FFPDILLVVIVTILISMKL-SLKQRYGISIVGDFSMDNFDKLKNPLTHS-RRKLMPDLFS 367

Query: 473 TMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNS 532
             + +   G         +L  +  +     +REL+A G  N F  L G++ ++  Y  S
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGCINMFISLFGALPSFGGYGRS 426

Query: 533 VLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTW 592
            +   +GA S  +G  +  +T+  M +    + +IP C++  +  ++G  LL E   D  
Sbjct: 427 KINALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIK 486

Query: 593 NKLNRFEYLTVVIIVFTMGI---FDFVLGIIVGILIACFSFLVDSTK-----LQTINGEY 644
             L    Y  + +   T G+   +    GI +G + +  + +  S K     L  I G  
Sbjct: 487 FHLQCGGYSELFVFAVTFGVTIFYSIESGICIGCVYSILNIIKHSAKSRIQILARIAGTS 546

Query: 645 NGNVAKSTVYRDYVQTK-----FLDGIGEQI---YVLKLQNLLFFGTILSIEEKIEKLLQ 696
           N      T   DY++T       ++G  E+I    ++++   L F     ++++++++ +
Sbjct: 547 N-----FTNLDDYLRTTKKNPPAVEGRIEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIER 601

Query: 697 ISNKD--------ATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISS 748
             +           +K  IKY+I D   + +  ID SAA+  + I    + + + + +++
Sbjct: 602 FGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--IDSSAAQVLDEIISCYKRRNVFIYLAN 659

Query: 749 IRERDRIYNAFNNVGLLNDVE 769
           +   D+I       G+  +VE
Sbjct: 660 VSINDKIRTRLLKAGVTPNVE 680

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 124/288 (43%), Gaps = 27/288 (9%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGF---LLIALTICIMMIG 560
           +REL+A G  N FS +LGS+  +  Y  S +   +GA +  +G    LL+ LTI  ++  
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLL-- 450

Query: 561 PVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEY---LTVVIIVFTMGIFDFVL 617
             +I +IPIC++  +  ++G  LL EA  D       F Y   L   + V T   +   +
Sbjct: 451 -PMIHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEV 509

Query: 618 GIIVGILIACFSFLVDSTK-----LQTINGE---YNGNVAKSTVYRDYVQTKFLDGIGEQ 669
           GI +G   +  S +  S K     L  + G     N +       R++          E 
Sbjct: 510 GICIGCGYSVISIIKHSAKSRIQILARVQGTSRFVNSDDYLKQTNREHANENLELEELEG 569

Query: 670 IYVLKLQNLLFFGTILSIEEKIEKLLQISNKDA--------TKRRIKYLILDFKNINADN 721
             ++K+   L F     ++E++ +L +  +           ++   +Y+I+D   +   +
Sbjct: 570 CLIVKIPEPLTFTNTEDLKERLNRLEKFGSTRVHPGARGRRSRSSTRYVIIDLHGMT--H 627

Query: 722 IDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVE 769
           +D SAA+    I      + +++ ++ +    R+       G+++ VE
Sbjct: 628 MDSSAAQILLEIVSSYRKRDVRVFLARVTIDARVRERLEKSGVVDLVE 675

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 109/540 (20%), Positives = 228/540 (42%), Gaps = 69/540 (12%)

Query: 277 IEITPFYHTMALAVKEALAGDD-----------DEIIT-----TTIFCYVISSMLTGTVF 320
           + ITPF + +  +V + + G +           ++++T      TI   V+ + L+G + 
Sbjct: 132 LAITPFVYCVFGSVPQMIVGPESAISLVVGQAVEKLVTHNEKVGTINISVVVTFLSGAIL 191

Query: 321 YVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF------EYSWPF--- 371
            + G  +LG +     R +L G I  VG  ++I  +    ++ K        Y  PF   
Sbjct: 192 LIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEKV 251

Query: 372 -FLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLV--LPSFYILTLVLFHFIVAIIPT 428
            FL  +   +      +  + + I++ T R+ K  L+    S      +L   I ++I +
Sbjct: 252 QFLFKYGPENLHKPTAILSLCSFIILMTLRFLKKKLMKRYKSVIFFPEILLIVISSLIIS 311

Query: 429 LSLDTLRAAGWIFPIANSDSKWYDHYKLFN-VHKVHWSLVLQQIPTMMALTFFGILHVPI 487
           ++ + L+    I  + +  +  +D  KL N + K + SL  + +   +     G      
Sbjct: 312 VNFN-LKKDFDISMLGDFSTSGFD--KLNNPLGKDNRSLCHELLSVGLMCAILGFFESTT 368

Query: 488 NVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGF 547
              +L     +     +REL+A G  N    L G++ ++  Y  S +   +GA +  +G 
Sbjct: 369 ASKSLGTIYDL-TISSNRELVALGSMNLVGSLFGALPSFGGYGRSKINALSGAQTVMSGA 427

Query: 548 LLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEY--LTVVI 605
            +  +T+  +     +I + P+CI+  +  ++G  LL EA  D    +    Y  L +  
Sbjct: 428 CMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAPSDIRFHIRCHGYNELIIFT 487

Query: 606 IVFTMGIFDFV-LGIIVGIL--------------IACFSFLVDSTKLQTINGEYNGNVAK 650
           ++F   I   V  GI VG +              I   + ++ + +   ++G Y G    
Sbjct: 488 LIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRIQILTRVIGTNQFVPVDGYYPG---L 544

Query: 651 STVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQI-SNKDATKRR--- 706
            T+  D  ++  L+ + +   ++K+   L F     ++E++ +L +  S +    RR   
Sbjct: 545 KTI--DLRESSALEELDDSTLIVKIPEPLTFTNTEDLKERLNRLERFRSVRIHPGRRPLH 602

Query: 707 ----IKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKL----IISSIRERDRIYNA 758
               IKY+I +   + +  +D SAA+    I +  + + + +    + S+++ R R+++A
Sbjct: 603 NRENIKYVIFELGGMTS--MDSSAAQILKEIIKTYKKRSVNVYFCKVSSNLQIRTRLHDA 660

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 112/523 (21%), Positives = 210/523 (40%), Gaps = 67/523 (12%)

Query: 292 EALAGDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFL 351
           E  +  D EI T TI   +  + ++G V + LG ++LG +     + +L G I  VG  +
Sbjct: 158 EKFSAHDSEISTVTITMMI--TFISGVVLFFLGSVRLGFLGNILSKALLRGFISSVGLVM 215

Query: 352 IITGIEVTTRV------AKFEYSWP-----FFLGLFTNYDTLAKWLLPVILTVILIGTQR 400
           II  + +  ++          Y  P     F     + Y      +L +I  ++LI T+ 
Sbjct: 216 IINSLIIELKLNHKLADVAGHYHTPVGKIMFLFRYASEYYHKPTAILSLICFLVLISTRI 275

Query: 401 YFKNSLVLPSFYILTL-VLFHFIVAIIPTLSLDTLRAAGWIFPIA--NSDSKWYDHYKLF 457
             K  +    F I    +L    V I+ +L  D   + G I  I   N+D        L 
Sbjct: 276 AKKKLMNRYRFLIFVPEILLVVSVTILLSLKYDFKHSYG-ISTIGEFNADGFGSIGNPLS 334

Query: 458 NVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMD---KYDVDRELIAHGYSN 514
           N ++  +S +  +   +  L FF            + SL  D    Y  +RELIA G+ N
Sbjct: 335 NENRALYSSLWNEGLAVAMLGFF-------ESTTASKSLGSDYNLTYSSNRELIALGFMN 387

Query: 515 FFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGS 574
               L G++ ++  Y  S + + +G  +  +G ++  +T+    +   +I + P C++  
Sbjct: 388 IVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSV 447

Query: 575 LIFLLGYELLVEALIDTWNKLNRFEY--LTVVIIVFTMGIFDFV-LGIIVG-----ILIA 626
           +  ++G  LL E   D    ++   Y  LTV  + F   +   V LG+ VG     ILI 
Sbjct: 448 ITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTLTFIATLSQSVELGVTVGCIYSLILIV 507

Query: 627 CFSFLVDSTKLQTINGE------------YNGNVAKSTVYRDYVQTKFLDGIGEQIYVLK 674
             S L     L  + G             YNG   ++     +          E  Y++K
Sbjct: 508 KHSALSRIQILAKLEGSDEFVNVDDYIKNYNGRDFENITLEQF----------EHCYIVK 557

Query: 675 LQNLLFFGTILSIEEKIEKLLQISNKD--------ATKRRIKYLILDFKNINADNIDYSA 726
           +   L F     +  ++ +L +  + +         ++  ++Y+I D + + +  +D  +
Sbjct: 558 IPEPLTFTNGEDLRSRLSRLERFGSTNVHPGSTSIVSQDDMEYIIFDLEGMTS--MDSGS 615

Query: 727 AEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVE 769
           A+    I R    + +++ ++ +     I     + G+L+ VE
Sbjct: 616 AQILLEIIRSYVHRDVRVYLTRVSLDREIRIRLKSAGILDLVE 658

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 106/565 (18%), Positives = 222/565 (39%), Gaps = 71/565 (12%)

Query: 261 YSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDEI----------IT------T 304
           Y+   +  P   G   + I+PF + +  +V + + G +  I          IT      +
Sbjct: 130 YTTSIAHVPPLCGLYSLAISPFVYGVFGSVPQMIVGPESAISLVVGQAVESITLHKDNVS 189

Query: 305 TIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 364
            I   ++ + ++G +    G  + G +     + +L G I  VG  +II  +    ++ K
Sbjct: 190 LIDISIVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDK 249

Query: 365 F------EYSWPFFLGLFTNYDTLAKWLLPVILTVILIGT---------------QRYFK 403
           F       Y  PF   LF      A++ +P   T I  G                 +Y K
Sbjct: 250 FLVSLPQHYHTPFEKILFLIDYAPAQYHMP---TAIFSGCCLIILFLMRLLKRKLLKYHK 306

Query: 404 NSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFN-VHKV 462
            ++  P       +L   IV I+ ++  D L+    I  + +     +D  KL N + + 
Sbjct: 307 GAIFFPD------ILLVVIVTILISMKFD-LKHRYGITIVGDFSMDNFD--KLKNPLTRS 357

Query: 463 HWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGS 522
              L+       + +   G         +L  +  +     +REL+A G+ N    L G+
Sbjct: 358 RRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGA 416

Query: 523 VQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYE 582
           + ++  Y  S +   +GA S  +G  +  +T+  M +    + +IP C++  +  ++G  
Sbjct: 417 LPSFGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGIS 476

Query: 583 LLVEALIDTWNKLNRFEYLTVVIIVFTMGI---FDFVLGIIVGILIACFSFLVDSTKLQT 639
           LL E   D    L    Y  + +   T G+   +    GI +G + +  + +  S K + 
Sbjct: 477 LLEEVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGICIGCVYSILNIIKHSAKSRI 536

Query: 640 INGEYNGNVAKSTVYRDYVQTKFLDGIG-------EQIYVLKLQNLLFFGTILSIEEKIE 692
                    +  T   DY+     + +        E   ++++   L F     ++++++
Sbjct: 537 QILARVAGTSNFTNLDDYLMNMKRNPLSIENTEEIEGCMIVRIPEPLTFTNSEDLKQRLD 596

Query: 693 KLLQISNKD--------ATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKL 744
           ++ +  +           +K  IKY+I D   + +  +D SAA+  + I    + + + +
Sbjct: 597 RIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--LDSSAAQVLDEIITSYKRRNVFI 654

Query: 745 IISSIRERDRIYNAFNNVGLLNDVE 769
            ++++   D+I    +  G++ +VE
Sbjct: 655 YLANVSINDKIRTRLSKAGVIPNVE 679

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 126/614 (20%), Positives = 240/614 (39%), Gaps = 111/614 (18%)

Query: 273 GSEMIEITPFYHTMALAVKEALAGDDDEI-----------------ITTTIFCYVISSML 315
           G   +  TPF++ +  +V + + G +  I                 +++   C +I+  +
Sbjct: 144 GLYALAFTPFFYAIFGSVPQMIVGPESAISLVVGQAIEPMIRHDPSLSSLDLCVIIT-FI 202

Query: 316 TGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF------EYSW 369
           +G V +  G  + G +     R  L G I  VG  ++I  + V  ++ K        Y  
Sbjct: 203 SGVVLFTFGVFRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYHS 262

Query: 370 PFFLGLF------TNYDTLAKWLLPVILTVILIGTQRY-------FKNSLVLPS--FYIL 414
           PF   LF       NY  L   LL +   +IL+  +         F++ +  P     ++
Sbjct: 263 PFEKVLFLIKYAPANYH-LPTSLLSLCCFLILMSLRLIKKKLLKRFRSLVFFPEILLVVV 321

Query: 415 TLVLFHF-----------IVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVH 463
           T++ F +           +V  I     D LR      P++ +   +Y    LF+     
Sbjct: 322 TVIFFSYNFDLKHRYNIEVVGDIEASVFDKLRN-----PLSKNKRPFYG--DLFSAG--- 371

Query: 464 WSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSV 523
                     M+A+   G         +L  +  +     +REL+A G  N    L G++
Sbjct: 372 ---------FMVAM--LGFFESTTASKSLGTAYDL-AVSSNRELVALGSLNLIGSLFGAL 419

Query: 524 QNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYEL 583
            ++  Y  S +   +GA +  +G  +  +T+  +      I +IP+C++  +  ++G  L
Sbjct: 420 PSFGGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSL 479

Query: 584 LVEALIDTWNKLNRFEY---LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK---- 636
           L EA  D    +    Y   ++ +I V T   +    GI VG   +    +  STK    
Sbjct: 480 LEEAPADLRFHIRCRGYNELISFIITVLTTFFYSVEAGITVGCGYSIIRVIKHSTKSRIQ 539

Query: 637 -LQTING--------EYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSI 687
            L  + G        EY G  + S   R   Q + ++G      ++++   L F     +
Sbjct: 540 ILGKLAGTNKFVNADEYEGKNSTSE-RRVNPQLEEIEGC----LIVRIPEPLTFTNTDDL 594

Query: 688 EEKIEKL-LQISNKD---ATKRR----IKYLILDFKNINADNIDYSAAEGFNRIKRFTET 739
           + ++ +L L  S K    A + R     KY+I D   +    ID SA +    I    + 
Sbjct: 595 KTRLNRLELYGSTKTHPAAPRSRDQEMTKYVIFDLHGMT--TIDSSAIQILQEIISSYKR 652

Query: 740 KKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFL-----FQYKQLRI 794
           + + + +  +    ++ N F N G+L  VE  +D++ +L     + L     F+  +  +
Sbjct: 653 RHVHVFLVRVPSARKVRNRFVNSGILEMVE--SDIHRSLLPSAQQMLTSSPYFETIEEAL 710

Query: 795 KAKERLEERKQNNI 808
           +  + LE R  +++
Sbjct: 711 RIVDELELRAASHL 724

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 61/291 (20%), Positives = 127/291 (43%), Gaps = 33/291 (11%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVI 563
           +REL+A G+ N    L G++ ++  Y  S +   +GA S  +G  +  +T+  M +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQF 457

Query: 564 ISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGI 623
           + +IP C++  +  ++G  LL E   D    L    Y  + +   T G+   +  I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGV-TILCSIEAGI 516

Query: 624 LIACFSFLVDSTK---------LQTINGEYNGNVAKSTVYRDYVQTKFLDGIG------- 667
            I C   +++  K         L  + G  N      T   DY++T   + +G       
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQILARVAGTSN-----FTNLDDYLRTMKKNPLGGENRLEE 571

Query: 668 -EQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKD--------ATKRRIKYLILDFKNIN 718
            E   ++++   L F     ++++++++ +  +           +K  IKY+I D   + 
Sbjct: 572 VEGCMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMT 631

Query: 719 ADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVE 769
           +  ID SAA+  + I    + + + + ++++   D+I       G++ ++E
Sbjct: 632 S--IDSSAAQVLDEIITSYKRRNVFIYVANVSINDKIRTRLLKAGVIPNLE 680

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 135/658 (20%), Positives = 243/658 (36%), Gaps = 116/658 (17%)

Query: 237 PVFSHLGPTGISMFYISTIISQAV-----------YSGGCSSFPSGIGSEMIEITPFYHT 285
           P FS L PT  +  +I  +I+ A            YS   +  P   G   +  TP  + 
Sbjct: 86  PCFSWL-PTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 286 MALAVKEALAGDD-----------------DEIITTTIFCYVISSMLTGTVFYVLGKLQL 328
           +  +V   + G +                 D  +  T  C V++  ++G++ +  G ++ 
Sbjct: 145 VFGSVPHMIVGPESAISLVVGQAIEKLTKHDASLNVTNLCVVLT-FISGSILFSFGLMRF 203

Query: 329 GKIVGFFPRHILIGCIGGVGYFLIITGI------EVTTRVAKFEYSWPFFLGLFTNYDTL 382
           G +     R +L G I  VG  ++I  +      + T + A   Y  PF   +F  +   
Sbjct: 204 GFLDSVLSRALLRGFISAVGLIMVINSLISELKLKDTFKNAPGHYHAPFQKVVFLVHYAP 263

Query: 383 AKWLLPVILTVIL----IGTQR--------------YFKNSLVLPSFYILTLVLFHF--- 421
           A + LP  L  ++    +G  +              +F + LV+ +F  L    + F   
Sbjct: 264 ANYHLPTALVSLVCFAALGALKVIKKKLVKRFKKVIFFPDILVVVAFATLVSYCYDFKVR 323

Query: 422 ----IVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMAL 477
               IV  I T S +T++      PI+       D+ KLFN    H   ++         
Sbjct: 324 YNIDIVGDIETGSSNTIKN-----PISK------DNLKLFN-DLFHAGFLV--------- 362

Query: 478 TFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIR 537
              G         +L  +  +     +REL+A G  N    L G++ ++  Y  S +   
Sbjct: 363 ALLGFFESTTASKSLGTNYDL-AISSNRELVALGSLNLVGSLFGALPSFGGYGRSKINAY 421

Query: 538 AGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALID---TWNK 594
           +GA +  +G  +  +T+         I  IPIC++  +  ++G  L  EA  D    +  
Sbjct: 422 SGAATVMSGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKFHFRC 481

Query: 595 LNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK-----LQTINGE---YNG 646
               E LT  I V T   +    GI +G   +    + +ST+     L  I+G     N 
Sbjct: 482 RGYNELLTFAITVLTTFFYSVEAGITLGCGYSIIRAIKNSTQSGIQILGRISGTNRFVNA 541

Query: 647 NVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQ--------IS 698
           +   S    D      LD + E   V ++   L F     ++ ++ +L           S
Sbjct: 542 DEFYSASSLDSEFGPRLDHM-EGCLVARIAEPLTFTNTEDLKSRLNRLENHGSVKTHPAS 600

Query: 699 NKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNA 758
            +   K   + +I D + +    ID SA++    I +    +K+++ ++ +     +   
Sbjct: 601 PRSRDKDLTRNMIFDLEGMT--QIDSSASQILCEIVKSLTKRKVRVYLARVPRALHVRER 658

Query: 759 FNNVGLLNDVELFADLNSAL------EWCENEFLFQYKQLRIKAKERLEERKQNNIVS 810
               G+   VE    LN+A        WC     F+  Q  +K  + L     + + S
Sbjct: 659 LVASGVAGMVENNIPLNTASMGQPGDSWC-----FKSIQEALKMCDELAPNMDSEVSS 711

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 110/561 (19%), Positives = 220/561 (39%), Gaps = 63/561 (11%)

Query: 261 YSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDEI----------IT------T 304
           Y+   +  P   G   + I+PF + +  +V + + G +  I          IT      +
Sbjct: 140 YTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKENVS 199

Query: 305 TIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 364
            I    + + ++GT+    G  + G +     + +L G I  VG  +II  +    ++ K
Sbjct: 200 LIDISTVITFVSGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDK 259

Query: 365 F------EYSWPFFLGLFTNYDTLAKWLLPVIL-----TVILIGTQ-------RYFKNSL 406
           F       Y  PF   LF      A++ +P  +      ++L  T+       +Y K+++
Sbjct: 260 FLVSLPQHYHTPFEKILFLIDYAPAQYHIPTAIFSGCCLIVLFLTRLLKRKLMKYHKSAI 319

Query: 407 VLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSL 466
             P       +L   IV I+ ++  + L+    I  I +     +D  K   + +    L
Sbjct: 320 FFPD------ILLVVIVTILISMKFN-LKHRYGISIIGDFSMDNFDELK-NPLTRPRRKL 371

Query: 467 VLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNY 526
           +       + +   G         +L  +  +     +REL+A G+ N    L G++  +
Sbjct: 372 IPDLFSASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPAF 430

Query: 527 LVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVE 586
             Y  S +   +GA S  +G  +  +T+  M +    + +IP C++  +  ++G  LL E
Sbjct: 431 GGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEE 490

Query: 587 ALIDTWNKL--NRFEYLTVVIIVFTMGIF-DFVLGIIVGILIACFSFLVDSTKLQTINGE 643
              D    L    F  L V  + F   IF     GI +G + +  + +  S K +     
Sbjct: 491 VPGDIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILA 550

Query: 644 YNGNVAKSTVYRDY---VQTKFLDGIG----EQIYVLKLQNLLFFGTILSIEEKIEKLLQ 696
                +  T   DY   ++   LD  G    E   ++++   L F     ++++++++ +
Sbjct: 551 RVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIER 610

Query: 697 ISNKD--------ATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISS 748
             +           +K  IKY+I D   + +  ID SAA+    I    + + + + + +
Sbjct: 611 YGSSKIHPGRKSLRSKDSIKYVIFDLGGMTS--IDSSAAQVLEEIITSYKRRNVFIYLVN 668

Query: 749 IRERDRIYNAFNNVGLLNDVE 769
           +   D++       G+   VE
Sbjct: 669 VSINDKVRRRLFKAGVAASVE 689

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 107/526 (20%), Positives = 210/526 (39%), Gaps = 76/526 (14%)

Query: 306 IFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF 365
           I   +  ++++GT+  + G  +LG +     + +L G IG VG+ +II  +    ++   
Sbjct: 206 ILIVIAVTLISGTILLISGIFRLGYLGNILNKALLHGFIGSVGFVMIIDSLINELKLGDI 265

Query: 366 ------EYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQ----RYFKNSLV-------- 407
                  Y+ PF   +F        + +P  L   +        R FK  L+        
Sbjct: 266 LADTPEHYNTPFLKIVFLWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHRHRWLIF 325

Query: 408 LPSFYIL--TLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWS 465
           +P   I+  T+++  + +    T  +D L         +N +S +++     N   +H  
Sbjct: 326 IPEILIVLTTVLILSYKLDFADTYDIDILGDFK-----SNENSIFHNPLSNKNRGLIH-- 378

Query: 466 LVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQN 525
            V+  I  + A+  FG         AL  S +      +REL+A G SN     LG++ +
Sbjct: 379 -VVFNIGIITAI--FGFFESTTASKALGASSER-SVSSNRELVALGLSNIVISTLGALPS 434

Query: 526 YLVYTNSVLFIRAGADSSFAG-FLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELL 584
           +  Y  S +   +G  +  +G F+ +   + I+ + PVI  +IP+CI+  +  ++G+ LL
Sbjct: 435 FGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPVI-HYIPVCILSVITTVIGFTLL 493

Query: 585 VEALIDT---WNKLNRFEYLTVVIIVFTMGIFDFV-LGIIVGILIACFSFLVDSTK---- 636
            E   +    W +   +  L ++++ F   IF  V   + +G + +  + +  S K    
Sbjct: 494 EEIPKEVSFHW-RCRGYNELFLIVLTFMTSIFYSVETSMYIGCVYSILNIIKHSAKSRIQ 552

Query: 637 -------LQTINGE-----------YNGNVAKSTVYRDYVQTKFLDGI------GEQIYV 672
                  + +I+              N    +S+ YR   +    D         EQ  +
Sbjct: 553 IYTDAPLITSISNPPSIDNSNINSNNNIKSTRSSDYRPESRRNSADECFRCSLTNEQTLI 612

Query: 673 LKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRI--------KYLILDFKNINADNIDY 724
           +K+   L F     ++EK+ +  ++    A   +I        KY+I D + +    +D 
Sbjct: 613 VKIPEPLTFTNCEDLKEKLNRFERLGTHTAHPGKILKDTLFQPKYIIFDLQGMTL--MDS 670

Query: 725 SAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVEL 770
           SA E    I          +   ++  R+ I N     G+++ +EL
Sbjct: 671 SATEILKEIVLSYRRSGSHIFFVNVSFRENIRNRIQASGIIDLIEL 716

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 104/251 (41%), Gaps = 24/251 (9%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVI 563
           +REL++ G  N  S +  ++  +  Y  S + I  GA + F+G  +  L I  M      
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNA 331

Query: 564 ISFIPICIVGSLIFLLGYELLVEALIDT---WNKLNRFEYLTVVIIVFTMGIFDFVLGII 620
              +PICI+  +I  + + LL EA  D    W+     E    +IIV T  ++    G+ 
Sbjct: 332 FHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVT 391

Query: 621 VGILIACFSFLVDSTKLQT-INGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLL 679
           +G+ +     L  ST+ +  I G          +  D      L+ I E++ V+K+   L
Sbjct: 392 MGMCLTMIRLLKHSTRSRVQILGRDPITYTFKNIDDDENSDIPLEEI-EKVMVVKIPEPL 450

Query: 680 FFGTILSIEEKIEKLLQ-----------------ISNKDATKRRIKYLILDFKNINADNI 722
            F  +  +   ++++ +                 +S   + +  +KYL++D   +    I
Sbjct: 451 IFSNVSDLRTSLKRMEKYGSLKVHPSYPLPLRQMLSPTTSGQVSLKYLVIDLFGMT--YI 508

Query: 723 DYSAAEGFNRI 733
           D SA +    I
Sbjct: 509 DISALQALREI 519

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 97/206 (47%), Gaps = 13/206 (6%)

Query: 499 DKYDVD----RELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLL-IALT 553
           +K+D+D    REL++ G  N  S +  ++  +  Y  S L I   A +  AG ++ +A  
Sbjct: 341 EKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAI 400

Query: 554 ICI-MMIGPVIISFIPICIVGSLIFLLGYELLVEALIDT---WNKLNRFEYLTVVIIVFT 609
            C+  M+G     ++P+C++  +I  + Y LL E   D    W+     E LT V +V T
Sbjct: 401 FCMNYMMGA--FHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVT 458

Query: 610 MGIFDFVLGIIVGILIACFSFLVDSTKLQT-INGEYNGNVAKSTVYRDYVQTKFLDGIGE 668
             ++    G+ +G+ +     L  +T+ +  I G          +Y +  +   L+ I E
Sbjct: 459 TLVWSPQFGVSIGVGLTMIRLLKHTTQSRVQILGRDPVTKKFQNIYAEQSEQIPLEEI-E 517

Query: 669 QIYVLKLQNLLFFGTILSIEEKIEKL 694
           +  V+K+   L F  +  +++++ +L
Sbjct: 518 KTMVIKIPEPLIFSNVSDLKKRLSRL 543

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 125/292 (42%), Gaps = 34/292 (11%)

Query: 501 YDVD----RELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICI 556
           +D+D    REL++ G  N    +  S+  +  Y  S L I  GA +  AG  +    I  
Sbjct: 343 FDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFC 402

Query: 557 MMIGPVIISFIPICIVGSLIFLLGYELLVEALIDT---WNKLNRFEYLTVVIIVFTMGIF 613
           M     +  ++P+CI+  +I  + Y LL E   D    W+     E +T   +V +  I+
Sbjct: 403 MRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLIW 462

Query: 614 DFVLGIIVGILIACFSFLVDSTKLQ-TINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYV 672
               G+++G+ +     L  +T+ +  I G+         +Y ++ +   L+ I E+  V
Sbjct: 463 SPQFGLVMGLGLTMIRLLKHTTQSRIQILGKDPITKKFRNIYSEHNEEIPLEEI-EKTMV 521

Query: 673 LKLQNLLFFGTILSIEEKIEKL-----LQISNKDATKRR-------------IKYLILDF 714
           +K+   L F  +  + +K+++L     L +     T  R             +KY+I+D 
Sbjct: 522 IKVPEPLVFWNVPDLMKKVKRLEKYGSLYVHPSYPTSLRPVSGVTTLKDNVYVKYIIMDL 581

Query: 715 KNINADNIDYSAAEGFNRIKRFTETKKIKLII--SSIRERDRIYNAFNNVGL 764
             +    ID SA +    +      + I +I   SSIR+   + N F+  G+
Sbjct: 582 --LGMTYIDMSALQALVDMVVNYHKRGIYVIFCRSSIRD---LKNKFDKSGI 628

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 106/557 (19%), Positives = 209/557 (37%), Gaps = 83/557 (14%)

Query: 261 YSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDD-----------------DEIIT 303
           YS   +  P   G   +  TPF + +  +V   + G +                 D+ + 
Sbjct: 105 YSTSVAHVPPICGLNALAFTPFVYAVFGSVPHMIVGPESAISLVVGQAIEKQMKHDKSLD 164

Query: 304 TTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVA 363
               C +++  ++G + +  G ++ G +     R +L G I  VG  +++  +    ++ 
Sbjct: 165 VVNLCLILT-FISGAILFCFGIMRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLK 223

Query: 364 KF------EYSWPFFLGLFTNYDTLAKWLLPVILTVILIGT------------QRYFKNS 405
           K        Y  PF   +F  +     + +P  L  +   +             R +K  
Sbjct: 224 KVFNDAPGHYHAPFQKLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKV 283

Query: 406 LVLPSFYIL----TLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFN-VH 460
           + +P   I+    TL  +HF   +    ++D +            D +  D  K  N + 
Sbjct: 284 IFVPEILIVVALVTLGSYHFSFKL--RYNIDIV-----------GDIEVGDTSKFRNPLS 330

Query: 461 KVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLL 520
           K + SL  +       +   G         +L  S ++     +REL+A G  N    + 
Sbjct: 331 KKNLSLFSELFHAGFMVALLGFFESTTASKSLGSSYELS-VSSNRELVALGSLNLVGSIF 389

Query: 521 GSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLG 580
           G++ ++  Y  S +   +GA +  +G  +  +T    M     I  IP+C++  +  ++G
Sbjct: 390 GALPSFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVG 449

Query: 581 YELLVEALID---TWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK- 636
             L  EA  D    +      E L   + V T   +    GI +G   +    + +STK 
Sbjct: 450 ITLFEEAPADLRYHFRCRGYNELLIFALTVLTTFFYSVEAGITLGCGYSVIRVIKNSTKS 509

Query: 637 ----LQTINGE---YNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEE 689
               L+ ++G     N +   S+     V    LD I E   ++K+   L F     ++ 
Sbjct: 510 KIQILRRVSGTDQFVNADDFNSSTNTCVVIPPRLDDI-EGSLIVKIPERLTFMNTEDLKT 568

Query: 690 KIEKLLQ--------ISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKK 741
           ++ +L +         S K   + + K++I D   +    ID SA++    I      + 
Sbjct: 569 RLYRLEKYGSVKTHPASPKPRNRNQTKHMIFDMNGMT--EIDSSASQILQEIVLSLRKRG 626

Query: 742 IKL------IISSIRER 752
           +++      +I+ +RER
Sbjct: 627 VRVYLARVPLIAGVRER 643

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 107/520 (20%), Positives = 207/520 (39%), Gaps = 66/520 (12%)

Query: 292 EALAGDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFL 351
           E +   D+ I T +I   ++ + ++G+    LG  +LG +     R +L G I  VG+ +
Sbjct: 144 EPMVNHDERISTISI--SIVVTFISGSFLLFLGIFRLGFLGNILSRALLRGFICSVGFVM 201

Query: 352 IITGIEVTTRVAKF------EYSWPFFLGLFT------NYD------TLAKWLLPVILTV 393
           II  +    ++ K        Y  PF   LF       NY       +L  +++ +++ V
Sbjct: 202 IINSLISELKLDKVLATSPEHYHTPFEKILFLIKYGQHNYHAPTAILSLYSFIILMLMKV 261

Query: 394 ILIGTQRYFKNSLVLPSFYILTL--VLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWY 451
           +     + FK  + +P   I+ +  ++F F   I     +  +      F +   DS   
Sbjct: 262 MKKRLMKRFKWVIFVPEILIVIVGTIMFSFHFDIKHKFDISIIGD----FKVNGFDSL-- 315

Query: 452 DHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHG 511
            H  L   +++    +L        L FF          AL  +  +     +REL+A G
Sbjct: 316 -HNPLDKTNRLLLKPLLDAGIVCAVLGFF---ESTTASKALGTTYDL-TVSSNRELVALG 370

Query: 512 YSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICI 571
             N    L G++  +  Y  S +   +G  +  +G  L ++T+  +     ++   P C+
Sbjct: 371 SMNIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCV 430

Query: 572 VGSLIFLLGYELLVEALIDT--WNKLNRFEYLTVVIIVFTMGIFDFV-LGIIVGILIACF 628
           +  +  ++G  LL EA  D   + + + +  L V+ + F   IF  V +GI VG   +  
Sbjct: 431 LSVVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTFITTIFYSVEVGICVGCCYSII 490

Query: 629 SFLVDS--TKLQTIN--------------GEYNGNVAKSTVYRDYVQTKFLDGIGEQIYV 672
           S +  S  +++Q +               G ++G    +  + +      L+ + E   V
Sbjct: 491 SIIKHSAQSRIQILAKRKGDNRFSNADELGIFDGENNNNNTFFE----PLLEDLDEDRLV 546

Query: 673 LKLQNLLFFGTILSIEEKIEKL-------LQISNKDATKR-RIKYLILDFKNINADNIDY 724
           +K+   L F     ++E++ +L       +    +D   R + KY+I D   +    ID 
Sbjct: 547 VKIPEPLTFTNTEDLKERLSRLERFGSVRVHPGRRDLRSRDKTKYIIFDLHGMTY--IDA 604

Query: 725 SAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGL 764
           SAA+    I      +++ +    +  R  +   F   GL
Sbjct: 605 SAAQILLEIILAYNRRQVFVFFVRVPMRREVRQRFERSGL 644

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 124/297 (41%), Gaps = 34/297 (11%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVI 563
           +RELIA G  N    +   +  +  Y  S +   +GA ++ +GF +  +T+  +     I
Sbjct: 377 NRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPI 436

Query: 564 ISFIPICIVGSLIFLLGYELLVEALID---TWNKLNRFEYLTVVIIVFTMGIF-DFVLGI 619
           I +IP+CI+  +  ++G  LL EA  D    W +   +  LTV  +     +F     GI
Sbjct: 437 IRYIPVCILSVITTVVGLTLLEEAPHDLKFHW-RCKGYSELTVFTVTLLATLFYSLEAGI 495

Query: 620 IVGILIACFSFLVDSTKLQ-TINGEYNGNVA--KSTVYRDYVQTKFLDGIGEQI---YVL 673
            +G   +  + +  S K +  I G   G      +  Y+      F++   E+I    ++
Sbjct: 496 YIGCACSIINVIKHSAKSRIQILGRVPGTETFINADDYQANAAGYFINPQIEEIEGFLIV 555

Query: 674 KLQNLLFFGTILSIEEKIEKLLQ----ISNKDATKRRIKYL----ILDFKNINADNIDYS 725
           K+   L F     ++ ++ +L +    +++  A + R K +    I D K +   +ID S
Sbjct: 556 KIAEPLTFTNADDLKMRLHRLEKHGSAVTHPAAPRSRRKEMTENVIFDMKGMT--HIDSS 613

Query: 726 AAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCE 782
           AA+                I+S+   RD ++    NV L   V      +   E CE
Sbjct: 614 AAQTLEE------------ILSAYNRRD-VHVFLTNVPLTEKVRERLVTSGVAELCE 657

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/285 (22%), Positives = 124/285 (43%), Gaps = 22/285 (7%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVI 563
           +REL+A G  N  + L G++ ++  Y  S +   +G+ +  +G  + ++T+  +     +
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPL 451

Query: 564 ISFIPICIVGSLIFLLGYELLVEA---LIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGII 620
           I +IP+CI+  +  ++G  LL EA   L   +      E     I V    ++   +GI 
Sbjct: 452 IHYIPLCILSVITSIVGISLLEEAPSELKFHFRCKGYDELFVFAITVLATLLYSVEMGIC 511

Query: 621 VGILIACFSFLVDSTKLQ-TINGEYNG-----NVAK---STVYRDYVQTKFLDGIGEQIY 671
           +G   +  S +  S K +  I G   G     N+ +   S    D    KF+    E   
Sbjct: 512 IGCGYSIISIVKHSAKSRIQILGRVQGTREFANIDEYLDSDPIGDIETNKFVLEEIEGCL 571

Query: 672 VLKLQNLLFFGTILSIEEKIEKLLQISNKDA--------TKRRIKYLILDFKNINADNID 723
           ++K+   L F     ++E++ +L +  +  A        +K   K +I D   + +  ID
Sbjct: 572 IVKIPEPLTFTNTDDLKERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFDLHGMTS--ID 629

Query: 724 YSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDV 768
            SA + F  I    + +K+K+ ++ + +  +I       G+ + V
Sbjct: 630 SSATQIFFDIVATYKKRKVKVFLARVLQSKQIRERLEKSGVTSMV 674

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 60/127 (47%), Gaps = 7/127 (5%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVI 563
           +REL+A G  N  + LLG + ++  Y  S +   +GA +  +G ++  +T+  +      
Sbjct: 428 NRELVALGVMNLTASLLGGLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNY 487

Query: 564 ISFIPICIVGSLIFLLGYELLVEALIDT---WNKLNRFEYLTVVIIVFTMGIFDFVLGII 620
           I FIP C++  +  ++G  L+ EA  +    W    R +    +II F          + 
Sbjct: 488 IHFIPTCVLSVITTIVGLSLIEEAPGEVKFHW----RCKGYNELIIFFMTACGTIFFSVE 543

Query: 621 VGILIAC 627
           VGI+I C
Sbjct: 544 VGIIIGC 550

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 84/403 (20%), Positives = 163/403 (40%), Gaps = 62/403 (15%)

Query: 277 IEITPFYHTMALAVKEALAGDDD----------EIITT------TIFCYVISSMLTGTVF 320
           + +TPF + +  +V   + G +           E +T+      T+    + S ++G   
Sbjct: 123 LAVTPFIYALFGSVPHMIVGPESAISLVVGQAVETLTSHDLSLETVDIATMISFMSGLTL 182

Query: 321 YVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF------EYSWPFFLG 374
              G  +LG +     + +L G I  +G+ +I+  +    ++ K        Y  PF   
Sbjct: 183 LFGGIFRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKI 242

Query: 375 LF------TNYDTLAKWLLPVILTVILIGTQRYFKNSLV--------LPSFYILTLVLFH 420
           LF      +NY     +L   + T ++  T R FK  ++        +P   IL++V+F 
Sbjct: 243 LFLVRYGPSNYHLPTSFLSLAVFTTLM--TIRIFKKKMMRRIKWIVFIPE--ILSVVIFS 298

Query: 421 FIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLV--LQQIPTMMALT 478
            +++      +  L+    I  I + ++  +D ++   + K +  L+  L+ +  + AL 
Sbjct: 299 IVLSY-----MCDLKKKYDISVIGDFNTDGFDDFR-NPLSKCNRGLIPALRDVSLVSALL 352

Query: 479 FFGILHVPINVPALAMSLQMDKY-----DVDRELIAHGYSNFFSGLLGSVQNYLVYTNSV 533
            F        + ++  S  +  Y       +REL+A G  N      G +  +  Y  S 
Sbjct: 353 GF--------LESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGGYGRSK 404

Query: 534 LFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWN 593
           +   +GA +  AG  + ++T+  +     +I +IP C++  +   +G  LL EA  D   
Sbjct: 405 INAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEAPHDIKF 464

Query: 594 KLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK 636
            +    Y  +++ V T     F   I  GIL  C   L+   K
Sbjct: 465 HIRCKGYDELIMFVLTFLCTCF-YSIEFGILAGCTYSLISIVK 506

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 884 ILLFALKQYRPDIISEIQKVREKEIKFWAQ------LCPYFTRRRLASQSLLLHADNVFF 937
           +L+  LK+YRPD++S +Q+V   E+ FW +          F R    +  LL+  +N  F
Sbjct: 142 VLVHELKKYRPDVVS-LQEVDYNELNFWQENFHKLGFDVIFKRHEGKTHGLLVAWNNKKF 200

Query: 938 LVETGML 944
            ++   +
Sbjct: 201 QLDNDWM 207

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 884 ILLFALKQYRPDIISEIQKVREKEIKFWAQ 913
           +L+  LK Y+PDI+S +Q+V   E+KFW +
Sbjct: 140 VLVHELKTYKPDIVS-LQEVDYNELKFWQE 168

>Kpol_1050.18 s1050 complement(45297..47087) [1791 bp, 596 aa] {ON}
           complement(45297..47087) [1791 nt, 597 aa]
          Length = 596

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 692 EKLLQISNKDATK----RRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKK-IKLII 746
           +K + +SN+D +K    RR+ + I  +  + +  I ++ +  +NR  R    +K +K+  
Sbjct: 496 DKFMSLSNEDTSKYDYCRRMDFFICKWSELGSSRIHFTGSSEYNRWMRLKAIEKGMKMTQ 555

Query: 747 SSIRERDRIYNAFN 760
             + + DR+  +FN
Sbjct: 556 HGLFKDDRLLESFN 569

>NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON}
           Anc_4.309 YLR429W
          Length = 661

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 61/134 (45%), Gaps = 29/134 (21%)

Query: 13  SLSEAISVSLGINQDSS-------INKMHRASVSAMSPPLCRSYMSGF-----------F 54
           S+++A S    IN+DS+       I+K+ R       PPL RSY+               
Sbjct: 432 SVTDAFSPPTSINEDSNISIPSLRISKLRRRE----EPPLARSYLRSISSEEEKRTRRRI 487

Query: 55  TGGNSPMINSMSDSKLP-----LSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPT 109
           T   + +I+ +SDS +      L  ++    ++ +E   R+ A+++ +  ++S EE  P+
Sbjct: 488 TSQKNRLISGLSDSPIKKGEEILRPEEESSSVNLTEAEDRKVAKITPQVAATSTEE--PS 545

Query: 110 IKDYMDIIDSGDRK 123
           IK   + +   D +
Sbjct: 546 IKQLSNTLKWNDNQ 559

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 70/154 (45%), Gaps = 16/154 (10%)

Query: 466 LVLQQIPTMMALTFFGIL-HVPINVPALAMSL-QMDKYDV--DRELIAHGYSNFFSGLLG 521
           LV + +P + A T   +L H+     A+A S  +++ Y V  D+ELIA G +N F+    
Sbjct: 397 LVEKLLPELPAATIILLLEHI-----AIAKSFGRINNYKVVPDQELIAIGVTNLFATFFN 451

Query: 522 SVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGY 581
           +      ++ S L  +    +  +G    A  +  +        FIP   + ++I     
Sbjct: 452 AYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVIIHAVA 511

Query: 582 ELLVEALIDTW-----NKLNRFEYL-TVVIIVFT 609
           +L+    + TW     N L+ F ++ TV+I VF+
Sbjct: 512 DLIASYKV-TWMFWRTNPLDFFAFIVTVIITVFS 544

>Suva_8.339 Chr8 complement(595820..600958) [5139 bp, 1712 aa] {ON}
           YOR290C (REAL)
          Length = 1712

 Score = 32.3 bits (72), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 60/115 (52%), Gaps = 9/115 (7%)

Query: 836 PVRNLMSLPTNTPRNYQMLSVAQN-VFVNDEQAV----KNFKKEYKDDEPVLPILLFALK 890
           PV+NL ++ +NTP     L + +N    N+++AV    KN  ++ K   P  P+ L  L+
Sbjct: 382 PVKNLRTV-SNTPIAQANLKIEENEASSNEDKAVPIIDKNPTEQNKPPTPQKPVPLSVLQ 440

Query: 891 -QYRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGML 944
            QY+  I  ++  + + ++   +   P   +  +   +LL ++D+  FL+E G+L
Sbjct: 441 EQYKEGI--KVVDIDDPDMMVDSFTMPNICQNNIDYLTLLANSDHARFLIEPGVL 493

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,155,790
Number of extensions: 4510041
Number of successful extensions: 14115
Number of sequences better than 10.0: 72
Number of HSP's gapped: 14443
Number of HSP's successfully gapped: 86
Length of query: 1036
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 916
Effective length of database: 39,721,479
Effective search space: 36384874764
Effective search space used: 36384874764
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 71 (32.0 bits)