Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2203.483ON57257230110.0
YGR124W (ASN2)3.483ON57257229140.0
Skud_7.4353.483ON57257228880.0
Suva_7.4103.483ON57257228600.0
YPR145W (ASN1)3.483ON57257226850.0
Suva_16.4743.483ON57257226770.0
Smik_16.3963.483ON57257226630.0
CAGL0I10648g3.483ON57457426540.0
Skud_16.4393.483ON57257226350.0
KLLA0B10868g3.483ON57457126130.0
NCAS0F035103.483ON57557226050.0
Kpol_480.193.483ON57457226000.0
NDAI0B058103.483ON57757725780.0
TDEL0D055203.483ON57357125700.0
SAKL0F02970g3.483ON57357125570.0
KNAG0A079203.483ON57857525490.0
KAFR0G036703.483ON57257125470.0
Kwal_55.211873.483ON57357125390.0
KLTH0F14630g3.483ON57357125200.0
TBLA0C044303.483ON58057825140.0
AFR303W3.483ON57157225010.0
TPHA0D042003.483ON57457325000.0
ZYRO0B04136g3.483ON57257324570.0
Ecym_12443.483ON57357324320.0
ZYRO0A00528g8.875ON5121031384e-08
KLLA0D10285g8.875ON5155241332e-07
Kpol_455.78.875ON518941252e-06
KAFR0L021108.875ON514951224e-06
ADL350C8.875ON508941207e-06
TPHA0C049508.875ON525991207e-06
Skud_7.311singletonON81891078e-06
Skud_13.468.875ON5191011181e-05
NCAS0C001908.875ON5171051171e-05
TDEL0B004408.875ON516941171e-05
NDAI0K001808.875ON522941171e-05
SAKL0D00352g8.875ON515931162e-05
Suva_13.528.875ON519991162e-05
KNAG0J002008.875ON5151021152e-05
YML096W8.875ON525951134e-05
Smik_13.398.875ON521961117e-05
TBLA0C063008.875ON518941101e-04
Kwal_27.97058.875ON515991092e-04
KLTH0E16412g8.875ON5154351063e-04
Ecym_81558.875ON5134201036e-04
CAGL0H06963g8.875ON51793990.002
Kwal_26.94775.21ON510214790.46
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.220
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...  1164   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...  1127   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...  1117   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...  1106   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...  1038   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...  1035   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...  1030   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...  1026   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...  1019   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...  1011   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...  1008   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1006   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   997   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...   994   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...   989   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...   986   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...   985   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   982   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   975   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   972   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   967   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   967   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   951   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   941   0.0  
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    58   4e-08
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    56   2e-07
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    53   2e-06
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    52   4e-06
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    51   7e-06
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    51   7e-06
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    46   8e-06
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    50   1e-05
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    50   1e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    50   1e-05
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    50   1e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    49   2e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    49   2e-05
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    49   2e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    48   4e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    47   7e-05
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    47   1e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    47   2e-04
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    45   3e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    44   6e-04
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    43   0.002
Kwal_26.9477 s26 complement(1234178..1235710) [1533 bp, 510 aa] ...    35   0.46 

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/572 (97%), Positives = 560/572 (97%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300
             IAAIAARETEKANADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ
Sbjct: 241 SLIAAIAARETEKANADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420

Query: 421 PFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKEQ 480
           PFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKEQ
Sbjct: 421 PFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKEQ 480

Query: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA
Sbjct: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 541 NTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572
           NTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA
Sbjct: 541 NTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1127 bits (2914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/572 (93%), Positives = 553/572 (96%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKH+DIH+FKPKALQLSK+IRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITSADGEYMLGVNGEIYNHIQLRE CSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           AFC+YD+KKDRIVAARDPIGVVTLYMGRSS+SP+TVYFASELKCLTDVCDSII+FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTPVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300
             IAAIAARETEKANAD NE+++VDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ
Sbjct: 241 SLIAAIAARETEKANADANEDNNVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420

Query: 421 PFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKEQ 480
           PFLDKDFLQLCMNIDP +KMIKPKEG+IEKYILRKAFDTT+EPDVKPYLPEEILWRQKEQ
Sbjct: 421 PFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480

Query: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWIDGLRDTAER ISD MFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA
Sbjct: 481 FSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 541 NTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572
           +TVMRW+PKADWGCAEDPSGRYAKIHEKHV A
Sbjct: 541 DTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1117 bits (2888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/572 (92%), Positives = 551/572 (96%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKH+DI+SFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PI SADGEYMLGVNGEIYNHIQLRE+CS YKFQTFSDCEPIIPLYLEHDIDAPK+LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           AFC+YDAKKDR+VAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSII+FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTP+WLDEKRIPS PVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300
             IAAIAARETEKANAD + ++SV+ KQLAGIDDQGHLHTSGWSRLHSFA+GLPNAPDLQ
Sbjct: 241 SLIAAIAARETEKANADADGDASVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420

Query: 421 PFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKEQ 480
           PFLD+DFLQLCMNIDPKDKMI PKEG+IEKYILRKAFDTT+EP+VKPYLPEEILWRQKEQ
Sbjct: 421 PFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKEQ 480

Query: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWIDGLRDTAERVISDTMFANPKADWG+DIPTTKEAYWYRLKFDAWFPQKTAA
Sbjct: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 541 NTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572
           +TVMRWVPKADWGCAEDPSGRYAKIHEKHV A
Sbjct: 541 DTVMRWVPKADWGCAEDPSGRYAKIHEKHVSA 572

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1106 bits (2860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/572 (91%), Positives = 545/572 (95%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKH+DI  FKPKALQLSKRIRHRGPDWSGNA+MNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS+DG+YMLGVNGEIYNHIQLRE+CSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           AFC+YD+KKDR++AARDPIGVVTLYMGR SKSPKTVYFASELKCLTDVCDSIIAFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKR+P+TPVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300
             IAAIAARETE AN + NEE+S ++ +LAGIDDQGHLHTSGWSRLHSFA+GLPNAPDLQ
Sbjct: 241 SLIAAIAARETETANVEANEEASAEKSKLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST+AWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARV 420

Query: 421 PFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKEQ 480
           PFLDKDFLQLCMNIDPKDKMI  KEG+IEKYILRKAFDTT+EPDVKPYLPEEILWRQKEQ
Sbjct: 421 PFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480

Query: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWID LRDTAERVISD MFANPKA WGDDIPTTKEAYWYRLKFDAWFPQKTAA
Sbjct: 481 FSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 541 NTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572
           +TVMRWVPKADWGCAEDPSGRYA+IHEKHV A
Sbjct: 541 DTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1038 bits (2685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/572 (86%), Positives = 529/572 (92%), Gaps = 3/572 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+H+D+H +KPKALQLSKRIRHRGPDWSGNA+ NSTIFVHERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS+DGEYML VNGEIYNHIQLREEC+DY+F T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ +YDAK+DRIVAARDPIG+ TLYMGRSS SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DY+AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEESSVDEK--QLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298
             IA+IAARET KA  DV E S+ D K   LAGIDD G LHT+GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETAKATNDV-EPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPD 299

Query: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358
           LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419

Query: 419 RVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQK 478
           RVPFLD++FLQLCMNIDP +KMIKPKEG+IEKYILRKAFDTT EPD KPYLPEEILWRQK
Sbjct: 420 RVPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479

Query: 479 EQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538
           EQFSDGVGYSWIDGL+DTAE VISD MFA+PKA+WG DIPTTKEA+WYRLKFDA FPQKT
Sbjct: 480 EQFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKT 539

Query: 539 AANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
            A+TVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 540 VADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/572 (86%), Positives = 528/572 (92%), Gaps = 3/572 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKH+D+H +KPKALQLSKRIRHRGPDWSGNAV NSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS D +YML VNGEIYNHIQLREEC DY+F+T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ +YDAK+DRI+AARDPIG+ TLYMGRSS SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DYLAIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEESSVDEK--QLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298
             IAAIAARET KA  DV E S+ D K   LAG+DD+G+LHT+GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIAAIAARETAKATNDV-EPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPD 299

Query: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419

Query: 419 RVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQK 478
           RVPFLD++FLQLCMNIDP +KMI+PKEG+IEKYILRKAFDTT+EP+ KPYLPEEILWRQK
Sbjct: 420 RVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQK 479

Query: 479 EQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538
           EQFSDGVGYSWID L+DTAE VISD MFANPKA+WG+DIPTTKEAYWYRLKFD  FPQKT
Sbjct: 480 EQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKT 539

Query: 539 AANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
            A+TVMRWVPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 540 VADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1030 bits (2663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/572 (85%), Positives = 526/572 (91%), Gaps = 3/572 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKH+D+H++KPKALQLSKRIRHRGPDWSGNA+ NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS D +YML VNGEIYNHIQLREEC +Y+F+T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ +YDAK+DRIVAARDPIG+ TLYMGRSS SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DYLAIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEESSVDEK--QLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298
             IA+IAARET  A  DV+  S+ D K   LAG+DD G LHT+GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETANATNDVDP-STYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPD 299

Query: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419

Query: 419 RVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQK 478
           RVPFLDK+FLQLCMNIDP +KMIKPKEG+IEKYILRKAFDTT EPD KPYLPEEILWRQK
Sbjct: 420 RVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479

Query: 479 EQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538
           EQFSDGVGYSWIDGL+DTAE VISD MFA+PKA+WG DIP+TKEA+WYRLKFDA FPQKT
Sbjct: 480 EQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKT 539

Query: 539 AANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
            A+TVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 540 VADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score = 1026 bits (2654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/574 (84%), Positives = 522/574 (90%), Gaps = 2/574 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KH D+H+FKPKALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS DG+Y L VNGEIYNHIQLRE+  DYKF+T SDCEPIIP YLEHDIDAPKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+C+YDAK+DRIVAARDP+G+ TLYMGR S SPKTV+FASELKCLTD CD I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYFTPDW+DE RIP+TPV++  IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANA--DVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298
             IA+IAARETEKAN   D  +  +   KQLAGID+QGHLHT+GWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358
           LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 419 RVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQK 478
           RVPFLDK+FLQLCMNIDPKDKMI    G+IEKYILRKAFDT++EPDVKPYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 479 EQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538
           EQFSDGVGYSWIDGL+DTAERVISDTMF+NPK +WG+DIPTTKEAYWYRLKFDA FPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 539 AANTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572
           AA+TVMRW+PKADWGCAEDPSGRYAKIHE+HV A
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHVTA 574

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/572 (84%), Positives = 522/572 (91%), Gaps = 3/572 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KH+D+H +K KALQLSKRIRHRGPDWSGNA  NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS D +YML VNGEIYNHIQLREEC DY+F+T SDCEPIIP+YL+HDI+APKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ +YDAK+DRIVAARDPIG+ TLYMGRSS SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DY+AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEESSVDEK--QLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298
             IA+IAARET  A  DV E S+ D K   LAG+DD G+LHT+GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETANATNDV-EPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPD 299

Query: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359

Query: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419

Query: 419 RVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQK 478
           RVPFLD++FLQLCMNIDPK+KMI+ KEG+IEKYILRKAFDTT EPD KPYLPEEILWRQK
Sbjct: 420 RVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479

Query: 479 EQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538
           EQFSDGVGYSWID L+D AE VISD MFA+PKA+WG DIPTTKEA+WYRLKFDA FPQKT
Sbjct: 480 EQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKT 539

Query: 539 AANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
            A+TVMRWVPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 540 VADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score = 1011 bits (2613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/571 (83%), Positives = 517/571 (90%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA+F++ D+ ++KPKALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS DG Y L VNGEIYNHI LREEC+ Y F+T SDCEPIIPLY ++DIDAPK+LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+C+YD+KKDRI+AARDPIG+ TLYMGRSS SPK+V+F+SELKCLTD CD IIAFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYFTPDWLDE RIP+TPVD+ A+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEES-SVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IAAIAARETEK NA+++      D  QLAG+D+QGHLH +GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479
           VPFLD+DFLQLCMNIDP DKMIKP EGKIEKYILRKAFDTT+EPD+KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+D AE  ISD  FA PKA+WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
           A+TVMRW+PKADWGCAEDPSGRYAKIHE+HV
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/572 (83%), Positives = 519/572 (90%), Gaps = 2/572 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+H+D+ ++KPKALQL+KRIRHRGPDWSGN V N+TI  HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G Y L VNGEIYNHIQ+REEC+DY+F+T SDCEPIIPLYL++D+DAPK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+C+YDAK+DRIVAARDPIG+ TLYMGR SK+P+TVYFASELKCLTD CDSI+AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPSTPVD  AIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKA--NADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298
             IA+IAARETEKA  + DV +E+    K L G+DD+GHLHT GWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358
           LQAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 419 RVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQK 478
           RVPFLDK+FLQLCMNIDPKDKMI    GKIEKYILRKAFDTT++P+ KPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 479 EQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538
           EQFSDGVGYSWIDGL+DTAERVISD MF NPK  WG+D+PTTKEAYWYRLKFDA +PQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 539 AANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
           AA+TVMRW+PKADWGCAEDPSGRYAKIHEKHV
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1006 bits (2600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/572 (83%), Positives = 521/572 (91%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KH++  +FKP+ALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G+Y+L VNGEIYNHIQLRE C DYK++T SDCEPIIPLYL+HDIDAPKYLDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+C+YDAKKDRI+AARDPIG+ TLYMGR+SKSPKTV+FASELKCLTD CDSI+AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF+PDW+DE+RIP+ PV Y AIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEES-SVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARETEKA  +++  +   ++K L GIDDQG+LHT+GWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
            AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMNIDP +KMI   EG+IEKYILRKAFDT++EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+DTAERVISD +F+ PK  WG DIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHVG 571
           A TVMRW+PKADWGCAEDPSGRYAKIHE+H+G
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHIG 572

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/577 (81%), Positives = 517/577 (89%), Gaps = 5/577 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKH+D+H+FKP+ALQLSKRIRHRGPDWSGN + N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G Y L VNGEIYNHIQ+RE+  DY F+T SDCEPIIPLYL+HDID PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+C+YD+K+DRI+AARDPIG+ TLYMGR+SK+P+TV+FASELKCLTD CDSIIAFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYFTPDWLDE+RIP   +D  AIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANAD--VNEESSVDEK---QLAGIDDQGHLHTSGWSRLHSFAIGLPN 295
             IA+IAARETEKANA   ++ E++ DE     L G+DD+GHLH  GWS+LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 416 LEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILW 475
           LEARVPFLD+DFLQLCMNIDPK+KMI   EG+IEKYILRKAFDT+++P+ KPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 476 RQKEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFP 535
           RQKEQFSDGVGYSWIDGL+DTAERVISD MF NPK  WG DIPTTKEAYWYRLKFDA +P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 536 QKTAANTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572
           QKTAA+TVMRW+PKADWGCAEDPSGRYAKIHEKHV A
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/571 (81%), Positives = 522/571 (91%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA KH+D+ ++K KALQLSKRIRHRGPDWSGN + N+T+ VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G Y L VNGEIYNHI+LREE SDYKF T SDCEPIIPLY ++DID PKYLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+C+YDAK+DRI+AARDP+G+ TLYMGR+S SPKTV+FASELKCLTD CD+I+AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDE RIPS PVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVN-EESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARETEKANA+++ ++   ++K LAGIDD G+LH++GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           +AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMNIDPKDKMI  +EG++EKYILRKAFDTT+EPDVKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+DTAERVISD +FA PK+ WGDD+PTTKEA+WYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
           A+TVMRWVPKADWGCAEDPSGR+A+IH++HV
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  989 bits (2557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/571 (82%), Positives = 507/571 (88%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA +KH+ +  FKPKALQLSKRIRHRGPDWSGN V N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS DG+Y L VNGEIYNHI+LREE + Y F+T SDCEPIIPLY ++DID PKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+C+YDAKKDRI+AARDPIG+ TLYMGRSS SP TV+FASELKCL D CD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+RIP TP+DY  IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEESSVDE-KQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IAAIAARETEKAN D++  +  DE K LAG+DD+G+LH +GWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479
           VPFLD+DFL +CMNIDP +KMI   EG+IEKYILRKAFDTT+EPDVKPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+D AE  ISD  FA PK +WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
           A+TVMRW+PKADWGCAEDPSGRYAKIHE+H+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score =  986 bits (2549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/575 (81%), Positives = 516/575 (89%), Gaps = 5/575 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA F+H+D+ +FKP+ALQLSKRIRHRGPDWSGN + NSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G+Y+L VNGEIYNHIQLREEC +Y++++ SDCEPIIP+YL++D+DAPK+LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+C+YDAKKDRIVAARDPIG+ TLYMGRSS  PKTV+FASELKCLTD CD+IIAFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRY+TP+WLDE +IPSTPVD   IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVN-----EESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPN 295
             IAAIAARETEKAN +++     E+   +   LAGIDD+G+L ++ WSRLHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 416 LEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILW 475
           LEARVPFLDK+FL LCMNIDPKDK+I  KEG+IEKYILRKAFDT +EPDVKPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 476 RQKEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFP 535
           RQKEQFSDGVGYSWIDGL+DTAE VISD MFA PKA WG D+PTTKEA+WYRLKFDA FP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 536 QKTAANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
           Q TAA TVMRW+PKADWGCAEDPSGR+AKIHE+HV
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/571 (82%), Positives = 509/571 (89%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+H+D+ SFK KALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G Y L VNGEIYNHIQLRE+  DYKF+T SDCEPIIPLYL  DIDAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ +YD+KKDRI+AARDPIGV TLYMGRSS SPKTV+FASELKCL D CDSI+AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTP+W+DE +IP+TPVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEESSVDE-KQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARETE AN +++     +E   LAGIDD+GHL TSGWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
            AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479
           VPFLD++FL LCMNIDP DK+I  KEG+IEKYILRKAFDT ++P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+DTAE+VISD MFANPK+ WG DIPTTKEAYWYRLKFDA FPQ TA
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
           A TVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  982 bits (2539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/571 (80%), Positives = 510/571 (89%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIF  F+H+D+  FKP ALQL+KRIRHRGPDWSGN + NST+  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           P+ S + +Y+L VNGEIYNHIQLREE SDY F+T SDCEPIIPLY ++ IDAPKYLDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ +YD KKDR++AARDPIG+ TLYMGR SKSPKTVYFASELKCLTD CDSIIAFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE RIPS P+D L IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNE-ESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IAAIAARETEKAN ++N  E   ++K LAG+DD G LH++GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           +AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479
           VPFLD++FL LCMN+DPK+KMI   EG+IEKYILRKAFDT++EP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+DTAE  ISD  F  PKA+WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
           A+TVMRW+PKADWGCAEDPSGRYAKIH++H+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/571 (80%), Positives = 503/571 (88%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIF  F+H  +  FKP AL+L KRIRHRGPDWSGN + NST+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           P  S D  Y+LGVNGE+YNHIQLREE S Y F+T SDCEPIIPLY ++ IDAPKYLDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ +YDAKKDRIVAARDPIG+ TLYMGR SKSPKTVYFASELKCLTD CDSIIAFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF PDW+DE RIPS P+D L IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNE-ESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARETEKAN+ ++  +   ++K LAG+DD G+L ++GWS LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMN+DPK+KMI   EG+IEKYILRKAFDT++EP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+D AE  ISD  F  PKA+WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
           A+TVMRW+PKADWGCAEDPSGRYAKIHE+H+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  972 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/578 (79%), Positives = 509/578 (88%), Gaps = 8/578 (1%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KH ++++FKP+ALQL+KRIRHRGPDWSGN V N+T+F HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G YML VNGEIYNHIQLREE +DYK++T  DCEPIIP+YL++D+DAP +LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           AF +YD++KDR++AARDP+G+ TLYMGR+SK+PKTVYFASELKCL D CDSIIAFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKI RYF P+W+DE  IP+TPVD   +R +LE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVN----EESSVD----EKQLAGIDDQGHLHTSGWSRLHSFAIG 292
             IA+IAARETEK   + N    E+ S D     K+L G+DD G+L T  WS+LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 293 LPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 352
           LP APDL+AARKVA FIGSIHHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 353 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 412
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 413 AWGLEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEE 472
           AWGLEARVPFLD+DFL LCMNIDP DKMIKPKEGKIEKY+LRKAFDT++EPDVKPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 473 ILWRQKEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDA 532
           ILWRQKEQFSDGVGYSWID L+DTAERVISD MFANPK  WG DIPTTKEAYWYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 533 WFPQKTAANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
            FPQKTAA+TVMRW+PKADWGCAEDPSGRYAKIHE+H+
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHI 578

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  967 bits (2501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/572 (79%), Positives = 503/572 (87%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA ++ DDI SFKP AL+LSKR+RHRGPDWSGN + N TI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PI S DG Y+L VNGEIYNHI LREECSDY+F + SDCEPIIPLYL++D++ P++LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+C+YD ++DRIVAARDPIGV TLYMG+SS SP+T YFASELKCL D CD I AFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRYF PDW+DE RIPS PVDY A+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300
             IA+IAARETE+AN +  +  + D K LAG+DD+G LHT GWSRLHSFAIGLPNAPDLQ
Sbjct: 241 SLIASIAARETERANREAGDVYA-DGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDLQ 299

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 300 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQGV 359

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKSTMAWGLEARV
Sbjct: 360 KMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARV 419

Query: 421 PFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKEQ 480
           PFLD++FLQLCMNIDP +KMI P++G+IEKYILRKAFDT++EP V PYLPEEILWRQKEQ
Sbjct: 420 PFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKEQ 479

Query: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWIDGL+D AER ISD  FANP   WGDDIPTTKEA+WYRLKFDA FPQ TAA
Sbjct: 480 FSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTAA 539

Query: 541 NTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572
            TVMRWVPKADWGCAEDPSGRYAKIH++H+ +
Sbjct: 540 ATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  967 bits (2500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/573 (79%), Positives = 509/573 (88%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIF  +KH++  +FKP+ALQLSKRIRHRGPDWSGN V NSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS DG+++L VNGEIYNHIQ+RE+  DY+F+T SDCEPIIPLY+++  +APK+LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+ +YDAK+DRI+AARDPIG+ TLYMGRSSKSPKTVYFASELKCLTD CDSI+AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+TPDW+DE RI + P+D + IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANADVNEESSVDE-KQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARETEKA    + +S      QL GIDD G+L +SGWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
            AA+KVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479
           VPFLD++FL LCMNIDP +KMI  KEG+IEKYILRKAFDTT+EP+ KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+DTAERVISD +F NP+  WG DIPTTKEAYWYRLKFDA FPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572
           A+TVMRW+PKADWGCAEDPSGRYAKIHE+H+GA
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIGA 573

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/573 (78%), Positives = 500/573 (87%), Gaps = 6/573 (1%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+H D+  ++P ALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PI S  G Y L VNGEIYNHIQLREECSDY FQ+ SDCEPIIPLYL++ +DAPK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+C+YD+K+DRIVAARDPIG+ TLYMG+SSKSPKT +FASELKCL D CD I+AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D+ITRYF P WLDE  +PSTP+DY  +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANAD---VNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAP 297
             IA+IAARETE+AN +   VN +S  +EK LAGID QG+LHT GWSRLHSFAIGLP AP
Sbjct: 241 SLIASIAARETERANEELDPVNYDS--EEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAP 298

Query: 298 DLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA 357
           DL AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA
Sbjct: 299 DLLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA 358

Query: 358 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 417
           QGVKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLE
Sbjct: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLE 418

Query: 418 ARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQ 477
           ARVPFLD+DFL LCM +DP +KMIKP+EG+IEKYILRKAFDTT+EP+VKPYLPE+ILWRQ
Sbjct: 419 ARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQ 478

Query: 478 KEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQK 537
           KEQFSDGVGYSWIDGL+D AE  ISD M A P+ +WGDD PTTKEAYWYRLKFD +FP K
Sbjct: 479 KEQFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-K 537

Query: 538 TAANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
           +AANTVMRW+PKADWGC  DPSGR+AKIHE+H+
Sbjct: 538 SAANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/573 (77%), Positives = 495/573 (86%), Gaps = 5/573 (0%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA ++ D I SFKP ALQLSKRIRHRGPDWSGN V N TIFVHERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PI S DG Y+L VNGEIYNHI LR+ C+DY F T SDCEPIIPL+ ++ ++ P YLDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180
           A+C+YDAK DRIVAARDPIGV TLYMG+ SKSP+T YFASELKCL + CD II+FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF P WL +   P+ PVDY  +R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANAD---VNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAP 297
             IAAIAARETEKAN +   V  +S V  + L G+DD+ HLH SGWS+LHSFAIGLPNAP
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQV--RNLVGVDDELHLHASGWSKLHSFAIGLPNAP 298

Query: 298 DLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA 357
           DLQAARKVAKFIGSIHHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKIKA
Sbjct: 299 DLQAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKA 358

Query: 358 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 417
           QG+KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKSTMAWGLE
Sbjct: 359 QGIKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLE 418

Query: 418 ARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQ 477
           ARVPFLD+DFL+LCMNIDP++KMIKPKEGKIEKYILRKAFDT++EPDV+PYLP+EILWRQ
Sbjct: 419 ARVPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQ 478

Query: 478 KEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQK 537
           KEQFSDGVGYSWID L+D AE  ISD  FA PK +WGDDIP+TKEAYWYR+KFDA FPQ 
Sbjct: 479 KEQFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQP 538

Query: 538 TAANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570
           TAA+TVMRWVPKA+WGC+EDPSGR+AKIHEKH+
Sbjct: 539 TAASTVMRWVPKAEWGCSEDPSGRFAKIHEKHI 571

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 353 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 412
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 413 AWGLEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRK 455
           A G+E R PFLD+  ++  M   P +        KI K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQSIPIN-------WKINKLILRK 471

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 61/133 (45%), Gaps = 25/133 (18%)

Query: 69  YMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHD----IDAPKYLDGMFAFCI 124
           Y+L  NGE+YN     EE  D      +D   +  L LE+D     +   +L+G FA+ I
Sbjct: 88  YILQFNGELYN-----EEILD------NDTSFVASL-LENDKMSVFEVISFLEGEFAYTI 135

Query: 125 YDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFAS---ELKCLTDVCDSIIAFPPGHVY 181
           YD  + ++   RD IG  +L   R  ++   +Y AS   + +  TD    I+     ++Y
Sbjct: 136 YDMHEHKLYFGRDDIGKRSLSY-RLDQAIGDIYVASVTGQQEGFTDCLAGIV-----YIY 189

Query: 182 DSQTDKITRYFTP 194
           D +   + +   P
Sbjct: 190 DVEDKSLNQQMLP 202

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 112/524 (21%), Positives = 196/524 (37%), Gaps = 121/524 (23%)

Query: 1   MCGIFAAFKH-------DDIHSFKPKAL--------------QLSKRIRHRGPDWSGN-- 37
           MCGI A F         D+      K L              +L   I  RGP+++    
Sbjct: 1   MCGILAYFGKSFGSTLTDEFQELYEKDLTGPIQSCNSNTLFNELIPYIVRRGPNYASLRS 60

Query: 38  -AVMNSTIFVHERLAIVGLDS--GAQPITSADGEYMLGVNGEIYNHIQLREECSDYKFQT 94
            + +N+ +F     +++ L +    Q +   D  Y+L  NGE+YN   + E C       
Sbjct: 61  LSEINAMLFS----SVLSLRTPFTKQSVMVQD-RYLLQYNGELYNDDTV-ENCEH----- 109

Query: 95  FSDCEPIIPLYLEHDID-APKYLDGMFAFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSP 153
            SD E I  L  +H ++   +   G FA+ I D ++ ++   RD IG          +S 
Sbjct: 110 -SDTEYISSLLEKHSVEEVVRKCYGEFAYAITDLQERKVYFGRDSIG---------KRSL 159

Query: 154 KTVYFASEL--KCLTDVCDSIIAFPPG--HVYDSQTDKITRYFTPDWLDEKRIPSTPVDY 209
             +    EL    ++  CD       G  +++D  T ++T   +    DE  I S  +D 
Sbjct: 160 SYILLDDELYITSVSGRCDGFQNCLAGVIYIFDINTKQLTG--SVKIHDEPYIVSDQIDN 217

Query: 210 ---------LAIRHSLEKAVRKRLMAEVPYXXXXXXXXXXXXIAAIAARETEKANADVNE 260
                    + +   L ++V +R                   I  I     E  N  +  
Sbjct: 218 DFQLLEEYKIKLYECLRRSVYQR-------------------IVTIHPMHLENGNISILF 258

Query: 261 ESSVDEKQLAGI--DDQGHLHTSGWSRLHSFAIGLPN---------APDLQAARKVAKFI 309
              +D   +  +  +    ++ +  + +    +G  N         +PD   A K A+ +
Sbjct: 259 SGGLDCSVITALLCEQLIKINRNSETIIELLNVGFENPRTGKMPSDSPDRILAIKSAQLL 318

Query: 310 GSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPM--------FLLSR---KIKAQ 358
             ++ +    L E      D + H +T        +T M        +  SR   K+   
Sbjct: 319 SELYPQVNIKLIEVDVPYTDYLSHKDTVIDLMYPKNTEMDLSIAIAFYFASRGRGKVTEN 378

Query: 359 GVK--------MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKS 410
           G          ++ SG G+DE++GGY  F+   S  E   E  +++  +H  +  R +K 
Sbjct: 379 GESKPYNRSGIVMFSGLGADELYGGYHKFSNK-SNEELVIELQKQIAQIHDRNLNRDDKV 437

Query: 411 TMAWGLEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILR 454
               G+E R PFLD+  +Q  +++        P   K+ K+ILR
Sbjct: 438 ISNHGIEVRYPFLDERVVQFSVDL--------PLNYKVNKHILR 473

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFANK-SIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 422 FLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRK 455
           FLD++ +Q  ++  P          K+ K ILRK
Sbjct: 450 FLDEEVIQYSVSQIPISY-------KVNKGILRK 476

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 88/218 (40%), Gaps = 36/218 (16%)

Query: 27  IRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQPITS----ADGEYMLGVNGEIYNHIQ 82
           I  RGP++S   V       H       + S  QP T      D  Y+L  NGE+YN  +
Sbjct: 50  IVSRGPNYSSLRVNRE----HGISWFSSILSLRQPFTRQSIVVDERYVLQFNGELYNS-E 104

Query: 83  LREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCIYDAKKDRIVAARDPIGVV 142
           +    + Y       C+  +       +   + LDG FA+ IYD K+  I   RD IG  
Sbjct: 105 ISGNDTQYIVSLLKSCDGDV-------VSLVRKLDGGFAYTIYDLKEGNIYFGRDTIGKR 157

Query: 143 TLYMGRSSKSPKTVYFASELK----CLTDVCDSIIAFPPGHVYDSQT-----DKITR--Y 191
           +L       S +   F S +        D    +I     + YD++T      K+ R  Y
Sbjct: 158 SLCYSIDENSGEL--FISSVTGTRGTFVDCLGGVI-----YTYDTKTHTLDDTKVIRDKY 210

Query: 192 FTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVP 229
              D  DE    S  ++ L    +L ++V+KR+++  P
Sbjct: 211 VVTDMTDELENESQYMELLY--GTLYESVKKRVLSIHP 246

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 47/95 (49%), Gaps = 8/95 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 422 FLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKA 456
           FLD + +Q      P +        K+ K ILRK 
Sbjct: 447 FLDHNVVQFSTQEIPINY-------KVNKLILRKV 474

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 15/118 (12%)

Query: 27  IRHRGPDWSGNAVMNS--TIFVHERLAIVGLDSGAQPITSADGEYMLGVNGEIYNHIQLR 84
           I +RGP++S   +     T +    LA+  L    Q +   D  Y+L  NGE+YN  +++
Sbjct: 46  IANRGPNYSSLRLSEKYHTAWFSSVLAL-RLPFTKQSLCVED-RYVLQFNGELYNK-EIK 102

Query: 85  EECSDYKF--QTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCIYDAKKDRIVAARDPIG 140
           ++ +D +F     S    +I    +        LDG FA+ IYD ++ +I   RD IG
Sbjct: 103 QDQNDTQFIASLLSSSTDVIHTLTQ--------LDGEFAYTIYDLRETKIYFGRDSIG 152

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 9/94 (9%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ +G G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 422 FLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRK 455
           FLD+  ++  + +        P   K +K ILRK
Sbjct: 441 FLDEKVIKASVAL--------PISYKNDKMILRK 466

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 53/99 (53%), Gaps = 9/99 (9%)

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 416 LEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILR 454
           +E R PFLD    +  +N   K+    P   KI K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKE---IPINYKINKKILR 477

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 59/124 (47%), Gaps = 17/124 (13%)

Query: 27  IRHRGPDWSGNAVMNSTIFVHERLA-IVGLDSGAQPITSADGE----YMLGVNGEIYNHI 81
           I  RGP++    V  S     E+++    + S  +P T    E    Y+L  NGE+YN+ 
Sbjct: 47  IARRGPNYQMFRVFKS-----EQISWYSSILSLRKPFTKQSIEVNDRYILQFNGELYNN- 100

Query: 82  QLREECSDYKFQTFSDCEPIIPLYLEHDI-DAPKYLDGMFAFCIYDAKKDRIVAARDPIG 140
                 SD  +  F +C  +     E DI +  + L+G FA+ I+D+KK  +   RD IG
Sbjct: 101 -EIHGISDTTY--FVNC--LKTALDEKDIINILRTLEGEFAYTIFDSKKKLVYFGRDTIG 155

Query: 141 VVTL 144
             +L
Sbjct: 156 KRSL 159

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 45.8 bits (107), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 45/89 (50%), Gaps = 14/89 (15%)

Query: 102 IPLYLEHDIDAPKYLDGMFAFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASE 161
           +P YLE DIDAPK+L+ MFAF     +K              ++ G S    +T +  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCCCC--------KIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKCLTDV----CDSIIAFPPGHVYDSQ 184
             L C T +    CD+  +F PG V+DS+
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 53/101 (52%), Gaps = 9/101 (8%)

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415
           + QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G
Sbjct: 388 QRQGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNG 445

Query: 416 LEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKA 456
           +E R PFLD+  + L         +  P   K+ K ILRK 
Sbjct: 446 VEVRYPFLDEYVINLST-------LEIPINYKVNKLILRKV 479

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 56/123 (45%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQPIT----SADGEYMLGVNGEIYNHIQ 82
           I  RGP++S   V+ +    H+      + S  +P T    + D  Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRVIKA----HQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN--- 99

Query: 83  LREECSDYKFQTFSDCEPIIPLYLEHDI-DAPKYLDGMFAFCIYDAKKDRIVAARDPIGV 141
             +E SD+   +      +  L    ++ D  + L+G +A+ +YD K       RDPIG 
Sbjct: 100 --KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 VTL 144
            +L
Sbjct: 158 RSL 160

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 9/105 (8%)

Query: 351 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKS 410
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +   E  +++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 411 TMAWGLEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRK 455
               G+E R PFLD++ ++          M  P   K+ K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFST-------MEIPINYKVNKMILRK 475

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 68/171 (39%), Gaps = 41/171 (23%)

Query: 1   MCGIFAAFK-HDDIHSFKPKALQL------SKR--------------IRHRGPDWSGNAV 39
           MCGI       DD++  K + L+       SKR              I  RGP++S   V
Sbjct: 1   MCGILLHHAGDDDLYHLKEQFLEFPEGSLSSKRCSDGSPIFNSIIPYISARGPNYSSLRV 60

Query: 40  MNS--TIFVHERLAIVGLDSGAQPITSADGE----YMLGVNGEIYNHIQLREECSDYKFQ 93
                T +    L++       QP T    E    Y+L  NGE+YNH ++    + Y   
Sbjct: 61  SKKYKTAWYSSVLSL------RQPFTCQSIEIEERYVLQFNGELYNH-EIVHNDTQYIVG 113

Query: 94  TFSDCEPIIPLYLEHDIDAPKYLDGMFAFCIYDAKKDRIVAARDPIGVVTL 144
              +  P IP  +       K L+G FA+ IYD +       RD +G  +L
Sbjct: 114 LLKESAPSIPAII-------KKLNGEFAYSIYDIQNGTFYFGRDTVGKRSL 157

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 422 FLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRK 455
           FLD D ++      P +        K+ K ILR+
Sbjct: 449 FLDHDVIKFSTEEIPINY-------KVNKMILRR 475

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 113/264 (42%), Gaps = 53/264 (20%)

Query: 1   MCGI---FAAFKHD-------------DIHSFKPKAL----QLSKRIRHRGPDWSGNAVM 40
           MCGI   +A  K D             D HS + K       +   I+ RGPD+S   V 
Sbjct: 1   MCGILLHYAPLKSDNHCFVDEYVEDIADGHSQRSKTTAFFDSMVPYIKSRGPDYSSLRVS 60

Query: 41  NSTIFVHERLAIVGLDSGAQPITS----ADGEYMLGVNGEIYNHIQLREECSDYKFQTFS 96
           +     H       + S  +P TS        ++L  NGE+YN     +E + +     +
Sbjct: 61  SE----HSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYN-----QEITAHD----N 107

Query: 97  DCEPIIPLYLE--HDI-DAPKYLDGMFAFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSP 153
           D + I+    E  HD+    + L G FA+ +YD ++ +    RD +G  +L    S+ + 
Sbjct: 108 DTQFIVSKLQEGYHDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDNVGKRSLSYHLSAITG 167

Query: 154 KTVYFASELKCLTDVCDSIIAFPPGHVYDSQTDKI-------TRYFTPDWLDEK-RIPST 205
           + +Y +S    +    D I      +VYD+++  +       ++YF    LDE+     +
Sbjct: 168 E-LYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLESQYFITKKLDEELTCLDS 224

Query: 206 PVDYLAIRHSLEKAVRKRLMAEVP 229
            V+ L    SL  AVRKR+++  P
Sbjct: 225 TVEQLYGMLSL--AVRKRVLSIHP 246

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY  FA   S  E   E  +++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 422 FLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRK 455
           FLD D ++      P +        KI K ILRK
Sbjct: 455 FLDIDVIKFSTEELPINY-------KINKLILRK 481

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 78/168 (46%), Gaps = 19/168 (11%)

Query: 69  YMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCIYDAK 128
           Y++  NGE+YN  +++   + Y  Q   + + II        D  + LDG FA+ IYD +
Sbjct: 91  YVVQFNGELYND-EIQYNDTQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQ 141

Query: 129 KDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHVYDSQ---- 184
                  RDPIG   L     +++ + +Y +S   C T   D I      + YD Q    
Sbjct: 142 NRMFYFGRDPIGRRCLSFSIDNETGE-LYISSVTGCKTGFQDCIAG--TIYKYDCQLKEL 198

Query: 185 -TD-KITR-YFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVP 229
            TD KI++ ++  + LD++ +     +   +   L  +V KR+++  P
Sbjct: 199 NTDSKISKPFYVSEELDDENLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 9/93 (9%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   + G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVEVRYP 448

Query: 422 FLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILR 454
           FLD+  +Q    +        P   K+ K ILR
Sbjct: 449 FLDEKVVQFSTEL--------PINYKVNKKILR 473

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 64/134 (47%), Gaps = 20/134 (14%)

Query: 27  IRHRGPDWSGNAVMNSTIF-VHERLAIVGL-DSGAQPITSADGEYMLGVNGEIYNH-IQL 83
           I +RGP+++  ++ NS+ + +    +I+ L D   +     +  ++L  NGE+YN  IQ 
Sbjct: 49  IINRGPNYA--SIRNSSKYGISWFSSILSLRDPLTRQSVKINDRFVLQYNGELYNSSIQ- 105

Query: 84  REECSDYKFQTFSDCEPIIPLYLEHDIDAPKY---LDGMFAFCIYDAKKDRIVAARDPIG 140
                       +D   I  L   +  D PK    ++G FA+ I+D + +++   RD IG
Sbjct: 106 -----------HNDTLFIASLIERYQDDIPKAIREMEGEFAYTIFDKQCEKLYFGRDTIG 154

Query: 141 VVTLYMGRSSKSPK 154
             +L     S++ K
Sbjct: 155 KRSLSYKFDSETSK 168

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (51%), Gaps = 9/99 (9%)

Query: 358 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 417
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 418 ARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKA 456
            R PFLD+  ++    +D       P   KI K ILR  
Sbjct: 448 VRYPFLDEHVIKFSA-VDI------PINFKINKLILRNV 479

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 71/168 (42%), Gaps = 28/168 (16%)

Query: 27  IRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQPIT----SADGEYMLGVNGEIYNHIQ 82
           I  RGP++S   V  +    ++      + S  QP T    S D  Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRVSKA----YQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYN--- 99

Query: 83  LREECSDYKFQTFSDCEPIIPLY--LEHD---IDAPKYLDGMFAFCIYDAKKDRIVAARD 137
             +E SD      +D + I  L   L  D   ID  + L+G +A+ +YD K  +    RD
Sbjct: 100 --KEISDDD----NDSQYIASLLQNLTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRD 153

Query: 138 PIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHVYDSQT 185
           PIG  +L    S      +Y AS    +    D I     G VY+  T
Sbjct: 154 PIGRRSL--SYSVTPNNELYVASATGAIEGFQDCI----GGIVYEYDT 195

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 354 KIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 412
           KI  Q   +VL SG G+DE++GGY  FA   S  +   E  +++ N+H  +  R +K   
Sbjct: 380 KIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIA 438

Query: 413 AWGLEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILR 454
           + G+E R PFLD   ++      P +        KI K ILR
Sbjct: 439 SNGVEIRYPFLDSSVVKFSTEDLPINY-------KINKLILR 473

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 60/133 (45%), Gaps = 23/133 (17%)

Query: 27  IRHRGPD---WSGNAVMNSTIFVHERLAIVGLDSGAQPITS----ADGEYMLGVNGEIYN 79
           I  RGP+   W G+A  ++  F     +++ L    QP T      DG Y+L  NGE+YN
Sbjct: 47  IAARGPNFASWRGSAEYSTAWFS----SVLSL---RQPFTKQSLVVDGRYVLQFNGELYN 99

Query: 80  HIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCIYDAKKDRIVAARDPI 139
             ++    + Y     +  E  IP       D    LDG FA+ IYD +  +    RD I
Sbjct: 100 D-EIEFNDTQYIADMLARGEASIP-------DIIARLDGEFAYTIYDTEDQKYYFGRDAI 151

Query: 140 GVVTL-YMGRSSK 151
           G  +L Y   +SK
Sbjct: 152 GKRSLSYYVNTSK 164

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 422 FLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKA 456
           FLD+  ++L            P   K+ K ILRK 
Sbjct: 452 FLDEYVIKLST-------AEIPINFKVNKLILRKV 479

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 42/90 (46%), Gaps = 10/90 (11%)

Query: 60  QPIT----SADGEYMLGVNGEIYN-HIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPK 114
           QP T    + D  Y L  NGE+YN  I   +  S Y      + +  + +     ID  K
Sbjct: 76  QPFTKQSINVDDRYFLQFNGELYNKEISQGDNDSLYIASMLQNLKEGMGV-----IDVIK 130

Query: 115 YLDGMFAFCIYDAKKDRIVAARDPIGVVTL 144
            L+G +A+ IYD    ++   RDPIG  +L
Sbjct: 131 SLEGEYAYTIYDVNSSKLYFGRDPIGRRSL 160

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query: 362 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420
           ++LSG G+DE++GGY  FA +AP   E   E  +++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 421 PFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKA 456
           PFLD+  ++          +  P   K+ K ILRK 
Sbjct: 451 PFLDEYVIKFST-------VEIPINYKVNKLILRKV 479

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 75/174 (43%), Gaps = 32/174 (18%)

Query: 27  IRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQPIT----SADGEYMLGVNGEIYNHIQ 82
           I  RGP++S       T+  +       + S  +P T    + D  Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSL----RTVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYN--- 99

Query: 83  LREECSDYKFQTFSDCEPIIPLY--LEHD---IDAPKYLDGMFAFCIYDAKKDRIVAARD 137
             +E S +     +D   I  L   LE D   ID  K L+G +A+ +YD K  +    RD
Sbjct: 100 --KEVSHWG----NDSLYIASLLKDLEDDGSVIDVIKSLEGEYAYTVYDVKSAKFYFGRD 153

Query: 138 PIGVVTLYMGRSSKSPKTVYFAS---ELKCLTDVCDSIIAFPPGHVYDSQTDKI 188
           PIG  +L    S  +   +Y AS    ++C  D     +     + YD+QT  +
Sbjct: 154 PIGRRSL--SYSVTANNELYVASVTGAVECFHDCIGGTV-----YEYDTQTKSL 200

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY  F    +  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 422 FLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRK 455
           FLD+  ++   +  P +        KI K ILRK
Sbjct: 451 FLDEHVIKYSTHDIPINY-------KINKLILRK 477

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 67/175 (38%), Gaps = 46/175 (26%)

Query: 1   MCGIFA--------AFKHDDIHSFK---PKAL----------QLSKRIRHRGPDWSGNAV 39
           MCGI           F  ++   FK   P AL           L K I  RGP+++    
Sbjct: 1   MCGILLNISPNDNLKFFQNEYKEFKENCPDALLNSNNDYTFSNLMKLISARGPNFASLRT 60

Query: 40  MNSTIFVHERLAIVGLDSGAQPITS----ADGEYMLGVNGEIYNHIQLREECSDYKFQTF 95
           +      H       + S  +P        +  Y+L  NGE+YN   +            
Sbjct: 61  LKD----HRISLFSSVLSLREPFCKQSVLVEDRYVLQFNGELYNDEIIH----------- 105

Query: 96  SDCEPIIPLYLEHD------IDAPKYLDGMFAFCIYDAKKDRIVAARDPIGVVTL 144
           +D + I+ L L  +      I   K LDG FAF IYD K  R+   RDPIG  +L
Sbjct: 106 NDTQFIVKLLLNTEQNSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRDPIGKRSL 160

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 50/99 (50%), Gaps = 10/99 (10%)

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 416 LEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILR 454
           +E R PFLD   ++    +        P   K+ K ILR
Sbjct: 442 VEVRYPFLDDRVIEFSTQL--------PINYKVNKMILR 472

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 95/435 (21%), Positives = 155/435 (35%), Gaps = 98/435 (22%)

Query: 69  YMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAP---KYLDGMFAFCIY 125
           ++L  NGEIYN              + +D + I  + L    D P   + L G FA+ IY
Sbjct: 91  FVLQYNGEIYN-----------SSISHNDTQYIAEMLLNAK-DIPSVIRTLSGEFAYTIY 138

Query: 126 DAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAF---PPGHVYD 182
           D     +   RDPIG  +L     +   K         C++ V   I  F     G +Y 
Sbjct: 139 DKLTGEVFFGRDPIGRRSLSFKLDTGDSKI--------CISSVSGKIEGFQDCQAGVIYV 190

Query: 183 SQTDKITRYFTPDWLDEKRIPSTPVDY---------LAIRHSLEKAVRKRLMAEVPYXXX 233
            Q +            E+   S  VD+           +   +  AVRKR          
Sbjct: 191 FQKNTGELKSNLRINSERFAVSNKVDHDLSQIVEQSCKLYEHISAAVRKR---------- 240

Query: 234 XXXXXXXXXIAAIAARETEKANADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGL 293
                    +  I    TE     +     +D   +  +  Q  L   G   L    +G 
Sbjct: 241 ---------VTTIHPMHTENRPISILFSGGLDCSVITSLICQQILDLGGNIVLELLNVGF 291

Query: 294 PN---------APDLQAARKVAKFIGSIHHEHTFTLQEGLDA-----------LDDVIYH 333
            N          PD    ++ A  + +++ +      E +D            + ++IY 
Sbjct: 292 ENPRTGLSPSQVPDRILGQRSASILRALYPQVQIMFVE-VDVPYSEFLKYKAHIMNMIYP 350

Query: 334 LETYDVTTIRASTPMFLLSR-----------KIKAQGVKMVL-SGEGSDEIFGGYLYFAQ 381
            +T    +I A+   +  SR           +I  +   +VL SG G+DE++GGY  F++
Sbjct: 351 KQTEMDLSIAAA--FYFASRGEGFVNEPSGTRISYKRKGLVLFSGLGADELYGGYHKFSK 408

Query: 382 APSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVPFLDKDFLQLCMNIDPKDKMI 441
             +  E   E   ++ N++  +  R +K   + G+E R PFLD   +     +       
Sbjct: 409 RAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYPFLDDQVVAFSTQL------- 460

Query: 442 KPKEGKIEKYILRKA 456
            P   K+ K ILRK 
Sbjct: 461 -PINYKVNKMILRKV 474

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 91/420 (21%), Positives = 158/420 (37%), Gaps = 75/420 (17%)

Query: 69  YMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCIYDAK 128
           Y+L  NGE+YN     ++ S    Q  +     +P+    D+   + L G FA+ IY+ K
Sbjct: 91  YILQYNGELYN-----DDISHNDSQYIAGLLEKLPV----DV-VLRRLYGEFAYSIYNTK 140

Query: 129 KDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLT-DVCDSIIAFPPGHVYDS---- 183
              I   RD +G  +L   + +++ +    +   K      CD+ I +    VYD+    
Sbjct: 141 TKCIYFGRDSVGKRSLSYHQDNETGELFITSVSGKLEGFKACDAGIIY----VYDTVRRT 196

Query: 184 --QTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYXXXXXXXXXXX 241
                ++  Y+      +  +     +   + + L  ++ KRL    P            
Sbjct: 197 LYNDMRLREYYQVSGTHDTDVELLQSNVDLLYNKLYDSINKRLTTIEP------------ 244

Query: 242 XIAAIAARETEKANADVNEESSVDEKQLAG-IDDQGHLHTSGWSRLHSFAIGLPN----- 295
                   E  K +  V     +D   +A  I +Q  +++     L + A   P      
Sbjct: 245 ------LHEENKTHVSVLFSGGLDCSVIAALICEQWKVNSDAVLELLNVAFENPRTGMKP 298

Query: 296 --APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPM----- 348
             APD   +++  K +  ++ +    L E   + DD + H            T M     
Sbjct: 299 SEAPDRILSKRSVKILRKLYPQTKIKLVEVDVSYDDYLKHKPVVIDLMYPKDTEMDLSIA 358

Query: 349 --FLLSRK-----------IKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQ 394
             F  + K           I  Q   +VL SG G+DE++GGY  F    S      E  +
Sbjct: 359 IAFYFASKGHGSLQEGDKTISYQRRSLVLFSGLGADELYGGYHKFNNK-SPELLIKELTK 417

Query: 395 RVKNLHLADCLRANKSTMAWGLEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILR 454
           ++ N++  +  R +K     G+E R PFLD++ + L  ++        P   K  K ILR
Sbjct: 418 QINNIYDRNLDRDDKCMACNGIEIRYPFLDEEVINLSTSL--------PINYKTNKNILR 469

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 6/93 (6%)

Query: 353 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 412
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 413 AWGLEARVPFLDKDFLQLCMNIDP----KDKMI 441
           + G+E R PFL ++ ++      P    +DKMI
Sbjct: 442 SNGVEVRYPFLAEEVVEFSTASIPLNYKRDKMI 474

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 61/131 (46%), Gaps = 22/131 (16%)

Query: 23  LSKRIRHRGPDWSGNAVMN--STIFVHERLAIVGLDSGAQPITSAD----GEYMLGVNGE 76
           + K +R RGP++     +   ++I++   L++       QP T        +Y+L  NGE
Sbjct: 39  IVKLVRCRGPNYCSMRQIKDVNSIWISSVLSL------RQPFTKQSIVIGNKYVLQFNGE 92

Query: 77  IYNHIQLREECSDYKFQT--FSDCEPIIPLYLEHDI-DAPKYLDGMFAFCIYDAKKDRIV 133
           +YN  ++ E  +D +F +     C        E DI +    LDG FAF I D + + I 
Sbjct: 93  LYND-EIIESGNDTQFLSGLLKKCIS------EDDIFNILHGLDGEFAFTIQDLENNLIY 145

Query: 134 AARDPIGVVTL 144
             RD IG  +L
Sbjct: 146 FGRDTIGKRSL 156

>Kwal_26.9477 s26 complement(1234178..1235710) [1533 bp, 510 aa]
           {ON} YMR300C (ADE4) - phosphoribosylpyrophosphate
           amidotransferase [contig 73] FULL
          Length = 510

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 80/214 (37%), Gaps = 54/214 (25%)

Query: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAV--------------MNSTIFV 46
           MCG+      D   +  P+       ++HRG D +G A               M   +F 
Sbjct: 1   MCGVLGIALADQSSAVAPELFDGCLFLQHRGQDAAGIATCGQRGRLYQCKGNGMARDVFT 60

Query: 47  HERLA-IVG---------------LDSGAQP--ITSADGEYMLGVNGEIYNHIQLR---E 85
            +R+A +VG                +S AQP  + S  G  +LG NG + N I LR   +
Sbjct: 61  QQRMAGLVGSMGIAHLRYPTAGSSANSEAQPFYVNSPYG-ILLGHNGNLVNTISLRRYMD 119

Query: 86  ECSDYKFQTFSDCEPIIPL----------YLEHDIDAPKYLDGMFAF------CIYDAKK 129
           E       T SD E ++ +          Y  ++ D    L+G++        C+     
Sbjct: 120 EDVHRHINTDSDSELLLNILAAELEKHNKYRVNNDDIFHALEGVYRLCRGGYACVGMLAG 179

Query: 130 DRIVAARDPIGVVTLYMGRSSK--SPKTVYFASE 161
             ++  RDP G+  L  G  +K    K    ASE
Sbjct: 180 YAMIGFRDPNGIRPLLFGERTKPDGTKDYMLASE 213

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,272,878
Number of extensions: 2559104
Number of successful extensions: 5902
Number of sequences better than 10.0: 46
Number of HSP's gapped: 5990
Number of HSP's successfully gapped: 63
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)