Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.2003.454ON44544523710.0
YGR110W (CLD1)3.454ON44544520410.0
Suva_7.3953.454ON45144419990.0
Skud_7.4153.454ON45244419960.0
ZYRO0C06270g3.454ON43040313370.0
TDEL0F033903.454ON42440013330.0
Kpol_1035.93.454ON42740712891e-176
SAKL0B06116g3.454ON43141412191e-165
KAFR0I019703.454ON41140012051e-163
KLTH0E13948g3.454ON43842812041e-163
Ecym_24653.454ON43840312011e-162
Kwal_27.123173.454ON43539511921e-161
KNAG0B009503.454ON41839911841e-160
NDAI0G010903.454ON45640711811e-159
NCAS0E008603.454ON44042111731e-158
ABL019W3.454ON43142011691e-158
TPHA0O013103.454ON43839011661e-157
CAGL0L04686g3.454ON45141310671e-142
KLLA0B12914g3.454ON42639610311e-137
TBLA0F034603.454ON4414099061e-118
SAKL0G19074gna 1ON4324084741e-53
KLTH0C01254gna 1ON4344314652e-52
Ecym_5577singletonON4334214616e-52
Kwal_14.985na 1ON4354114311e-47
Skud_12.1678.284ON3943481811e-13
Suva_2.2888.284ON4353471782e-13
YLR099C (ICT1)8.284ON3943481748e-13
KAFR0B053808.284ON4113981739e-13
Skud_4.3868.284ON4463551731e-12
Suva_10.1838.284ON3943481684e-12
Smik_12.1588.284ON3943341651e-11
TPHA0A016908.284ON4053621651e-11
TDEL0F041008.284ON4343871614e-11
YDR125C (ECM18)8.284ON4533741588e-11
Kpol_543.498.284ON4293911571e-10
SAKL0H16500g8.284ON4193961552e-10
Smik_4.3718.284ON4353531543e-10
Kwal_56.237028.284ON4163801499e-10
NDAI0J01200singletonON4273511491e-09
NDAI0J012108.284ON4163531481e-09
KLTH0G13178g8.284ON4153771418e-09
KNAG0G021408.284ON4083521419e-09
CAGL0B01969g8.284ON4233391411e-08
NCAS0B051208.284ON3963611411e-08
Ecym_42858.284ON4053531321e-07
KAFR0B028308.284ON3913641302e-07
ZYRO0D06666g8.284ON3803461284e-07
CAGL0M11462g8.284ON3863591241e-06
KNAG0H031208.284ON4343651222e-06
AGR062C8.284ON384581151e-05
KLLA0F19624g8.284ON4091601123e-05
TPHA0L016008.524ON3721161124e-05
NDAI0C054308.524ON3621181105e-05
CAGL0M05467g8.524ON3542021097e-05
NCAS0B037108.284ON4303411107e-05
SAKL0H10450g8.524ON3921141026e-04
TBLA0H014008.284ON42157960.003
ZYRO0F09064g8.524ON349116900.016
TDEL0B032508.524ON348115890.021
NCAS0B022608.524ON363115880.030
KNAG0A037708.524ON356115860.045
KAFR0E03110singletonON35686840.076
KLLA0A10395gna 2ON294161830.083
Skud_14.400na 3ON29366790.28
Suva_14.424na 3ON28958750.82
Kwal_27.10170na 2ON29355750.90
TDEL0G00150singletonON29967751.1
TBLA0H035408.524ON378116741.5
Skud_13.991.498ON31190722.0
Kpol_299.68.524ON349120722.0
YNR064Cna 3ON29052722.1
TDEL0D00200singletonON56763713.4
SAKL0E06138g2.347ON68379696.7
TDEL0A076806.353ON46242679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_6.200
         (445 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W ...   917   0.0  
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...   790   0.0  
Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W ...   774   0.0  
Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W ...   773   0.0  
ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} simila...   519   0.0  
TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.4...   518   0.0  
Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON...   501   e-176
SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {...   474   e-165
KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON}              468   e-163
KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]...   468   e-163
Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}...   467   e-162
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...   463   e-161
KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.4...   460   e-160
NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454    459   e-159
NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454    456   e-158
ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-synteni...   454   e-158
TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {...   453   e-157
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...   415   e-142
KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} simi...   401   e-137
TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON}              353   e-118
SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON} cons...   187   1e-53
KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {...   183   2e-52
Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar...   182   6e-52
Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON...   170   1e-47
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    74   1e-13
Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON...    73   2e-13
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    72   8e-13
KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON} Anc_8...    71   9e-13
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    71   1e-12
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    69   4e-12
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    68   1e-11
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    68   1e-11
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    67   4e-11
YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}  ...    65   8e-11
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    65   1e-10
SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} simi...    64   2e-10
Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON...    64   3e-10
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    62   9e-10
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              62   1e-09
NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8....    62   1e-09
KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} simi...    59   8e-09
KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {O...    59   9e-09
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    59   1e-08
NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {O...    59   1e-08
Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar t...    55   1e-07
KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {O...    55   2e-07
ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} simila...    54   4e-07
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    52   1e-06
KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.2...    52   2e-06
AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON} S...    49   1e-05
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    48   3e-05
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    48   4e-05
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    47   5e-05
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    47   7e-05
NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284     47   7e-05
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    44   6e-04
TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.2...    42   0.003
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    39   0.016
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    39   0.021
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    39   0.030
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    38   0.045
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               37   0.076
KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {O...    37   0.083
Skud_14.400 Chr14 complement(717609..718490) [882 bp, 293 aa] {O...    35   0.28 
Suva_14.424 Chr14 complement(736902..737771) [870 bp, 289 aa] {O...    33   0.82 
Kwal_27.10170 s27 complement(227197..228078) [882 bp, 293 aa] {O...    33   0.90 
TDEL0G00150 Chr7 complement(22315..23214) [900 bp, 299 aa] {ON}        33   1.1  
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    33   1.5  
Skud_13.99 Chr13 (170491..171426) [936 bp, 311 aa] {ON} YML050W ...    32   2.0  
Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON} (14238..15...    32   2.0  
YNR064C Chr14 complement(749136..750008) [873 bp, 290 aa] {ON} E...    32   2.1  
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                 32   3.4  
SAKL0E06138g Chr5 complement(498976..501027) [2052 bp, 683 aa] {...    31   6.7  
TDEL0A07680 Chr1 (1336496..1337884) [1389 bp, 462 aa] {ON} Anc_6...    30   9.8  

>Smik_6.200 Chr6 (329969..331306) [1338 bp, 445 aa] {ON} YGR110W
           (REAL)
          Length = 445

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/445 (100%), Positives = 445/445 (100%)

Query: 1   MFKSTLISIMRRPLKSFQLLTGANPSNTQPQCPRASVRDITEKQISRTPSAPTAIPLREI 60
           MFKSTLISIMRRPLKSFQLLTGANPSNTQPQCPRASVRDITEKQISRTPSAPTAIPLREI
Sbjct: 1   MFKSTLISIMRRPLKSFQLLTGANPSNTQPQCPRASVRDITEKQISRTPSAPTAIPLREI 60

Query: 61  IYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVVDDDG 120
           IYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVVDDDG
Sbjct: 61  IYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVVDDDG 120

Query: 121 NYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGY 180
           NYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGY
Sbjct: 121 NYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGY 180

Query: 181 GFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYV 240
           GFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYV
Sbjct: 181 GFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYV 240

Query: 241 QKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSR 300
           QKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSR
Sbjct: 241 QKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSR 300

Query: 301 QFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEP 360
           QFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEP
Sbjct: 301 QFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEP 360

Query: 361 RLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVP 420
           RLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVP
Sbjct: 361 RLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVP 420

Query: 421 HAGHHLYLDNSKFFNDILVKEMRKV 445
           HAGHHLYLDNSKFFNDILVKEMRKV
Sbjct: 421 HAGHHLYLDNSKFFNDILVKEMRKV 445

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/445 (83%), Positives = 411/445 (92%)

Query: 1   MFKSTLISIMRRPLKSFQLLTGANPSNTQPQCPRASVRDITEKQISRTPSAPTAIPLREI 60
           MFKSTL SI+RRPLK FQLL GA+ SNT+PQ PRAS RD+TEKQI RTPSAPTAIPLREI
Sbjct: 1   MFKSTLNSIIRRPLKGFQLLRGADSSNTRPQSPRASARDVTEKQILRTPSAPTAIPLREI 60

Query: 61  IYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVVDDDG 120
           IY+VP LFPRP+ DSVKDFRDFIK+ED FQTELLKTLPFYP PS+ K +R+IRTVVDD+G
Sbjct: 61  IYRVPSLFPRPLEDSVKDFRDFIKNEDAFQTELLKTLPFYPTPSESKTARLIRTVVDDEG 120

Query: 121 NYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGY 180
           NYINEFCIRP   SVPE +LKHL+FIHGYGAGLGFFIKNFEDIPLL+NEWC+HAIDLPGY
Sbjct: 121 NYINEFCIRPRKTSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLDNEWCIHAIDLPGY 180

Query: 181 GFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYV 240
           GFSSRPKFPFEYPRDN+H VQDWFH+R+HTWF+KRNLLN+P+KN+VMAHSLGSYLMALY+
Sbjct: 181 GFSSRPKFPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYL 240

Query: 241 QKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSR 300
           QKYKE PSFKKLILCSPAGVS+RD NNT SE EKWKPPPWWYVKLWDRNISPFTLVRN R
Sbjct: 241 QKYKESPSFKKLILCSPAGVSYRDFNNTASEVEKWKPPPWWYVKLWDRNISPFTLVRNFR 300

Query: 301 QFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEP 360
           Q GSKITSGWSYRRFKHILNGD +QS RFEALHRYAY+IFNKRGSGEYLLSFALKCGGEP
Sbjct: 301 QLGSKITSGWSYRRFKHILNGDPEQSKRFEALHRYAYAIFNKRGSGEYLLSFALKCGGEP 360

Query: 361 RLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVP 420
           RL LE+QLF+ +  +IL++SN +WLWLYGDDDWMDVNGG+RVS+FL EKL+QKSNVIIVP
Sbjct: 361 RLSLEQQLFDGKKSDILKNSNCDWLWLYGDDDWMDVNGGLRVSRFLKEKLKQKSNVIIVP 420

Query: 421 HAGHHLYLDNSKFFNDILVKEMRKV 445
           H+GHHLYLDN KFFN+IL KEM+K+
Sbjct: 421 HSGHHLYLDNYKFFNNILTKEMQKI 445

>Suva_7.395 Chr7 (684763..686118) [1356 bp, 451 aa] {ON} YGR110W
           (REAL)
          Length = 451

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/444 (81%), Positives = 405/444 (91%)

Query: 2   FKSTLISIMRRPLKSFQLLTGANPSNTQPQCPRASVRDITEKQISRTPSAPTAIPLREII 61
           FKSTL SI++ PLK FQLLTGA+ S+TQP+    S++D  EK+I RTPSAPTAIPLREII
Sbjct: 8   FKSTLSSIIKGPLKGFQLLTGASSSSTQPESGETSIKDAAEKRILRTPSAPTAIPLREII 67

Query: 62  YKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVVDDDGN 121
           YKVPGLFPRP+ DSVKDFRDFIK+ED FQTELL TLPFYPNPS  KKS++I+T+VDDDGN
Sbjct: 68  YKVPGLFPRPLEDSVKDFRDFIKNEDSFQTELLATLPFYPNPSTTKKSKLIKTIVDDDGN 127

Query: 122 YINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYG 181
           YINEFCI P  PSVPE +LKHL+FIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYG
Sbjct: 128 YINEFCIYPQVPSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYG 187

Query: 182 FSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQ 241
           FSSRPKFPF+YPRD++H VQDWFH+R+HTWF KRNLLNKP+KN+VMAHSLGSYLMALY+Q
Sbjct: 188 FSSRPKFPFKYPRDDIHSVQDWFHERIHTWFEKRNLLNKPEKNIVMAHSLGSYLMALYLQ 247

Query: 242 KYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSRQ 301
           KY+  PSFKKLILCSPAGVSHRD ++  S+ EKWKPPPWWYVKLWD+NISPFTLVRNSRQ
Sbjct: 248 KYEGSPSFKKLILCSPAGVSHRDFDSGNSDVEKWKPPPWWYVKLWDKNISPFTLVRNSRQ 307

Query: 302 FGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPR 361
           FGSKITSGWSYRRFKHILNGD  QS RFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPR
Sbjct: 308 FGSKITSGWSYRRFKHILNGDPDQSKRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPR 367

Query: 362 LPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVPH 421
           LPLEEQLFN +N N+L+++ YEW+WLYGDDDWMDVNGG+RVSK LN+KL+QKS+VI VP+
Sbjct: 368 LPLEEQLFNGKNANVLKNAKYEWVWLYGDDDWMDVNGGLRVSKLLNDKLKQKSSVITVPN 427

Query: 422 AGHHLYLDNSKFFNDILVKEMRKV 445
           AGHHLYLDN KFFN I++ EM+KV
Sbjct: 428 AGHHLYLDNHKFFNTIIMNEMQKV 451

>Skud_7.415 Chr7 (692655..694013) [1359 bp, 452 aa] {ON} YGR110W
           (REAL)
          Length = 452

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/444 (82%), Positives = 404/444 (90%)

Query: 2   FKSTLISIMRRPLKSFQLLTGANPSNTQPQCPRASVRDITEKQISRTPSAPTAIPLREII 61
           FKSTL SI+ RPLK  QLLTGAN S T+ +   +  RD TE++I RTPSAPTAIPLREII
Sbjct: 8   FKSTLSSIIGRPLKGLQLLTGANSSITRSESDESPERDGTEERILRTPSAPTAIPLREII 67

Query: 62  YKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVVDDDGN 121
           YKVPGLFPRP+ DSVKDFRDF K+EDVFQTELL+TLPFYPNPSK KKS++I+TVVDDDGN
Sbjct: 68  YKVPGLFPRPLEDSVKDFRDFTKNEDVFQTELLETLPFYPNPSKYKKSKLIKTVVDDDGN 127

Query: 122 YINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYG 181
           YINEFCI P  PSVPETELKHL+FIHGYGAGLGFFIKN EDIPLL+NEWC+HAIDLPGYG
Sbjct: 128 YINEFCIYPQKPSVPETELKHLVFIHGYGAGLGFFIKNLEDIPLLDNEWCIHAIDLPGYG 187

Query: 182 FSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQ 241
           FSSRPKFPFEYP+DNLH VQDWFH+R+HTWFNKRNLL+KPDKN+V+AHSLGSYLMALY+Q
Sbjct: 188 FSSRPKFPFEYPKDNLHTVQDWFHERIHTWFNKRNLLHKPDKNIVVAHSLGSYLMALYLQ 247

Query: 242 KYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSRQ 301
           KYKE PSFKKL+LCSPAGVS+RD +NTT+E  KWKPPPWWYVKLWDRNISPFTLVRN+RQ
Sbjct: 248 KYKESPSFKKLVLCSPAGVSNRDFDNTTAEVGKWKPPPWWYVKLWDRNISPFTLVRNARQ 307

Query: 302 FGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPR 361
            GSKITSGWSYRRFKHILNGD  QS RFEALHRYAYSIFNKRGSGEYLLSFAL+CGGEPR
Sbjct: 308 LGSKITSGWSYRRFKHILNGDPGQSRRFEALHRYAYSIFNKRGSGEYLLSFALRCGGEPR 367

Query: 362 LPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVPH 421
           LPLEEQLFN  N  +L++SNYEW+WLYG+DDWMDV+GG+RVSK+LNEKL QKSNV IVPH
Sbjct: 368 LPLEEQLFNGENSKVLKNSNYEWVWLYGNDDWMDVDGGLRVSKYLNEKLGQKSNVFIVPH 427

Query: 422 AGHHLYLDNSKFFNDILVKEMRKV 445
           AGHHLYLDN  FFN ILVKEM+ V
Sbjct: 428 AGHHLYLDNYTFFNKILVKEMQNV 451

>ZYRO0C06270g Chr3 (475283..476575) [1293 bp, 430 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
           Hypothetical ORF
          Length = 430

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/403 (60%), Positives = 300/403 (74%), Gaps = 10/403 (2%)

Query: 46  SRTPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSK 105
           +R P+APTAIPL +II ++P LFPR V  S +D++DF       Q ELL+TLPFYP  ++
Sbjct: 35  TRVPAAPTAIPLHKIIMRLPKLFPRSVDASTRDYKDFCYHTGQLQEELLRTLPFYPYCAE 94

Query: 106 LKKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPL 165
            KK+ V++T VDD GNYINEFCI P+ PSVP  ++KHLI IHGYGAGLGFF+KN E IPL
Sbjct: 95  SKKAEVVKTTVDDQGNYINEFCITPVKPSVPSHKMKHLICIHGYGAGLGFFLKNLEGIPL 154

Query: 166 LNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNV 225
           L+N W +HAIDLPGYGFSSRPKFPF+YP+D+L  V  WFH R+HTWF KR LL     N+
Sbjct: 155 LDNSWVIHAIDLPGYGFSSRPKFPFKYPKDSLSQVHSWFHDRIHTWFKKRGLLVNSQNNL 214

Query: 226 VMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKL 285
           VMAHSLG+YLMALY  KY     FKKL++CSPAGV      +TT++      PPWWY KL
Sbjct: 215 VMAHSLGAYLMALYTTKYTTH--FKKLVMCSPAGV----CKSTTAKNIGNTTPPWWYTKL 268

Query: 286 WDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQS---SRFEALHRYAYSIFNK 342
           WD NISPF LVRN+   GS +TSGWSYRRF  +L  +   +    +FEALHRYAY+IFN+
Sbjct: 269 WDLNISPFCLVRNAAALGSMVTSGWSYRRFNKLLQSNSNTNLDRLQFEALHRYAYAIFNR 328

Query: 343 RGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRV 402
           RGSGEYLLSFAL CGG+PRLPLE+ +F D+   I R SN EW+W+YG+ DWMDVNGG RV
Sbjct: 329 RGSGEYLLSFALSCGGDPRLPLEDTIFKDKTSGIFR-SNCEWIWIYGERDWMDVNGGERV 387

Query: 403 SKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445
           S+F+  +  +KS V + P++GHHLY DN KFFN  +VK+M+ +
Sbjct: 388 SRFIENQGGRKSQVHVAPNSGHHLYFDNHKFFNSFIVKQMKDM 430

>TDEL0F03390 Chr6 (624579..625853) [1275 bp, 424 aa] {ON} Anc_3.454
           YGR110W
          Length = 424

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/400 (62%), Positives = 309/400 (77%), Gaps = 10/400 (2%)

Query: 48  TPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIK-SEDVFQTELLKTLPFYPNPSKL 106
            P+APTAIPLREII K+P LFPR  GDSV+D+RD  + +++ FQ +LL TLPFY      
Sbjct: 33  VPAAPTAIPLREIIVKLPSLFPRSFGDSVRDYRDLCRHTDEKFQRDLLATLPFYGEGDLH 92

Query: 107 KKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLL 166
           ++S VIRT VDD+GNYINEF I P N SVP   LKHL+FIHGYGAGLGFF+KNFE+IPLL
Sbjct: 93  RRSEVIRTKVDDEGNYINEFYIMPKNASVPRDRLKHLVFIHGYGAGLGFFLKNFENIPLL 152

Query: 167 NNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVV 226
           NNEWC+HAIDLPGYGFSSR KFPF+YP+D + DV +WFHKRL+ WF +RNLL  P+ N+V
Sbjct: 153 NNEWCIHAIDLPGYGFSSRCKFPFQYPKDTVTDVHEWFHKRLNRWFAERNLLRNPENNIV 212

Query: 227 MAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLW 286
           MAHSLG+YLMALY    K    FKKL++CSPAG+      +TT++A   + PPWWY KLW
Sbjct: 213 MAHSLGAYLMALYAS--KNSSHFKKLVMCSPAGICE----STTTKAIGNRKPPWWYSKLW 266

Query: 287 DRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQS-SRFEALHRYAYSIFNKRGS 345
           DRNISPF+LVR S + GSK+TSGWSY+RF  +L    ++S  +FEALH+Y YSIFNK G 
Sbjct: 267 DRNISPFSLVRVSSRLGSKLTSGWSYKRFGKLLRSKSRKSEQQFEALHKYCYSIFNKPGC 326

Query: 346 GEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKF 405
           GEYLLSFAL+CGG+PR+PLE+ LF   +  I+ + N EWLWLYG+ DWMD NGG RVS+ 
Sbjct: 327 GEYLLSFALRCGGDPRIPLEDMLFKTNDSGIM-NGNLEWLWLYGERDWMDFNGGKRVSEH 385

Query: 406 LNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445
           L +K  QKS V IVP+AGHHLY DN  +FN ++++EM+ +
Sbjct: 386 L-KKSGQKSEVCIVPNAGHHLYFDNYDYFNSLIIREMKSM 424

>Kpol_1035.9 s1035 complement(19721..21004) [1284 bp, 427 aa] {ON}
           complement(19721..21004) [1284 nt, 428 aa]
          Length = 427

 Score =  501 bits (1289), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 236/407 (57%), Positives = 304/407 (74%), Gaps = 14/407 (3%)

Query: 42  EKQISRTPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYP 101
           ++++   P+AP AIPL EII K+P LFPR + +S+ D+ DF K  D FQTELL TLP+YP
Sbjct: 32  DEKLPTVPAAPAAIPLYEIILKLPNLFPRTLKESLNDYHDFHKDIDKFQTELLSTLPYYP 91

Query: 102 NPSKLKKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFE 161
             +  KK+ +I T VDD+GNYINEFCI PI     + +LKHLIFIHGYGAGLGFF+KNFE
Sbjct: 92  MANDGKKAELITTKVDDEGNYINEFCISPIGAEADQRDLKHLIFIHGYGAGLGFFLKNFE 151

Query: 162 DIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKP 221
            +PLL+N+WC+HAIDLPGYG+S R +FPF+YP  ++ DVQDWFHKR+ TWF  R+LL  P
Sbjct: 152 HLPLLDNKWCIHAIDLPGYGYSKRCEFPFKYPEHDISDVQDWFHKRIRTWFKARSLLTTP 211

Query: 222 DKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWW 281
           + N++MAHSLG+YLMALY+ K+     FKK+++CSPAG+      ++TSE       PWW
Sbjct: 212 ENNMIMAHSLGAYLMALYIDKFPN--DFKKIVMCSPAGICQ----SSTSEEIGNIKTPWW 265

Query: 282 YVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSS---RFEALHRYAYS 338
           + KLWD+N+SPFTLVRN+   GSK+TSGWSYRRFK      LKQS    +FE LHRYAYS
Sbjct: 266 FNKLWDQNVSPFTLVRNTYYLGSKLTSGWSYRRFKQ-----LKQSGHLMQFEKLHRYAYS 320

Query: 339 IFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNG 398
           IFN++GSGEY+L FALKCGG+PR+PLE+ LF       +  S+ EWLW+YG+ DWMD+ G
Sbjct: 321 IFNQKGSGEYILGFALKCGGDPRIPLEDNLFKSPKTEGIPKSDCEWLWVYGEKDWMDIGG 380

Query: 399 GIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445
           G RV+  L  +  +KS+  +VP +GHHLY DN KFFN++LVKEM+ +
Sbjct: 381 GKRVTDELVTRFGKKSSTTVVPDSGHHLYFDNYKFFNELLVKEMKNM 427

>SAKL0B06116g Chr2 complement(519929..521224) [1296 bp, 431 aa] {ON}
           similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 431

 Score =  474 bits (1219), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 229/414 (55%), Positives = 304/414 (73%), Gaps = 17/414 (4%)

Query: 34  RASVRDITEKQ--ISRTPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQT 91
           RA VR   E    I++  + PTA+PL +I  ++P LFP     S++D+  F ++ + FQ+
Sbjct: 31  RAKVRTSAETTAIINQKSTPPTAMPLIQIATQLPNLFPLSFEASIRDYSMFQENAESFQS 90

Query: 92  ELLKTLPFYPNPSKLKKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGA 151
           +LL TLPFYP+P+  + S +++T VDD+GNYINEF I+P+NPS   + +KHLIF+HGYGA
Sbjct: 91  QLLSTLPFYPSPANGRSSEILKTPVDDEGNYINEFTIKPMNPSS-SSSMKHLIFVHGYGA 149

Query: 152 GLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTW 211
           GLGFF+KNFE+IPLLNN WC+HAIDLPGYGFSSRPKFPF YP  N   V+DWFH+R+  W
Sbjct: 150 GLGFFLKNFENIPLLNNNWCIHAIDLPGYGFSSRPKFPFNYPEHNPIMVEDWFHQRIKGW 209

Query: 212 FNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSE 271
            +KR LL  P  N+++AHSLG+Y+ ALY  K+     F KLI+CSPAG+           
Sbjct: 210 LHKRGLLANPKNNLLVAHSLGAYISALYANKFPNH--FSKLIMCSPAGI--------CPS 259

Query: 272 AEKWKPPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEA 331
            +  + PP W+VKLWDRNISPF+LVRNS   GSK+TSGW+YRRF+  L    +   + +A
Sbjct: 260 PKLGQAPPQWFVKLWDRNISPFSLVRNSFHLGSKLTSGWTYRRFRQFLREGQRGYEQHKA 319

Query: 332 LHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDD 391
           +H+Y Y+IFNK GSGEYLLSFALKCGG+PRLPLE++LF++ +      +N +WLWLYGD+
Sbjct: 320 MHKYTYAIFNKPGSGEYLLSFALKCGGDPRLPLEKRLFDNTS---SFKANCDWLWLYGDE 376

Query: 392 DWMDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445
           DWMD+ GG R S+FL +K+  KS+V +VP AGHHLYLDN K FN++++KEM K+
Sbjct: 377 DWMDLRGGQRASEFL-KKIGMKSDVKVVPSAGHHLYLDNYKHFNNVVIKEMEKM 429

>KAFR0I01970 Chr9 (401907..403142) [1236 bp, 411 aa] {ON} 
          Length = 411

 Score =  468 bits (1205), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 230/400 (57%), Positives = 290/400 (72%), Gaps = 16/400 (4%)

Query: 46  SRTPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSK 105
           S   SAP AIPL +II ++P LFPR + +S KD+R + +  +  Q +LL TLPFYPN SK
Sbjct: 28  SNISSAPVAIPLVKIIAQLPRLFPRSIDESFKDYRVYKEGPERMQEDLLSTLPFYPNVSK 87

Query: 106 LKKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPL 165
            K +R+I+TVVD++GNYINEFCI P N +V   +LKHLIFIHGYGAG GFF+KN E IPL
Sbjct: 88  DKVARIIKTVVDEEGNYINEFCITPKN-TVNSQKLKHLIFIHGYGAGFGFFLKNLESIPL 146

Query: 166 LNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNV 225
           L+N WC+HAIDLPG+GFSSR  FPF+YP  N  +V  WFH+R+  W  +R LL+ P  NV
Sbjct: 147 LDNNWCIHAIDLPGFGFSSRKNFPFKYPTSNTSEVTAWFHERIRRWLEERTLLDNPKNNV 206

Query: 226 VMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKL 285
           ++AHSLG+YLMALY Q Y      +KLI+CSPAGVS +  NN+ +  +    PPWWY KL
Sbjct: 207 IVAHSLGAYLMALYTQVYPAH--LRKLIMCSPAGVS-KSQNNSKAVLQ----PPWWYAKL 259

Query: 286 WDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGS 345
           WD N+SPFTLVR S+  GSK+TSGWSYRRFK I N       +FE LHRY+Y+IFN+ GS
Sbjct: 260 WDMNLSPFTLVRLSKHLGSKLTSGWSYRRFKLIEN-----RMQFEMLHRYSYAIFNQPGS 314

Query: 346 GEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKF 405
           GEYLL F L+CGG PR  LE+ LF++ N N+  SS  EW W+YG++DWMD+ GG RV   
Sbjct: 315 GEYLLGFILECGGNPRCSLEDTLFSN-NFNV--SSKVEWAWIYGENDWMDIEGGRRVHNL 371

Query: 406 LNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445
           L EK  + S   +VP+AGHHLYLDN ++FN+I+V+ M  V
Sbjct: 372 LLEKFNRDSKFYMVPNAGHHLYLDNIRYFNNIIVQHMENV 411

>KLTH0E13948g Chr5 complement(1231122..1232438) [1317 bp, 438 aa]
           {ON} similar to uniprot|P53264 Saccharomyces cerevisiae
           YGR110W Hypothetical ORF
          Length = 438

 Score =  468 bits (1204), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 228/428 (53%), Positives = 298/428 (69%), Gaps = 12/428 (2%)

Query: 16  SFQLLTGANPSNTQPQCPRASVRDITEKQISRTPSAPTAIPLREIIYKVPGLFPRPVGDS 75
           +F  + G  P   +P  P  S    +   I+  PS+P+AIPLRE++  +P LFPR + +S
Sbjct: 19  AFSQVVGIQPKVRKPAFPCNS-ESASNPSITCRPSSPSAIPLRELVINLPRLFPRSMKES 77

Query: 76  VKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVVDDDGNYINEFCIRPINPSV 135
           V+D+  F K     Q +LL TLPF+P     K + V++T VD+  NYINEFC+RP  P  
Sbjct: 78  VRDYFAFRKDAGTLQHQLLSTLPFFPVAGDDKVAEVVQTPVDEQANYINEFCVRPAMPH- 136

Query: 136 PETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRD 195
           P   L+HLI +HGYGAGLGFF+KN E + L++N W +HAIDLPGYGFSSRPKFP++Y  D
Sbjct: 137 PSGTLRHLIIVHGYGAGLGFFLKNLEKLNLIDNRWVIHAIDLPGYGFSSRPKFPYKYKSD 196

Query: 196 NLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILC 255
               V+ WFH R  TW  KR LL  P++N+++AHS+G+YL ALY  KY     FKKL++C
Sbjct: 197 PAAQVEHWFHARFKTWLEKRGLLQHPEQNMLVAHSMGAYLAALYANKYPNH--FKKLVMC 254

Query: 256 SPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRF 315
           SPAG+ +  SN      ++ + PPWW+ KLWDRNISPF+LVRNSR  GSK+TSGWSYRRF
Sbjct: 255 SPAGICNTPSN------KQRRLPPWWFAKLWDRNISPFSLVRNSRLLGSKLTSGWSYRRF 308

Query: 316 KHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLN 375
             +L+   + + +FEA+H+YAY+IFN  GSGEYLLSFALKCGG+PR  LE +LF+++ +N
Sbjct: 309 GQLLSEGYRGAQQFEAIHKYAYAIFNSPGSGEYLLSFALKCGGDPRDALERRLFHNK-MN 367

Query: 376 ILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFN 435
             + +  EWLWLYGD DWMDV GG RVS FLN  + +KS V +V  +GHHLY DN + FN
Sbjct: 368 QFK-AKCEWLWLYGDQDWMDVGGGRRVSHFLNTAMGKKSKVEVVHDSGHHLYFDNYEQFN 426

Query: 436 DILVKEMR 443
            IL KEM+
Sbjct: 427 RILEKEMK 434

>Ecym_2465 Chr2 complement(908173..909489) [1317 bp, 438 aa] {ON}
           similar to Ashbya gossypii ABL019W
          Length = 438

 Score =  467 bits (1201), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 227/403 (56%), Positives = 289/403 (71%), Gaps = 15/403 (3%)

Query: 46  SRTPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSK 105
           S  P+ PTAIPL EI+  +P LFP P+ +S KD++ F    D FQT LL TLPF+P+ + 
Sbjct: 40  SPKPTPPTAIPLMEILLNIPSLFPMPLKESWKDYKIFHDDVDKFQTGLLSTLPFFPSAAD 99

Query: 106 LKKSRVIRTVVDDDGNYINEFCIRPINPSV--PETELKHLIFIHGYGAGLGFFIKNFEDI 163
            K   +IRT VD++GNYINEFCIRP +P V   ++++ HLIF+HGYGAGLGFF+KNFE+I
Sbjct: 100 GKIGEIIRTPVDEEGNYINEFCIRPNSPPVNPKDSKMHHLIFVHGYGAGLGFFLKNFENI 159

Query: 164 PLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDK 223
            LLNN W +HAID PGYGFSSRPKFPF   ++   +V++WFH R   W  KR LL   ++
Sbjct: 160 KLLNNSWTIHAIDFPGYGFSSRPKFPFSINKNTASEVENWFHDRFEIWLQKRGLLEDQER 219

Query: 224 NVVMAHSLGSYLMALYVQKYKERPS-FKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWY 282
           N+V+AHSLG+YL+ALY Q    RP   KKLI+CSPAG+    SN         K PPWW+
Sbjct: 220 NLVLAHSLGAYLIALYAQ---SRPKHLKKLIMCSPAGIC--PSNKVI------KQPPWWF 268

Query: 283 VKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNK 342
           VKLWDRN+SPF+LVRNS  FGSK+TSGWS+RRFK  LN      S+F+ALHRYAY+IFNK
Sbjct: 269 VKLWDRNLSPFSLVRNSGIFGSKLTSGWSFRRFKQFLNEGTMGESQFQALHRYAYAIFNK 328

Query: 343 RGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRV 402
            GSGEYLLSF LKCGG+PR PL  +LFN +  +  + +  +WLW+YGD DWMD  GG + 
Sbjct: 329 PGSGEYLLSFVLKCGGDPRSPLLSRLFNSQAADSFK-AQCDWLWMYGDQDWMDCKGGEQA 387

Query: 403 SKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445
           S F+   + ++SNV ++P +GHHLYLDN   FN++L  EM K+
Sbjct: 388 SDFIVRHIGKESNVHVIPQSGHHLYLDNYSVFNELLQAEMAKM 430

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score =  463 bits (1192), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 221/395 (55%), Positives = 280/395 (70%), Gaps = 11/395 (2%)

Query: 49  PSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKK 108
           PS+P+AIPL EII K+P LFPR +  S +DF+DF  +    Q+ELL TLPF+P     + 
Sbjct: 51  PSSPSAIPLNEIILKLPNLFPRSLEQSARDFKDFKLNAGALQSELLATLPFFPAGDSRRT 110

Query: 109 SRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNN 168
           + +IRT VD  GNYINEF IRP      +T +KHLI +HGYGAGLGFF+K FE++ L+N 
Sbjct: 111 AEIIRTTVDAQGNYINEFNIRPTAVDTSKT-MKHLILVHGYGAGLGFFLKTFENLNLINE 169

Query: 169 EWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMA 228
            W +HAIDLPGYGFSSRP FPF+        V+ WFH R H W  +R LL  P+ N+V+A
Sbjct: 170 NWMIHAIDLPGYGFSSRPPFPFKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVA 229

Query: 229 HSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDR 288
           HS+G+YL ALY  K+     FKKL++CSPAGV H     +  E  K +PPPWW+ KLWD+
Sbjct: 230 HSMGAYLTALYANKHPGH--FKKLVMCSPAGVCH-----SAPEMRK-RPPPWWFAKLWDK 281

Query: 289 NISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEY 348
           NISPF+LVRN+   GSK+TSGWSYRR   +L   +  + + EALHRYAY+IFN++GSGEY
Sbjct: 282 NISPFSLVRNANVLGSKLTSGWSYRRLGQLLKDKVLNARQHEALHRYAYAIFNRKGSGEY 341

Query: 349 LLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNE 408
           LLSFAL+CGGEPR+PLE +LF++R       +N EWLWLYGD DW+D  GG RVS+FL  
Sbjct: 342 LLSFALQCGGEPRVPLERRLFHNRGQQF--KANCEWLWLYGDQDWIDRRGGERVSQFLTA 399

Query: 409 KLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMR 443
           ++  +S V IV ++GHHLYLDN + FN IL  EMR
Sbjct: 400 EMGHESCVKIVKNSGHHLYLDNHRMFNKILEDEMR 434

>KNAG0B00950 Chr2 (173167..174423) [1257 bp, 418 aa] {ON} Anc_3.454
           YGR110W
          Length = 418

 Score =  460 bits (1184), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 229/399 (57%), Positives = 290/399 (72%), Gaps = 18/399 (4%)

Query: 47  RTPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKL 106
           +TP+APTAIPL EII K+P LFPR V  S++D++ F  + D  Q +LL TLPF+P     
Sbjct: 38  KTPTAPTAIPLTEIIVKLPYLFPRGVAQSLEDYKVFSNNADKIQYDLLSTLPFFPEAKDG 97

Query: 107 KKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLL 166
           K++ ++RT +D+D N+INEF I+P N + P ++LKHLIFIHGYGAGLGFF+KNFE+I L 
Sbjct: 98  KRAEIVRTKIDEDDNFINEFFIQPANVTEP-SKLKHLIFIHGYGAGLGFFLKNFENIQLK 156

Query: 167 NNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVV 226
           +N WC+HAIDLPG+GFSSR KFPF+YP D++  VQ WFH+RL  WF KR+LL  P  N+V
Sbjct: 157 DNSWCIHAIDLPGFGFSSRTKFPFKYPEDDVSKVQTWFHERLKIWFEKRDLLKNPGNNMV 216

Query: 227 MAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLW 286
           +AHSLG+YLMALY  K      FKKLI+CSPAG+     N+T  +    K PPWWY  LW
Sbjct: 217 VAHSLGAYLMALY--KRNNPLHFKKLIMCSPAGM----CNSTVVK----KQPPWWYAALW 266

Query: 287 DRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSG 346
           D N+SPF+LVRNS   GSK+TSGWSYRRF+      L    +FE LH Y+Y+IFN+ G G
Sbjct: 267 DMNLSPFSLVRNSGWLGSKLTSGWSYRRFR-----SLHSKIQFENLHLYSYAIFNRPGCG 321

Query: 347 EYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFL 406
           EYLL+FAL+CGG+PR+ LE  LFND  +     S+ EW+WLYGD DWMDV GG R+S+ +
Sbjct: 322 EYLLAFALRCGGDPRVSLEATLFND--VVNKWDSDSEWVWLYGDRDWMDVKGGRRISQKI 379

Query: 407 NEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445
           NE    KS+V ++P+AGHHLY DN   FN IL KEM K+
Sbjct: 380 NEIFPGKSSVEVIPNAGHHLYFDNISCFNAILEKEMTKL 418

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score =  459 bits (1181), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 232/407 (57%), Positives = 292/407 (71%), Gaps = 20/407 (4%)

Query: 41  TEKQISRTPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFY 100
           T K  +  P+ PTAIPL  II  +P LFPR +  S++D++ F K  +  Q +LLKTLPF+
Sbjct: 61  TTKINTIAPTPPTAIPLLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFF 120

Query: 101 PNPSKLKKSRVIRTVVDD-DGNYINEFCIRP-INPSVPETELKHLIFIHGYGAGLGFFIK 158
            N +K K  ++++T ++D D  YINEFCI P  N ++   ++KHLIFIHGYGAGLGFFIK
Sbjct: 121 SNGAKFKTGKILKTQIEDNDDYYINEFCITPDTNININSADVKHLIFIHGYGAGLGFFIK 180

Query: 159 NFEDIPLLNNEWCVHAIDLPGYGFSSR-PKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNL 217
           N E+IPLLNN WC+HAIDLPGYG+S+R  KFPF+YPRD+   VQ+WFH ++H W  KRNL
Sbjct: 181 NLENIPLLNNRWCIHAIDLPGYGYSTRNKKFPFKYPRDSQLKVQNWFHDKIHIWLQKRNL 240

Query: 218 LNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKW-K 276
           LN P  N+++AHSLG+YLMA Y  K+     F+KLI+CSPAGV       T S  +K   
Sbjct: 241 LNYPKNNLIVAHSLGAYLMAQYAFKFPSH--FQKLIMCSPAGV-------TKSSIKKLNN 291

Query: 277 PPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYA 336
            PPWWY KLWD N SPF++VRNS  +GSKITS WSYRRFK  L+ D KQ   FEALHRYA
Sbjct: 292 SPPWWYEKLWDLNFSPFSIVRNSGIYGSKITSAWSYRRFKP-LDLDHKQ---FEALHRYA 347

Query: 337 YSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDV 396
           YSIFN+ G GEYLLSF L CGG PR  LE+ LF   NL+   +   +W W+YGD+DWMD+
Sbjct: 348 YSIFNRPGCGEYLLSFILSCGGNPRFSLEDTLFQRENLS---TELCDWGWIYGDNDWMDI 404

Query: 397 NGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMR 443
           NG  RVS+ +NE+ + KS+V ++P AGHHLYLDN K FN +L+KEM 
Sbjct: 405 NGAKRVSRLINEQQKGKSDVHVIPSAGHHLYLDNYKDFNKLLIKEME 451

>NCAS0E00860 Chr5 (157521..158843) [1323 bp, 440 aa] {ON} Anc_3.454
          Length = 440

 Score =  456 bits (1173), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 234/421 (55%), Positives = 290/421 (68%), Gaps = 21/421 (4%)

Query: 34  RASVRDITEKQISRT----PSAP-TAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDV 88
           + S R++TE   S T    PS P  AIP+ +II  +P LFPR + DS +D+  F    D 
Sbjct: 31  QESQRNVTEYATSNTILPQPSTPPVAIPITDIITSLPSLFPRSLHDSRRDYNTFTTDIDS 90

Query: 89  FQTELLKTLPFYPNPSKLKKSRVIRTVVDDDGNYINEFCIRPI--NPSVPETELKHLIFI 146
            Q  LLKTLPF+P  S  K +++IRT +DD+GNYINEFCI P   +      +LKHLIFI
Sbjct: 91  LQLNLLKTLPFFPMGSSQKVAKLIRTPIDDEGNYINEFCIMPAVKDGDYSSPDLKHLIFI 150

Query: 147 HGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHK 206
           HGYGAGLGFF+KN E+IPLL+N+WC+HAIDLPGYGFSSR KFPF YP D+   VQ WFH 
Sbjct: 151 HGYGAGLGFFLKNLENIPLLDNKWCIHAIDLPGYGFSSRFKFPFHYPNDSQTKVQKWFHD 210

Query: 207 RLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSN 266
           R++ WF +RNLL  P  N+VMAHSLG+YLMA Y   +     FKK+I+CSPAGVS     
Sbjct: 211 RIYRWFRERNLLQNPQNNLVMAHSLGAYLMAHYAFHFSNH--FKKIIMCSPAGVSQ---- 264

Query: 267 NTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQS 326
              +  ++ K PPWWY KLWD N SPF+LVRNS  +GSKITSGWSYRRFK      L + 
Sbjct: 265 --FAVGKQNKQPPWWYNKLWDLNYSPFSLVRNSGIYGSKITSGWSYRRFKPTSFNGLNE- 321

Query: 327 SRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLW 386
           S+FEALH+Y Y IFNK GSGEYLLSF L CGG+PR  LE+ LF + N         +W+W
Sbjct: 322 SQFEALHKYTYGIFNKNGSGEYLLSFILSCGGDPRFALEDNLFKEEN---PPEDLCDWVW 378

Query: 387 LYGDDDWMDVNGGIRVSKFLNEKL--RQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRK 444
           +YGD DWMD+NG  R+S+ L +K     KS V ++P AGHHLYLDN K FN++++KEM  
Sbjct: 379 VYGDRDWMDINGAHRISRRLVKKAGDTSKSKVHVIPSAGHHLYLDNYKAFNNLIIKEMET 438

Query: 445 V 445
           +
Sbjct: 439 M 439

>ABL019W Chr2 (361560..362855) [1296 bp, 431 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR110W
          Length = 431

 Score =  454 bits (1169), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 223/420 (53%), Positives = 289/420 (68%), Gaps = 19/420 (4%)

Query: 29  QPQCPRASVRDITEKQISRTPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDV 88
           Q Q PR   R I      R P+ PTA+PL EII  +P LFP P   S +D++ F    + 
Sbjct: 25  QVQAPRKDGRHI---HTVRKPTPPTAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREA 81

Query: 89  FQTELLKTLPFYPNPSKLKKSRVIRTVVDDDGNYINEFCIRPINPSVPE---TELKHLIF 145
           FQ  LL TLPF+    + K  ++IRT VDD+GNYINEFCIRP   S+ E       HLIF
Sbjct: 82  FQVGLLSTLPFFERAREGKIGKIIRTPVDDEGNYINEFCIRPA--SMEENHGAATNHLIF 139

Query: 146 IHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFH 205
           IHGYGAGLGFFIKNFE +PLL+++W +HAIDLPGYG+S+R +FPF+    ++ +V+ WFH
Sbjct: 140 IHGYGAGLGFFIKNFEHLPLLDDQWVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFH 199

Query: 206 KRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDS 265
           +RL TW +KR LL  P +N+VMAHS+G+YL A Y Q  +    FKKLI+CSPAG+S   S
Sbjct: 200 ERLETWLSKRGLLQAPHRNMVMAHSMGAYLTAHYAQSRQNH--FKKLIMCSPAGISPSKS 257

Query: 266 NNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQ 325
                     K PPWW++KLWDRN+SPF+LVRNS   GSK+TSGWS+RRF+H+LN     
Sbjct: 258 MK--------KQPPWWFIKLWDRNVSPFSLVRNSGPLGSKLTSGWSFRRFRHLLNEGEIG 309

Query: 326 SSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWL 385
             +FEALH+Y+Y+IFN  GSGEYLLSF LKCGG+PR+PL   +F+    +  + +  EWL
Sbjct: 310 MRQFEALHKYSYAIFNMPGSGEYLLSFVLKCGGDPRIPLLGSMFSPEKEHGFK-AQCEWL 368

Query: 386 WLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445
           WLYGD  WMD  GG R S ++ +++  KS V IVP++GHHLY DN  +FN IL++EM+ +
Sbjct: 369 WLYGDHVWMDKEGGQRASSYITDRIGGKSRVEIVPNSGHHLYFDNYSYFNKILLREMQSI 428

>TPHA0O01310 Chr15 complement(258745..260061) [1317 bp, 438 aa] {ON}
           
          Length = 438

 Score =  453 bits (1166), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 221/390 (56%), Positives = 286/390 (73%), Gaps = 14/390 (3%)

Query: 55  IPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRT 114
           + L E+I + P LFPR    S +D++ F    + FQ  LL+TLP++P+PS    S++  T
Sbjct: 59  LSLFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLPYFPDPSNGIYSKITNT 118

Query: 115 VVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHA 174
           +VDD+G+ INEF + P N SVP  +LKHLIF+HGYGAGLGFF+KN E+I LLN+EWCVHA
Sbjct: 119 IVDDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFFLKNLENIKLLNDEWCVHA 178

Query: 175 IDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSY 234
           IDLPGYGFS+R KFPF+  +     V +WFH R+  W ++RNLL     N ++AHSLG+Y
Sbjct: 179 IDLPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQRNLLQHSQNNFLIAHSLGAY 238

Query: 235 LMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFT 294
           LMALYV K+      +K+++CSPAG+   DS N      K K P WW+ KLW+RNISPFT
Sbjct: 239 LMALYVDKHPN--DLQKILMCSPAGIG--DSMNL-----KKKTPAWWFEKLWERNISPFT 289

Query: 295 LVRNSRQFGSKITSGWSYRRFKHILN-GDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFA 353
           LVR+S   GSK+TSGW+YRRF  +L+  +LKQ   FEALH+Y YSIFN+RGSGEYLL+FA
Sbjct: 290 LVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQ---FEALHKYTYSIFNQRGSGEYLLNFA 346

Query: 354 LKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQK 413
           LKCGG PR PLE+ LF + +  I +SS  EW+W YGD+DWMD NGGIRVS+ L ++L+++
Sbjct: 347 LKCGGGPRYPLEKTLFMNNDKGISKSST-EWIWAYGDNDWMDKNGGIRVSEILTKQLKKR 405

Query: 414 SNVIIVPHAGHHLYLDNSKFFNDILVKEMR 443
           S V IVP AGHHLY DN +FFND+++KEM 
Sbjct: 406 SEVYIVPRAGHHLYFDNHQFFNDLILKEME 435

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score =  415 bits (1067), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 212/413 (51%), Positives = 280/413 (67%), Gaps = 22/413 (5%)

Query: 50  SAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKS 109
           +APTA PL EI+  +P LFPR + +S +D+  F  + D+ Q ELL+TLPF+      K++
Sbjct: 43  TAPTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRA 102

Query: 110 RVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNE 169
            + +T +D DGNYINE  I P N   P  + K LIF+HGYGAGLGF++KN+E +PLL++ 
Sbjct: 103 YLRKTEIDSDGNYINELVIEPANVD-PNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDS 161

Query: 170 WCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAH 229
           W +HAIDLPGYGFSSR  FPF++PRD+   V DWF  RL T F KR   +K D N+VMAH
Sbjct: 162 WSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGF-DKSD-NIVMAH 219

Query: 230 SLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRD---SNNTTSEAEKWKPP-------- 278
           S+G+YLMA Y+ KY +  S KK+++CSPAG+S      +NN T +    K          
Sbjct: 220 SMGAYLMAFYLNKYPD--SVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKKV 277

Query: 279 PWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYS 338
           PWWY KLWDRNISPF LVR +   GSKITSGW+YRRFK IL        +FE LHRY+++
Sbjct: 278 PWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRYSFA 337

Query: 339 IFNKRGSGEYLLSFALKCGGEPRLPLEEQLF-NDRN-LNI----LRSSNYEWLWLYGDDD 392
           IFN +GSGEYLLSF L+CGG+PR PLE  LF +D N   I    +++S+ EW+W+YG +D
Sbjct: 338 IFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWVYGAND 397

Query: 393 WMDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRKV 445
           WMD++G  RV+K      R+KS V+ +P +GHHLY DN   FN +L+ EM+ +
Sbjct: 398 WMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKSL 450

>KLLA0B12914g Chr2 (1126975..1128255) [1281 bp, 426 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110W
          Length = 426

 Score =  401 bits (1031), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 198/396 (50%), Positives = 265/396 (66%), Gaps = 25/396 (6%)

Query: 47  RTPSAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKL 106
           R  +AP  +PL +I+  +  LFP    +S+KD++ +  +++ FQ +LL  LP+YP PS  
Sbjct: 55  RKSTAPIGLPLLQIVTNLHKLFPLSFAESLKDYKQYNINKEQFQEDLLSVLPYYPEPSAR 114

Query: 107 KKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLL 166
             S++I+T +D  GNYINEF I PI P      LKH+I +HGYGAGLGF++KNF    LL
Sbjct: 115 FSSKIIKTPIDAAGNYINEFQITPIRPESDGKPLKHIILVHGYGAGLGFYLKNFN--ALL 172

Query: 167 NNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVV 226
           +    VHAIDLPGYGFSSRP FPF YP+D+   V+D+FH  LH WF+K+ L++  + N V
Sbjct: 173 SENVVVHAIDLPGYGFSSRPMFPFHYPKDSYLAVEDYFHDALHKWFDKKGLISCWENNYV 232

Query: 227 MAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLW 286
           +AHS+G+Y+ +LY  KYK    FKKL +CSP G+S           +   PPPWW++KLW
Sbjct: 233 IAHSMGAYIFSLYANKYKH---FKKLFMCSPGGISRN---------KDMPPPPWWFLKLW 280

Query: 287 DRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSG 346
           D+NISPF+LVRN+   GSK+ SGW+ RRF             F+ LH Y Y IFN+ GSG
Sbjct: 281 DQNISPFSLVRNAGHVGSKLVSGWTARRFG-------LHHPNFDKLHHYTYGIFNQPGSG 333

Query: 347 EYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFL 406
           EY+LSF L CGG PR+PLE +LF + N N   SS+ +W+WLYGD DWMD+NG  R++ FL
Sbjct: 334 EYMLSFMLGCGGWPRVPLETRLFTEENFN---SSHLDWVWLYGDSDWMDINGARRINDFL 390

Query: 407 NEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEM 442
            +K    + + IVP+AGHHLY DN  FFN++L KE+
Sbjct: 391 RKKCIN-TKLEIVPNAGHHLYWDNDSFFNNVLRKEL 425

>TBLA0F03460 Chr6 (853280..854605) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score =  353 bits (906), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 195/409 (47%), Positives = 257/409 (62%), Gaps = 33/409 (8%)

Query: 50  SAPTAIPLREIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPN------- 102
           +AP A  L +I+  +P LFPR + DS++D+  F  + + FQ  LL  L FYP+       
Sbjct: 46  TAPKAASLPQILRNLPRLFPRSMTDSIRDYSQFKTNPEFFQDRLLSQLSFYPSLYNNNSN 105

Query: 103 ----PSKLKKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIK 158
                   ++ ++I+T V+++  YINEF I P N S P   LKHLI IHGYGAGLGF+I 
Sbjct: 106 DTSGNDDPRQGQIIKTYVNEN-EYINEFQILP-NTSTPYDRLKHLILIHGYGAGLGFYIN 163

Query: 159 NFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLH---DVQDWFHKRLHTWFNKR 215
             + + + N  WC+HA+DLPGYGFSSR KFP+      ++   DV DWF KRL TWF+K+
Sbjct: 164 TLQHLSMDN--WCIHAVDLPGYGFSSRLKFPYGTINPRIYSKKDVLDWFQKRLKTWFHKK 221

Query: 216 NLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKW 275
            LL  P+ N+V AHS+G+Y+M  Y+  +     F+K+I+CSPAG  +  SN  T+     
Sbjct: 222 GLLAHPENNLVTAHSMGAYIMCHYLNNHPS--DFRKIIMCSPAGF-YPASNPLTNI---- 274

Query: 276 KPPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRY 335
              P WY  LWDRN SPF+LVR S   GSK+TSGWSY RF H  +     +    ALH Y
Sbjct: 275 ---PLWYTYLWDRNYSPFSLVRISGPLGSKLTSGWSYSRFFH--SNQTISNELSLALHTY 329

Query: 336 AYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNL--NILRSSNYEWLWLYGDDDW 393
           AYSIFN  GSGEY LS  LK GG+PR PL+E+ F  ++   N +R SN E+ WLYG  DW
Sbjct: 330 AYSIFNLPGSGEYSLSHILKAGGDPRTPLQEEFFTCQSTTNNGIRRSNVEYSWLYGQSDW 389

Query: 394 MDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEM 442
           ++  GG ++S+FLN  L +KSNV I P++GHHLY DN  +FN  L KEM
Sbjct: 390 INKTGGFKISQFLNS-LNKKSNVFIAPNSGHHLYFDNYMWFNSYLAKEM 437

>SAKL0G19074g Chr7 (1646858..1648156) [1299 bp, 432 aa] {ON}
           conserved hypothetical protein
          Length = 432

 Score =  187 bits (474), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 141/408 (34%), Positives = 196/408 (48%), Gaps = 85/408 (20%)

Query: 90  QTELLKTLPFYPNPSKLKKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGY 149
           +  +L  L FYP   + ++   +   +   GN I+EFCI     S      + ++ +HGY
Sbjct: 45  EENILSMLDFYPEGDESRRCETMDVDIGT-GNSIHEFCIENTKES-DRDYCRDMVLVHGY 102

Query: 150 GAGLGFFIKNFE---DIPLLNNEWCVHAIDLPGYGFSSRPKFP-----------FEYPRD 195
           GA LG FI+NF+    IP +     +HAID+ GYG SSRPKFP            E  ++
Sbjct: 103 GAALGLFIRNFDGLSQIPGIR----LHAIDMLGYGLSSRPKFPDTGFLTSFWKKREVTKE 158

Query: 196 NLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILC 255
           ++   +D+F   + TW +KR+L    DK V++ HSLG YL   Y  KY ER   +KLIL 
Sbjct: 159 DVLLAEDFFIDSIETWRHKRHL----DKFVLVGHSLGGYLSCRYALKYPER--VEKLILV 212

Query: 256 SPAGV---------SHRDSNNTTSE-----AEKWK-------------PPPWWYVK---- 284
           SP GV          H  ++   +E     A++ K             P   ++V     
Sbjct: 213 SPVGVETSIFDLTKEHTATHEHAAELGPDIAQELKVVPENSTTDKPVQPSSSFHVPNESG 272

Query: 285 --------------LWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFE 330
                         +W+ NISPF ++R+   +G  + S WS+RRF H   GD +Q  +F 
Sbjct: 273 HVERIPNLPKIVRIIWENNISPFGILRSLGPWGPLLCSRWSFRRFSHC--GDKEQVMKF- 329

Query: 331 ALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGD 390
             H YAY+ FN RGSGEY L+  L  G   R+PL       +NL        E LW+YG 
Sbjct: 330 --HDYAYNTFNARGSGEYALTRILAPGVLARIPLLS--CAPKNLKC------ESLWMYGS 379

Query: 391 DDWMDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDIL 438
            DWM    G  + K LN K    ++  +V  AGHHLYLDN   FN  L
Sbjct: 380 HDWMSKEAGSVIVKELN-KAGNTADYSVVSDAGHHLYLDNPHEFNQKL 426

>KLTH0C01254g Chr3 complement(113435..114739) [1305 bp, 434 aa] {ON}
           conserved hypothetical protein
          Length = 434

 Score =  183 bits (465), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 137/431 (31%), Positives = 201/431 (46%), Gaps = 91/431 (21%)

Query: 77  KDFRDFIKSEDVFQTE--LLKTLPFYPNPSKLKKSRVIRTVVDDDGN--YINEFCIRPIN 132
           K F+ +    D  + E  LL TL F+P    ++   ++     D GN  +I+EF I+ I 
Sbjct: 28  KAFKTWWSRADAKENEKKLLSTLEFFPGGDSIRNCELLDV---DIGNKQHIHEFSIQNIE 84

Query: 133 PSVPETELKHLIFIHGYGAGLGFFIKNFED---IPLLNNEWCVHAIDLPGYGFSSRPKFP 189
            S      K L+ +HGYGA LG F++NF+    IP +N    +HA+D+ G G SSRP+FP
Sbjct: 85  -SCSRDYCKDLVMVHGYGAALGLFVRNFDGLSRIPGIN----LHALDMLGCGLSSRPRFP 139

Query: 190 F-----------EYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMAL 238
                          ++ +++ +++F   L  W  +R L    DK V++ HSLG YL   
Sbjct: 140 GTGLISSVIKRGRVTKEEVYEAENFFIDSLEKWRQQRKL----DKFVLVGHSLGGYLSCC 195

Query: 239 YVQKYKERPSFKKLILCSPAGVS---------HRDSNNTTSE------------------ 271
           Y  K+ ER   +KL+L SP GV          H  S+N  SE                  
Sbjct: 196 YALKFPER--VEKLVLVSPVGVEKSVFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTT 253

Query: 272 ------------------AEKWKPPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYR 313
                              E+    PW +  +W  NISPF L+R++   G  ++S WS+R
Sbjct: 254 DDPVKTSSSFHVPDEAGNVERVPNMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFR 313

Query: 314 RFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRN 373
           RF    N     + +    H Y YSIF+  GSGEY L+  L  G   R+PL  ++    N
Sbjct: 314 RFSFAEN-----TEQLLTFHEYCYSIFSGSGSGEYALTRILAPGVLARVPLLSRV--PEN 366

Query: 374 LNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNE-KLRQKSNVIIVPHAGHHLYLDNSK 432
           L        +  W+YG  DWM    G  + + +N+ K   K++  +V  AGHHLYLDN +
Sbjct: 367 LKC------DSFWMYGSHDWMSKEAGSVIVRQINKTKGSVKADYSVVSDAGHHLYLDNPE 420

Query: 433 FFNDILVKEMR 443
            FN  L K ++
Sbjct: 421 EFNQKLAKFLK 431

>Ecym_5577 Chr5 (1185997..1187298) [1302 bp, 433 aa] {ON} similar to
           Saccharomyces cerevisiae YGR110W
          Length = 433

 Score =  182 bits (461), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 134/421 (31%), Positives = 200/421 (47%), Gaps = 84/421 (19%)

Query: 77  KDFRDFIKSEDVFQTE--LLKTLPFYPNPSKLKKSRVIRTVVDDDGNYINEFCIRPINPS 134
           + F+ +  S  + + E  +L+ L FYP+    +   V+   +   G+Y++EFCI    P 
Sbjct: 26  ESFKTWKSSARLHEAEDNVLRMLSFYPDGDSERTCEVLHVDIGG-GDYMHEFCIENKLPM 84

Query: 135 VPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFP----F 190
             +T  K ++ +HGYG  LG FI+NF+++  +     +HAID+ GYG SSRP+FP    +
Sbjct: 85  TRDT-CKDIVLVHGYGTALGVFIRNFDELSQIPGVR-LHAIDMLGYGLSSRPRFPRSGFW 142

Query: 191 EY-------PRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKY 243
           +Y        ++ + +   +F   L  W  KRN+    D  V++ HSLG YL + Y  ++
Sbjct: 143 DYYVKGKVVTKEQVEEALAFFVDSLEAWREKRNV----DSFVLVGHSLGGYLSSFYALRH 198

Query: 244 KERPSFKKLILCSPAGVS-------------HR--------------------------D 264
            ER    KL+L SP GV              H+                          D
Sbjct: 199 PER--IDKLVLVSPVGVETSIYDLTAEHTPEHQHAGQLGPEVASEFKEDATEHTTDLSID 256

Query: 265 SNNTTSEA----------EKWKPPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRR 314
           SN+  S +          E     PW    LW+ N+SPF+L+R     G KI + WS+RR
Sbjct: 257 SNSPQSSSLHIPNEKGFVEHVPNIPWLVKMLWNTNVSPFSLLRLLGPLGPKICANWSFRR 316

Query: 315 FKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNL 374
           F     G  K ++     H+YAY+ F  +GSGEY +   L  G   R+PL  QL      
Sbjct: 317 F-----GACKDTNELMNFHQYAYNNFKAKGSGEYAMMKILAPGALARVPLLSQL-----P 366

Query: 375 NILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFF 434
             L+  +   LW+YG +DWM    G  + + L EK   ++   IV +AGHHLYLDN + F
Sbjct: 367 GALKCDS---LWMYGSNDWMSKEAGCIIVEELQEKSDYRAEYKIVNNAGHHLYLDNPEEF 423

Query: 435 N 435
           N
Sbjct: 424 N 424

>Kwal_14.985 s14 complement(142781..144088) [1308 bp, 435 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 244] FULL
          Length = 435

 Score =  170 bits (431), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 128/411 (31%), Positives = 190/411 (46%), Gaps = 79/411 (19%)

Query: 90  QTELLKTLPFYPNPSKLKKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHGY 149
           + +LL TL F+P     +K +++   + D    I+E  I  +  S   +    L+ +HGY
Sbjct: 44  EKQLLSTLEFFPQGDSTRKCKILDVDIGDK-QTIHELEIENLKTS-SRSYANDLVLVHGY 101

Query: 150 GAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFP-----------FEYPRDNLH 198
           GA LG F++NF+ +  +     +HAID+ G G SSRPKFP               ++ ++
Sbjct: 102 GAALGLFVRNFDGLSSVPG-IKLHAIDMLGCGLSSRPKFPGTGLISSLIKRGNVTKEEVY 160

Query: 199 DVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPA 258
           + +D+F   +  W  KR +    +K V++ HSLG YL + Y  KY ER   +KL+L SP 
Sbjct: 161 EAEDFFVDSMEKWRKKRQV----EKFVLVGHSLGGYLSSCYALKYPER--VEKLVLVSPV 214

Query: 259 GV---------SHRDSNNTTSE------------------------------------AE 273
           GV          H +S+   +E                                     E
Sbjct: 215 GVEKSIFDLTHEHTESHKGAAELGPDVAKEITNNPDKPTTDNPVKNSSSFHVPDEHGMVE 274

Query: 274 KWKPPPWWYVKLWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALH 333
           +       +  +W  NISPF ++R     G  I+S WS+RRF      D KQ   F   H
Sbjct: 275 RVPNMSRIFSYMWTYNISPFGILRTLGPVGPLISSNWSFRRFS--FTDDPKQLLTF---H 329

Query: 334 RYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDW 393
            Y Y +F+  GSGEY L+  L  G   RLPL  ++  +     L+  ++   W+YG  DW
Sbjct: 330 EYCYGVFSGAGSGEYALTRILAPGVLARLPLLSRMPGN-----LKCDSF---WMYGSQDW 381

Query: 394 MDVNGGIRVSKFLNEK-LRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMR 443
           M    G  + K LNE     K++  IV  AGHHLYLDN + FN  L+K ++
Sbjct: 382 MSKEAGSVMVKKLNESPGLGKADFSIVSDAGHHLYLDNPEEFNRKLLKFLK 432

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 89/348 (25%), Positives = 141/348 (40%), Gaps = 74/348 (21%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKF--------------- 188
           + IHGY A    F + FE   L +N   ++AIDLP  G S  P                 
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSDNIKDLYAIDLPANGASQAPALQVDKTKKIKPLRFKH 131

Query: 189 --------------PFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSY 234
                         P E  + +L   +++F  R+  W  K N L + +   V+ HS G Y
Sbjct: 132 IEDDVVVPVLDKHPPAEDIKSHLEQYENYFVDRIEQW-RKDNKLRRIN---VVGHSFGGY 187

Query: 235 LMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFT 294
           +   Y  KY    S  KL L SP GV     N+  + A KW+P   + +   D +   +T
Sbjct: 188 ISFKYALKYPN--SIDKLCLISPLGV----ENSIHAIAHKWEPNTTYPLTFTDPSSRYYT 241

Query: 295 LVRNSRQF---------------GSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSI 339
              N  QF               GSK+ S +    +  + +    Q  +   LH +    
Sbjct: 242 RKLNVPQFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPD----QLYKDYLLHSFV--- 294

Query: 340 FNKRGSGEYLLSFALKCGG---EPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDV 396
               G  + +    +K      E  L   + + N  N+ +L  + +  +++YG+ DWMD 
Sbjct: 295 ----GKNQTVQPQTIKVFTHLFERNLIARDPIIN--NVGLLNPATHV-MFMYGEHDWMDK 347

Query: 397 NGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRK 444
             G   ++ +  K + K++ + VP AGH+L+LDN   F   LV  + K
Sbjct: 348 YAGYLTTESM-LKNKAKASYVEVPDAGHNLFLDNPHHFTSSLVSFLSK 394

>Suva_2.288 Chr2 complement(496577..497884) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 91/347 (26%), Positives = 143/347 (41%), Gaps = 84/347 (24%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP----------------- 186
           + IHGY A    + +N+  +    +   +++IDLP  G SS P                 
Sbjct: 112 LLIHGYAASSMSYFRNYSGLS--KHFQNLYSIDLPASGLSSIPPLEVNTTTPLPLDIKFI 169

Query: 187 ---KFPFEYPRDNLHD------VQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMA 237
              KF   Y  +  H        +D++  R+  W     + NK DK  ++ HS G YL  
Sbjct: 170 GKNKFKIPYTINASHHKFVIQMFEDFYIDRIEQW----RIDNKLDKMNIVGHSFGGYLSF 225

Query: 238 LYVQKYKERPSFKKLILCSPAGV-------SHRDSNNTTSEAEKWKPPPWWYVK------ 284
            Y  KY    S +KL L SP GV       ++  S+NT    +   P   +Y K      
Sbjct: 226 KYAVKYPN--SVEKLCLVSPLGVERNIWSVNNNLSSNTLYTTDFKDPSSKFYSKGHLIPK 283

Query: 285 -LWDRNISPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKR 343
            L++     F L+R     G+K+   W+Y                       AYS     
Sbjct: 284 YLFEEQ---FKLLRLMGPLGAKVC--WNYIM--------------------AAYSRVTSL 318

Query: 344 GSGEYLLSFALKCGGEPRLPLE--EQLFNDRNLN---ILRSSNY----EWLWLYGDDDWM 394
              EY+       GG P +  +  + LF+   L    IL S NY    + L +YG  DWM
Sbjct: 319 AFKEYIFELFYGKGGIPEVTTDIFKGLFSRSILARDPILDSLNYLNVKKLLVVYGQYDWM 378

Query: 395 DVNGGIRVSKFLNE--KLRQKSNVIIVPHAGHHLYLDNSKFFNDILV 439
           + N G+ + + +N+     ++++ + VP +GH+L+LDN + FN  +V
Sbjct: 379 NKNAGMLLVENVNKLGNGLERASYLEVPSSGHNLFLDNPESFNQSIV 425

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 88/348 (25%), Positives = 141/348 (40%), Gaps = 74/348 (21%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKF--------------- 188
           + IHGY A    F + FE+  L +N   ++AIDLP  G S  P                 
Sbjct: 74  VLIHGYAASSMAFYRTFEN--LSDNIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKH 131

Query: 189 --------------PFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSY 234
                         P E  + +L   + +F  R+  W  K N L K +   V+ HS G Y
Sbjct: 132 IEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQW-RKDNKLRKIN---VVGHSFGGY 187

Query: 235 LMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFT 294
           +   Y  KY +  S +KL L SP GV     N+  +   KW+P   + +   D +   +T
Sbjct: 188 ISFKYALKYPD--SIEKLCLISPLGVE----NSIHAITHKWEPNTTYPLTFTDPSSRYYT 241

Query: 295 LVRNSRQF---------------GSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSI 339
              N  +F               GSK+ S +    +  + +    Q  +   LH +    
Sbjct: 242 RKLNVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPD----QIYKDYLLHSFV--- 294

Query: 340 FNKRGSGEYLLSFALKCGG---EPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDV 396
               G  + +    +K      E  L   + + N  N+  L  +    +++YG+ DWMD 
Sbjct: 295 ----GKNQTVQPQTIKVFTHLFERNLIARDPIIN--NVRFLNPAT-PVMFMYGEHDWMDK 347

Query: 397 NGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRK 444
             G   ++ +  K + K++ + VP AGH+L+LDN + F   LV  + K
Sbjct: 348 YAGYLTTESM-LKNKAKASYVEVPDAGHNLFLDNPQHFASSLVSFLSK 394

>KAFR0B05380 Chr2 (1107049..1108284) [1236 bp, 411 aa] {ON}
           Anc_8.284 YDR125C
          Length = 411

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 103/398 (25%), Positives = 159/398 (39%), Gaps = 96/398 (24%)

Query: 89  FQTELLKTLPFYPNPSKLKKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIHG 148
           FQ  ++K +P Y      +KS VI +   +  ++ N  C    N +VP       + +HG
Sbjct: 50  FQDAIMKKVPSYA-----EKSNVITSEGLNQWHFHNSKCR---NVTVPT------LLLHG 95

Query: 149 YGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSR--PKFPFEYPR--------DNLH 198
           + +    F +NF  +    +   ++AIDLP  G S     KF    P+        D++H
Sbjct: 96  FASSSMSFFRNFTGLS--QDIMDLYAIDLPANGLSRSLSTKFYRVSPKETRKFDMLDDIH 153

Query: 199 -----------------DVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQ 241
                              +D++   +  W  + N L+K +   ++AHS G YL   Y  
Sbjct: 154 FQLLSHGNYHAEKELIQKCEDYYIDTIERW-RRSNELHKIN---IVAHSFGGYLSFKYAL 209

Query: 242 KYKERPSFKKLILCSPAGVS---HRDSNN----TTSEAEKWKPPPWWYVKLWDRNISP-- 292
           KY E  S  KL L SP GV    +  +NN     T    +  P    Y+   + N  P  
Sbjct: 210 KYPE--SINKLCLVSPLGVEANIYSINNNFNVGETYTVNRLDPSSCCYI---NENEIPKY 264

Query: 293 -----FTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGE 347
                F ++R S   G+K+   +    +  I + D K         RY + +   +G   
Sbjct: 265 VFDNLFKILRLSGPIGAKLCWNYVLSSYSRISSLDFK---------RYVFELLYGKGGMT 315

Query: 348 YLLSFALKCGGEPRLPLEEQLFNDRNL--NILRSSNYEW-----LWLYGDDDWMDVNGG- 399
                         + L  QLF  R L  + L  S +       L LYG+ DWM  N G 
Sbjct: 316 -----------ATAINLFTQLFTTRLLARDPLMDSAHSLSCNGILLLYGEYDWMAKNAGK 364

Query: 400 --IRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFN 435
             +   K  N+    K+  + VP +GH+L+LDN  FFN
Sbjct: 365 SLLTNCKADNKGSASKTKYLEVPKSGHNLFLDNPAFFN 402

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 99/355 (27%), Positives = 144/355 (40%), Gaps = 88/355 (24%)

Query: 138 TELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP----------- 186
           T L   + IHGY A    + +N+    L  +   +++IDLP  G SS P           
Sbjct: 117 TVLTPTLLIHGYAASSMSYFRNYPG--LSKHIRDLYSIDLPASGLSSIPSLEINATTPLP 174

Query: 187 ---------KFPFEYPRDNLHD------VQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSL 231
                    KF   Y  +  H        +D++  R+  W     + NK  K  ++ HS 
Sbjct: 175 LDIKFIGKNKFKIPYTINANHHKFVIQMFEDFYLDRIEQW----RIDNKLGKMNIVGHSF 230

Query: 232 GSYLMALYVQKYKERPSFKKLILCSPAGVSH---------RDSNNTTSEAEKWKPPPWWY 282
           G+YL   Y  KY    S +KL L SP GV           R ++  T + E   P   +Y
Sbjct: 231 GAYLSFKYAVKYPN--SVEKLCLVSPLGVERNIWSVNNNFRSNSPYTIDFEN--PSSKFY 286

Query: 283 VKLWDRNISP-------FTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRY 335
            K   RNI P       F ++R     G+K+   W+Y     IL                
Sbjct: 287 SK---RNIIPRYLFQQQFQILRMMGPLGAKLC--WNY-----ILA--------------- 321

Query: 336 AYSIFNKRGSGEYLLSFALKCGGEPRLPLE--EQLFN------DRNLNILRSSNY-EWLW 386
           AYS        EY+       GG P +  E  E LF+      D  ++ L S N  + L 
Sbjct: 322 AYSRVPSLAYKEYIFELFYGKGGIPAVTTEIFEGLFSRSILARDPLMDSLNSLNVRKLLV 381

Query: 387 LYGDDDWMDVNGGIRVSKFLNE--KLRQKSNVIIVPHAGHHLYLDNSKFFNDILV 439
           +YG  DWM+ N G+ + K LN      +K+    +P +GH+L+LDN + FN  +V
Sbjct: 382 VYGQYDWMNKNAGMLMVKELNNLGDHFEKATYTEIPFSGHNLFLDNPESFNQSIV 436

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 87/348 (25%), Positives = 137/348 (39%), Gaps = 74/348 (21%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKF--------------- 188
           + IHGY A    F + F++  L +N   ++AIDLP  G S  P                 
Sbjct: 74  VLIHGYAASSMAFYRTFKN--LSDNIKDLYAIDLPANGASEAPALQVEGVKKIKSLRFKH 131

Query: 189 --------------PFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSY 234
                         P E  + +L   + +F  R+  W    NL     K  V+ HS G Y
Sbjct: 132 VEDDMVTPVLDKRPPAEEIKSHLEQYESYFVDRIEQWRKDNNL----RKINVVGHSFGGY 187

Query: 235 LMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFT 294
           +   Y  KY    S  KL L SP GV     N+  +   KW+    + V   D +   +T
Sbjct: 188 ISFKYALKYPN--SIDKLCLISPLGVE----NSIHAINHKWEANTTYPVTFTDPSSRYYT 241

Query: 295 LVRNSRQF---------------GSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSI 339
              N  QF               GSK+ S +    +  + +    Q  +   LH +    
Sbjct: 242 RKLNVPQFIFENQLNVLKWMGPIGSKLCSSYISTAYVKVPD----QLYKDYLLHSFV--- 294

Query: 340 FNKRGSGEYLLSFALKCGG---EPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDV 396
               G  + +    +K      E  L   + + N  N+ +L  + +  +++YG+ DWMD 
Sbjct: 295 ----GKNQSVQPQTIKVFTQLFERNLIARDPIIN--NVGLLNPATHV-MFMYGEHDWMDK 347

Query: 397 NGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRK 444
             G   ++ +  K + K++ + VP AGH+L+LDN   F   LV  + K
Sbjct: 348 YAGYLTTESM-LKNKAKASYMEVPDAGHNLFLDNPNHFTSSLVSFLSK 394

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/334 (25%), Positives = 135/334 (40%), Gaps = 74/334 (22%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKF--------------- 188
           + IHGY A    F + FE   L NN   ++AIDLP  G S  P                 
Sbjct: 74  VLIHGYAASSMAFYRTFES--LSNNIKDLYAIDLPANGASEAPVLQVDKTKKVKSLRFKH 131

Query: 189 --------------PFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSY 234
                         P E  + +L   +++F  R+  W  K N L K +   V+ HS G Y
Sbjct: 132 IEDDVVIPVLDRRPPAEDIKSHLEQYENYFVDRIEQW-RKDNKLRKIN---VVGHSFGGY 187

Query: 235 LMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFT 294
           +   Y  KY    S  KL L SP GV     N+  +   KW+P   + +   D +   +T
Sbjct: 188 ISFKYALKYPN--SIDKLCLISPLGV----ENSIHAITHKWEPNTTYPLTFTDPSSRYYT 241

Query: 295 LVRNSRQF---------------GSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSI 339
              N  +F               GSK+ S +    +  + +    Q  +   LH +    
Sbjct: 242 RKLNVPRFIFENQLNVLKWMGPIGSKLCSNYISTAYVKVPD----QIYKDYLLHSFV--- 294

Query: 340 FNKRGSGEYLLSFALKCGG---EPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDV 396
               G  + +    +K      E  L   + + N  N+ +L  + +  +++YG+ DWMD 
Sbjct: 295 ----GKNQTVQPQTIKVFTHLFERNLIARDPIIN--NVGLLNPTMHV-MFMYGEHDWMDK 347

Query: 397 NGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDN 430
             G   ++ +  K + K++ I VP AGH+L+LDN
Sbjct: 348 YAGYLTTESM-LKNKAKASYIEVPDAGHNLFLDN 380

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 87/362 (24%), Positives = 146/362 (40%), Gaps = 92/362 (25%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFP-------------- 189
           + +HGY      + +NF  +     +  +++IDLP +G S  P+ P              
Sbjct: 65  LLVHGYATSSLAYYRNFAGLSSYIKD--LYSIDLPTFGLSKTPELPTRKVTKNLKVTLSN 122

Query: 190 -------------FEYPRDNLHDVQDWFHK--------------RLHTWFNKRNLLNKPD 222
                        F+  +D++   + ++++              R+  W     + NK D
Sbjct: 123 SNDKSDDPKKITSFQLSKDDIKHNEKYYNETKKELEINENYYIDRIEKW----RIENKLD 178

Query: 223 KNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAG-------VSHRDSNNTTSEAEKW 275
           K  ++ HS G YL   Y  KY +  S +KL L SP G       ++++  N+   E E+ 
Sbjct: 179 KINLVGHSFGGYLSYKYATKYPD--SIEKLCLVSPLGMESNIYSINNKFENDKIYEIEEE 236

Query: 276 KPPPWWYVKLWDRNISPF------TLVRNSRQFGSKITSGW---SYRRFKHILNGDLKQS 326
            P   ++     R I  F       ++R     GS +T  +   SYRR    L  D    
Sbjct: 237 DPSSIFFTNT--RTIPKFLFNNQLNVLRWLGPVGSTLTWKYIKASYRRVDDALYKD---- 290

Query: 327 SRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLW 386
                   Y + +   +G  E             +L  ++ + +   ++ L++ N   L 
Sbjct: 291 --------YIHELIYGKGGMEETTIKTFTNLFTTKLLAKDPITD--TVDKLKAKNV--LL 338

Query: 387 LYGDDDWMDVNGGIRVSKFLNE-KLRQKSNV--------IIVPHAGHHLYLDNSKFFNDI 437
           LYG +DWM+   G +++K LNE K    S V        + VP AGH+L+LDN  FFN  
Sbjct: 339 LYGQEDWMNNYAGYQMTKKLNELKGYNTSKVGELNYATYMEVPEAGHNLFLDNPSFFNKA 398

Query: 438 LV 439
           L+
Sbjct: 399 LL 400

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 97/387 (25%), Positives = 149/387 (38%), Gaps = 92/387 (23%)

Query: 111 VIRTVVDDDGNYINEFCIRPIN------PSVPETELKHLIFIHGYGAGLGFFIKNFEDIP 164
           +I   VD  G   N+     IN      P+        L+ IHGY A    + +NF  + 
Sbjct: 78  LIMVNVDVAGTKDNQIVAHGINQWHFNNPAATAITTPTLL-IHGYAASSMAYYRNFTGLS 136

Query: 165 LLNNEWCVHAIDLPGYGFSSRPKFPF--EYPR-------DN-----------------LH 198
               +  ++AIDLP  G S+   F    + PR       DN                 + 
Sbjct: 137 QTVTD--LYAIDLPANGLSAEQPFKLNGDKPRSLKVKYLDNDKFSVQHVIDESGTKQMIQ 194

Query: 199 DVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPA 258
             + ++  ++  W      +NK +K  ++ HS G YL   Y  KY    S +KL L SP 
Sbjct: 195 QCESYYLDKIEEWRK----VNKLEKINLVGHSFGGYLSFKYALKYPN--SIEKLCLVSPL 248

Query: 259 GV-------SHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTLVRNSR------QFGSK 305
           GV       +++   NT    +   P   +Y +   R I  F     S         G+K
Sbjct: 249 GVETSIYSVNNKLEKNTKYALDLEDPTSNFYTR--RREIPKFIFKNQSEILRWMGPLGAK 306

Query: 306 ITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLE 365
           +   W+Y     IL+               AYS   +     Y+       GG    P  
Sbjct: 307 MC--WNY-----ILS---------------AYSRIPEMEYKSYIFELLYGKGGIA--PTA 342

Query: 366 EQLFND---RNL--------NILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNE-KLRQK 413
            Q+F +   RNL        ++ +    + L +YGD DWM+   G ++ + LN  +    
Sbjct: 343 RQIFTNLFTRNLLAKDPIMDSLGQLQAKKVLLVYGDHDWMNKYAGYKLVERLNTIRNNTS 402

Query: 414 SNVIIVPHAGHHLYLDNSKFFNDILVK 440
           +  I VP +GH+L+LDN  FFN  L +
Sbjct: 403 AQYIEVPESGHNLFLDNPTFFNASLTE 429

>YDR125C Chr4 complement(701397..702758) [1362 bp, 453 aa] {ON}
           ECM18Protein of unknown function, similar to Rlp24p
          Length = 453

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 98/374 (26%), Positives = 154/374 (41%), Gaps = 87/374 (23%)

Query: 117 DDDGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAID 176
           D   N IN++  +  N S   T     + IHGY A    F +N+    L  +   +++ID
Sbjct: 106 DKLFNEINQWHFQNENTSTVRTPT---LLIHGYAASSMSFFRNYPG--LSKHIRNLYSID 160

Query: 177 LPGYGFSSRP--------------------KFPFEYPRDNLHD------VQDWFHKRLHT 210
           +P  G SS P                    KF   Y  +  H+       +D++  R+  
Sbjct: 161 MPASGLSSVPSLEINTTTPLPLDIKFIGENKFKVPYTINANHNKFVIQMYEDFYLDRIEQ 220

Query: 211 WFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGV-------SHR 263
           W     + NK  K  V+ HS G YL   Y  KY    S  KL L SP GV       ++ 
Sbjct: 221 W----RIDNKLGKMNVVGHSFGGYLSFKYAVKYPN--SVNKLCLVSPLGVERNIWSVNNN 274

Query: 264 DSNNTTSEAEKWKPPPWWYVKLWDRNISP-------FTLVRNSRQFGSKITSGWSYRRFK 316
             +NT    +   P   +Y K   RN+ P       F ++R     G+K+   W+Y    
Sbjct: 275 FHSNTLYTIDFKNPNSKFYSK---RNMIPKYLFEQQFHILRMMGPLGAKLC--WNY---- 325

Query: 317 HILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLE--EQLFN---- 370
                 +   SR  +L   AY         EY+       GG P +  +  + LF+    
Sbjct: 326 -----IMAAYSRVPSL---AYK--------EYIFELFYGKGGIPEVTTDIFKALFSRCIL 369

Query: 371 --DRNLNILRSSNYE-WLWLYGDDDWMDVNGGIRVSKFLN--EKLRQKSNVIIVPHAGHH 425
             D  ++ L+  N +  L +YG  DWM+   G+ + K LN  +   + ++ + +P +GH+
Sbjct: 370 AKDPLMDSLQYLNVKKLLIVYGQYDWMNKKAGMFMVKELNNLKNCLEGASYLEIPSSGHN 429

Query: 426 LYLDNSKFFNDILV 439
           L+LDN + FN  +V
Sbjct: 430 LFLDNPESFNQSIV 443

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 93/391 (23%), Positives = 154/391 (39%), Gaps = 96/391 (24%)

Query: 112 IRTVVDDDGNYINEFCIRPINP---SVPETELKHL--IFIHGYGAGLGFFIKNFEDIPLL 166
           I   V+ +G   N+  +  IN      PE  L     + IHGY A    + + F  +   
Sbjct: 66  IMDTVEINGTKKNDLILNEINQWHFHNPEASLVDTPTLLIHGYAASSLAYFRTFSGLS-- 123

Query: 167 NNEWCVHAIDLPGYGFSSRPKFPFE---------YPRDN-------------------LH 198
           +    ++AIDLP +G S+ P   F+            DN                   + 
Sbjct: 124 DKIKNLYAIDLPSFGLSNAPPLDFKEKVSDIKIKLSDDNTKFKISDSNRVDSLDLKKLIG 183

Query: 199 DVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPA 258
             +D++ +++  W       NK +K  ++ HS G Y+   Y  KY +  +  +L L SP 
Sbjct: 184 KYEDYYVEKIEDWRKA----NKLEKINLVGHSFGGYISFKYAIKYPD--AINRLCLVSPL 237

Query: 259 GVS---HRDSNNTTSEAEK----WKPPPWWYVKLWDRNISPF------TLVRNSRQFGSK 305
           G+    H  +NN  ++ E       P   +Y K  +R I  F       ++R     GSK
Sbjct: 238 GMESNIHSVNNNFETKKEYPLDLEDPSSRFYAK--ERRIPNFLFKNQLNVLRWMGPIGSK 295

Query: 306 ITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLE 365
           +   +    ++ + N   K                      EYL       GG P + ++
Sbjct: 296 LCWNYINASYRRVPNPLFK----------------------EYLFELLYGKGGMPSVTID 333

Query: 366 --EQLFNDRNL-------NILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNV 416
               LF    L       +I +    + L LYG+ DWM+   G  + + LN+ L+  +N+
Sbjct: 334 IFTNLFTRSLLARDPIMDSISKLKAEKVLLLYGEHDWMNNLAGYNMVESLNQ-LKPNNNI 392

Query: 417 --------IIVPHAGHHLYLDNSKFFNDILV 439
                   + VP AGH+L+LDN +FFN  ++
Sbjct: 393 STIDYANYVEVPDAGHNLFLDNPQFFNSAVL 423

>SAKL0H16500g Chr8 (1450828..1452087) [1260 bp, 419 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 419

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 89/396 (22%), Positives = 158/396 (39%), Gaps = 81/396 (20%)

Query: 102 NPSKLKKSRVIRTVVDD---DGNYINEFCIRPINP----SVPETELKHLIFIHGYGAGLG 154
           N +K K S++ + ++++    G   NE  +  IN     +   +     + +HGY A   
Sbjct: 51  NNTKDKLSQLQKQIMEEVKVPGTMENELLMGEINQWHFYNASASIKTPTLLLHGYAAASM 110

Query: 155 FFIKNFEDIPLLNNEWCVHAIDLPGYGFS---------------------SRPKFPFEYP 193
            F +NF    L +    ++AIDLP  G S                     S  +F   Y 
Sbjct: 111 GFHRNFAG--LSSRIQNLYAIDLPANGLSPGSSQPLVVSCGEPLPMKAEFSNDRFKIPYT 168

Query: 194 RDNLHD------VQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERP 247
            + LH       ++D++   +  W     + NK +K  ++AHS G YL   Y  KY    
Sbjct: 169 LEYLHQKSFIQQLEDYYLNSIEQW----RIDNKLNKINIVAHSFGGYLSTKYAIKYPH-- 222

Query: 248 SFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWD----------RNI------S 291
           + ++L L SP GV      N  S    W    W+ +   D          R I      S
Sbjct: 223 AVERLCLVSPLGVER----NIHSVNNHWCSNTWYDLNYEDPGSKYYMRRMRGIPSTVFQS 278

Query: 292 PFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIF-NKRGSGEYLL 350
              L+R     G+K+   +    +  + N   K+         Y + +F  K G  +  +
Sbjct: 279 QVKLLRLLGPLGAKLCWNYINAAYSRVKNEKYKE---------YVFELFYGKEGVTQTAM 329

Query: 351 SFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKL 410
                      L  +  + + ++L++ R      +  YG+ DWM+   G+ ++K  N  L
Sbjct: 330 DIFTNLFTRQLLAKDPLMDSLQHLHVGR-----LMLAYGEHDWMNKYAGVLMTKEFNH-L 383

Query: 411 RQKSNV---IIVPHAGHHLYLDNSKFFNDILVKEMR 443
           R KS+     ++  +GH+++LDN   FN+ ++  ++
Sbjct: 384 RGKSDAATYTVISSSGHNMFLDNPDEFNEKVINFLK 419

>Smik_4.371 Chr4 complement(662692..663999) [1308 bp, 435 aa] {ON}
           YDR125C (REAL)
          Length = 435

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 91/353 (25%), Positives = 140/353 (39%), Gaps = 84/353 (23%)

Query: 138 TELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP----------- 186
           T L   + IHGY A    F +N+    L  +   +++IDLP  G SS P           
Sbjct: 106 TVLTPTLLIHGYAASSMSFFRNYPG--LSKHIQNLYSIDLPASGLSSIPPLEINATTPLP 163

Query: 187 ---------KFPFEYPRDNLHD------VQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSL 231
                    KF   Y  +  H        +D++  ++  W     + NK  K  ++ HS 
Sbjct: 164 LDIEFTGKNKFKIPYTINLNHHKFVIQMYEDFYLDKIEQW----RIDNKLGKVNIVGHSF 219

Query: 232 GSYLMALYVQKYKERPSFKKLILCSPAGV-------SHRDSNNTTSEAEKWKPPPWWYVK 284
           G YL   Y  KY    S +KL L SP GV       ++   +NT        P   +Y K
Sbjct: 220 GGYLSFKYAAKYPN--SVEKLCLVSPLGVERNIWSINNNFRSNTLYTIGFEDPSSKFYSK 277

Query: 285 LWDRNISP-------FTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAY 337
              RN+ P       F L+R     G+K+   W+Y                       AY
Sbjct: 278 ---RNMIPKYLFERQFQLLRMMGPVGAKLC--WNYIM--------------------AAY 312

Query: 338 SIFNKRGSGEYLLSFALKCGGEPRLPLE--EQLFNDRNLN---ILRSSNY----EWLWLY 388
           S        EY+       GG P +  E  + LF+   L    ++ S +Y    + + +Y
Sbjct: 313 SRVPSLAYKEYIFELFYGKGGIPEVTTEIFKGLFSRCILAKDPLMDSLHYLNVRKLMVVY 372

Query: 389 GDDDWMDVNGGIRVSKFLNE--KLRQKSNVIIVPHAGHHLYLDNSKFFNDILV 439
           G  DWM+   G+ + + LN      +K++ + +P +GH+L+LDN   FN  +V
Sbjct: 373 GQYDWMNKKAGMLMVENLNSLGNCLEKASYLEIPSSGHNLFLDNPLSFNQSIV 425

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 88/380 (23%), Positives = 162/380 (42%), Gaps = 69/380 (18%)

Query: 108 KSRVIRTVVDDDGNYINEFCIRPINP---SVPETELKH-LIFIHGYGAGLGFFIKNFEDI 163
           +++++  VV + G+  N   +  IN      P+ E++   + +HGY A    F +NF  +
Sbjct: 61  QAKIMSDVVVE-GSADNRLLMGEINQWHFHNPKGEIRTPTLLVHGYAASSMGFHRNFPGL 119

Query: 164 PLLNNEWCVHAIDLPGYGFS-------------------SRPKFPFEYPRDNLH------ 198
                +  ++AIDLP  G S                   S+  F   Y  + LH      
Sbjct: 120 SQSIKD--LYAIDLPASGLSPALPLEMRCTQPLDLKINMSKDTFSLPYTINYLHHKSLIQ 177

Query: 199 DVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPA 258
           + +D++   +  W +     NK     ++AHS G YL   Y  K+    + +KL L SP 
Sbjct: 178 NYEDYYLDAIEQWRHD----NKLGPINIVAHSFGGYLSFKYAVKFPH--AVEKLCLVSPL 231

Query: 259 GV-------SHRDSNNTTSEAEKWKPPPWWYVK--------LWDRNISPFTLVRNSRQFG 303
           GV       +++  +NT+   +   P   +Y+K        ++++      L+RN    G
Sbjct: 232 GVERNIFSVNNQWRSNTSYNLDFENPASKFYIKKGPAIPRLVFEQQTQ---LLRNLGPLG 288

Query: 304 SKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLP 363
           +K++  +    +  + + D K+   FE L  Y  +  N+     ++  F  +      L 
Sbjct: 289 AKLSWNYINAAYSRVPSLDYKKYV-FELL--YGKNGLNQTSKDLFIGLFNNRVLARDPLL 345

Query: 364 LEEQLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVPHAG 423
              Q F           + + + +YGD DWM+   G+ +    N+ L  ++    V  +G
Sbjct: 346 DSIQFF---------GKSAKLMCIYGDHDWMNRRAGMEMVNEANQ-LGIEAKYNEVSSSG 395

Query: 424 HHLYLDNSKFFNDILVKEMR 443
           H+L+LDN + FND LV+ ++
Sbjct: 396 HNLFLDNPEEFNDKLVRFLK 415

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 85/351 (24%), Positives = 140/351 (39%), Gaps = 80/351 (22%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP----------------- 186
           + +HGY      F + F   PL      ++AID P  G S  P                 
Sbjct: 107 LLLHGYATSSIAFFRTFG--PLSKQIRDLYAIDFPANGLSKAPPLNVNHLKKHTPYKVKF 164

Query: 187 -----KFPFEYPRD------NLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYL 235
                KF   +  D       +   ++++   +  W     L NK +K  ++ HS G Y 
Sbjct: 165 KDDNTKFQISHTVDVQLQKETIEHYENYYLDAVRKW----QLTNKIEKFNLVGHSFGGYF 220

Query: 236 MALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFTL 295
              Y  +Y +  S  KL L SP GV      N  S    ++    + ++L D        
Sbjct: 221 AYKYALRYPD--SVDKLCLVSPLGVER----NIYSVNNNFEDKKVYNLELEDPT------ 268

Query: 296 VRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALH-----RYAYSIFNKRGSGEYL- 349
              S+ +G       +++  K +  G      +F  L       Y  S + +  S E+  
Sbjct: 269 ---SKYYGR------TFQIPKCLFEGQFDILRKFGPLGPRFTWNYINSSYRRVPSMEFKE 319

Query: 350 LSFALKCGGEPRLPLEEQLFND---RNL----------NILRSSNYEWLWLYGDDDWMDV 396
             F L  G     P+  ++F++   RNL          + L++SN   + +YG +DWM+ 
Sbjct: 320 YIFELLYGNRKTSPILTEVFSNIVSRNLLARDPILDSIDELKASNV--MLMYGQEDWMNS 377

Query: 397 NGGIRVSKFLNEKLRQKSNV---IIVPHAGHHLYLDNSKFFNDILVKEMRK 444
             G  + K LNE +R+  N    + VP+AGH+L+LDN  FF   L + +++
Sbjct: 378 QAGYLMVKELNE-IRENPNAASYVEVPNAGHNLFLDNPDFFCSSLTRFLKE 427

>NDAI0J01210 Chr10 (282384..283634) [1251 bp, 416 aa] {ON} Anc_8.284
          Length = 416

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 86/353 (24%), Positives = 137/353 (38%), Gaps = 96/353 (27%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFS-------------------- 183
           + +HGY A    F + F   PL NN   ++AIDLP  G S                    
Sbjct: 98  LLLHGYAASSMSFYRTFA--PLSNNFKNLYAIDLPANGLSVAIPLKITKQRKRLYEVKYK 155

Query: 184 SRPKFPFEYP------RDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMA 237
              KF   YP      +  +   ++++   + +W     + N  +K  ++ HS G Y   
Sbjct: 156 ENNKFSISYPVPIEEQKPLIEQYENYYLDAMRSW----QVANNIEKFNLVGHSFGGYFSF 211

Query: 238 LYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPF---- 293
            Y  ++ +  S  KL L SP G+     +N  S   K++    + V L D   SPF    
Sbjct: 212 KYALRFPD--SINKLCLVSPLGME----SNIFSIHNKFEENKIYNVNLTDPT-SPFYGKK 264

Query: 294 ------------TLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFN 341
                        ++R    FG+++   +    +K + + + K                 
Sbjct: 265 FQIPNYLFENQLDVIRKLGPFGARLCWNYILSAYKRVPSMEYK----------------- 307

Query: 342 KRGSGEYLLSFALKCGGEPRLPLEEQLFND---RNL----------NILRSSNYEWLWLY 388
                EYL  F L  G     P+  +LF +   RNL          + L+ SN   L +Y
Sbjct: 308 -----EYL--FELFYGNRQVSPILCELFTNLLTRNLLARDPILDSIDQLQLSNV--LVMY 358

Query: 389 GDDDWMDVNGGIRVSKFLNEKLR--QKSNVIIVPHAGHHLYLDNSKFFNDILV 439
           G+ DWM+   G  +   LN   R    +  + VP AGH+L+LDN ++F+  L 
Sbjct: 359 GEHDWMNRYAGYCMVSRLNNIRRTPNTAQYLQVPAAGHNLFLDNPEYFSSALA 411

>KLTH0G13178g Chr7 (1131579..1132826) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 415

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 92/377 (24%), Positives = 149/377 (39%), Gaps = 79/377 (20%)

Query: 116 VDDDGNYINEFCIRPINPSVPETELKHL----IFIHGYGAGLGFFIKNFEDIPLLNNEWC 171
           V  DG+  N   +  +N    +  L  +    + +HGY A    F +NFE +     +  
Sbjct: 68  VKVDGSMENTLMMGEVNQFHFQNSLAEIKTPTLLLHGYAASSMAFHRNFEGLSKCIRD-- 125

Query: 172 VHAIDLPGYGFS-------------------SRPKFPFEYPRDNLH------DVQDWFHK 206
           ++AIDLP  G S                   S   F   Y  ++LH      + +D++  
Sbjct: 126 LYAIDLPANGLSPPQPLEIRCTEPQPLKIEISNDTFKLPYTINSLHHKSAIQNFEDYYLD 185

Query: 207 RLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSHR--D 264
            L  W     L NK     ++AHS G Y+   Y  KY    + K+L L SP GV      
Sbjct: 186 ALEQW----RLDNKLGPINIVAHSFGGYISFRYAVKYPH--AVKRLCLLSPLGVERNIFS 239

Query: 265 SNNTTSEAEKWK-----PPPWWYVKLWDRNISPFT------LVRNSRQFGSKITSGWSYR 313
            NN      ++K     P   +Y++     I P        ++R     G+++   W+Y 
Sbjct: 240 VNNNWRSNTQYKLDFENPASKFYIR-KGPAIPPAIFELQTKVLRGLGPLGARLC--WNYI 296

Query: 314 RFKHILNGDLK-QSSRFE------ALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEE 366
              +     LK +   FE      AL + +  IF    +   L           R PL +
Sbjct: 297 TAAYARVPSLKYKQYIFEMFYGKNALTQTSKDIFTGLFTNRLL----------ARDPLLD 346

Query: 367 QLFNDRNLNILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVIIVPHAGHHL 426
            L + R+  +        L +YGD DWM+   G+ +     +KL   +    V  +GH+L
Sbjct: 347 SLCHVRSKKL--------LLMYGDHDWMNRKAGLEMVT-EAKKLGIDAQYGEVSSSGHNL 397

Query: 427 YLDNSKFFNDILVKEMR 443
           +LDN +  N+++V  +R
Sbjct: 398 FLDNPEESNELIVSFLR 414

>KNAG0G02140 Chr7 complement(484440..485666) [1227 bp, 408 aa] {ON} 
          Length = 408

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 84/352 (23%), Positives = 130/352 (36%), Gaps = 80/352 (22%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPR--------- 194
           + IHGY A    F  N   +    ++ CV  +DLP  G S  P  P   P+         
Sbjct: 84  VLIHGYAASSMAFHLNVAGLSNAFSDLCV--VDLPANGLSREP--PMLGPKVKGQPVHWK 139

Query: 195 -------------------------DNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAH 229
                                    D+    +D+F  R+  W     L +  D   V+ H
Sbjct: 140 ELDKKTGSLTVVCEPPSKMSSSGVLDDPGVYEDYFVDRIEKW----RLAHGFDNINVVGH 195

Query: 230 SLGSYLMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRN 289
           S G Y+   Y  KY +     KL+L SP GV      N  S + KW     + +   D  
Sbjct: 196 SFGGYMSFKYAIKYSKH--VDKLVLLSPLGVER----NIDSVSNKWDVGKTYDLTDIDAT 249

Query: 290 ----ISPFTL-----------VRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHR 334
                 PFT+           +R     G+ +       R+ ++            A H 
Sbjct: 250 SPLYYRPFTVPGYLFNNQLNVLRKMGPLGNHMAKRAIASRYSNVPG---------TAYHA 300

Query: 335 YAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNL-NILRSSNYEWLWLYGDDDW 393
           Y + +F     G +    A        L   + L  D  L NI R    + + +YGD DW
Sbjct: 301 YLHHVF----YGAHTFPSA-NITAFTHLFTRQLLARDPLLDNIQRLKVNKLMMVYGDHDW 355

Query: 394 MDVNGGIRVSKFLNEK--LRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMR 443
           M+   G  + + +N++  +  K+    +P AGH+L+LDN   FN +L+  +R
Sbjct: 356 MNKEAGYGMVQEINKERYVPAKAVYAELPSAGHNLFLDNPSGFNKLLIDFLR 407

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 85/339 (25%), Positives = 132/339 (38%), Gaps = 83/339 (24%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWC-VHAIDLPGYGFSSRPKFPFEYPR------DN 196
           + IHGY A    F   F  IP LN +   ++ IDLPG G S  P    E  +      +N
Sbjct: 110 VLIHGYAATSTAF---FRSIPYLNRDIKDLYTIDLPGNGLSFTPSLDLEVSKPLPLKIEN 166

Query: 197 LHD---------------------VQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYL 235
           + D                     + D++  R+  W     L NK  K  V+AHS G YL
Sbjct: 167 IDDGNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQW----RLDNKLGKINVVAHSYGGYL 222

Query: 236 MALYVQKYKERPSFKKLILCSPAGVS------HRDSNNTTSEAEKWKPPPWWYVK----- 284
              Y  KY    +   L L SP GV       + + ++ T    +W      +       
Sbjct: 223 SFNYALKYP--ANINTLGLISPLGVERNIYSINNEFHSRTIYKREWNDCNSMFYDRKFKL 280

Query: 285 ---LWDRNISPFTLVRNSRQFGSKITSGWSYRR--FKHILNGDLKQSSRFEALHRYAYSI 339
              L+ + + P   +R     G+K+   W+Y R  +  + + D K          Y +  
Sbjct: 281 NDYLFQKQLKP---LRWLGPIGAKLC--WNYIRSAYARVPSIDYKD---------YTFET 326

Query: 340 FNKRGS----GEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDDWMD 395
           F  RG        + +  L      R PL + +     L + +      + +YG  DWM+
Sbjct: 327 FYGRGGLPEQTSQIFTSLLTSSLLARDPLLDHV---SQLQVPK-----LIMMYGQYDWMN 378

Query: 396 VNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFF 434
            NGG    K + +    ++  I +P+AGH+L+LDN   F
Sbjct: 379 KNGG----KLMTQIFNGETKYIDIPNAGHNLFLDNPSDF 413

>NCAS0B05120 Chr2 complement(953798..954988) [1191 bp, 396 aa] {ON} 
          Length = 396

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 85/361 (23%), Positives = 141/361 (39%), Gaps = 78/361 (21%)

Query: 132 NPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP----- 186
           NP+  + ++   + IHGY A    + +      L  N   V+ IDLP    SS P     
Sbjct: 59  NPAAAKVDVP-TVLIHGYAASSMAYYRTLA--TLSKNVKDVYVIDLPANSLSSVPPHSDI 115

Query: 187 --------------------KFPFEYPRDNLHDVQ----------DWFHKRLHTWFNKRN 216
                               K+ F+    + +D Q          +++   +  W   R 
Sbjct: 116 SHLKINKIKVVQVSKDKENEKYVFKVAPPHAYDAQREKQVIDKLENYYLDVIEKW---RR 172

Query: 217 LLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSH--RDSNNTTSEAEK 274
                DK  ++ HS G YL   Y  KY E     KL L SP GV+   R  NN     ++
Sbjct: 173 ANYGLDKFNLVGHSFGGYLSFKYAIKYPE--VVDKLCLVSPLGVASNIRSVNNVFDTKKE 230

Query: 275 W-----KPPPWWYVKLWDRNISPFTLVRNSRQF-------GSKITSGWSYRRFKHILNGD 322
           +      P    Y +   + + P  L  N           GSK+T  +    +  +   D
Sbjct: 231 YVMDLQNPGSMLYNR---QRMIPNFLFNNQLNVLKWMGPVGSKLTRKYINSAYVKVPTMD 287

Query: 323 LKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNY 382
            K          Y Y  F + G  +  +    K      +  +  +    N+N L+S+  
Sbjct: 288 YKD---------YLYEYF-QMGVPQVNVDIFTKLFSRNLMARDPIM---DNMNRLKST-- 332

Query: 383 EWLWLYGDDDWMDVNGGIRVSKFLNE---KLRQKSNVIIVPHAGHHLYLDNSKFFNDILV 439
            ++ +YGD+DWMD   G  + + +N+      +K+  + +P AGH+L+LDN + F++ L+
Sbjct: 333 RFMMMYGDNDWMDKFSGYTLVQNINKIKNNFDRKATYVEIPDAGHNLFLDNPEDFSNNLI 392

Query: 440 K 440
           K
Sbjct: 393 K 393

>Ecym_4285 Chr4 (612053..613270) [1218 bp, 405 aa] {ON} similar to
           Ashbya gossypii AGR062C
          Length = 405

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 83/353 (23%), Positives = 130/353 (36%), Gaps = 86/353 (24%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVH--AIDLPGYGFSS----------------- 184
           + +HGY      + +N   +    +E   H   IDLP  G S                  
Sbjct: 87  LLLHGYATSSMCYHRNMPQL----SEGIKHLYTIDLPANGLSKELPLELDIAKPIVFKPE 142

Query: 185 ----RPKFPFEYPRDNLH------DVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSY 234
               + +F   Y  D LH       ++D++   +  W  K +L        ++ HS G Y
Sbjct: 143 FNSVKSEFHIPYTIDGLHHRCAIQKLEDYYIDSIELWRRKNSL----GAINLVGHSFGGY 198

Query: 235 LMALYVQKYKERPSFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYVKLWDRNISPFT 294
           +   Y  KY +  + KKL L SP GV      N  S    W+    + +   D +   F 
Sbjct: 199 ISFKYSIKYPQ--NVKKLCLISPIGVE----RNIYSVHNNWRSNCPYSIDYEDPSSKHFA 252

Query: 295 ---------------LVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSI 339
                          L+R     G+K+  GW Y      +N    +   F  L      I
Sbjct: 253 NKTMIPEFVFNEQTKLLRLMGPLGAKL--GWKY------INAVYSKVPNFLYLEFIFTLI 304

Query: 340 FNK-------RGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLWLYGDDD 392
           + K       R    YL + +L    +P L   E L  D+            L LYG+ D
Sbjct: 305 YGKNVMTDTSRNIFTYLFTNSL-LARDPMLDSLEHLHVDK-----------LLMLYGEHD 352

Query: 393 WMDVN-GGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMRK 444
           W+    G + V +F  ++      + +VP A H+L+LDN  FFN  L+  +++
Sbjct: 353 WVRSQPGKMMVEEFNKQRSHPSGTLTVVPDASHNLFLDNPVFFNVALLNFLKE 405

>KAFR0B02830 Chr2 complement(578530..579705) [1176 bp, 391 aa] {ON}
           Anc_8.284 YDR125C
          Length = 391

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 84/364 (23%), Positives = 140/364 (38%), Gaps = 74/364 (20%)

Query: 121 NYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGY 180
           N INE+     N S  +T     + IHGY A    F + F    L  +   ++AIDLPG 
Sbjct: 52  NEINEWHFHNPNASKIKTPT---LLIHGYAASSMAFHRTFN--RLSTDIKDLYAIDLPGN 106

Query: 181 GFSSRPKFP--------------------------FEYPRDNLHDVQDWFHKRLHTW--F 212
           G SS P+                             E  + NL   ++++  R+  W  F
Sbjct: 107 GLSSAPELSDVIKMKDLKITLNKSKDGFTLKKAIDLEIEKANLAKYENYYLSRIDEWRKF 166

Query: 213 NKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVS---HRDSNNTT 269
           +    LN      V+ HS G ++   Y   +  + +   LIL SP G+    H  +NN  
Sbjct: 167 HGIEKLN------VIGHSFGGFISFKYAITHPNQVN--DLILVSPLGMEKNIHSLNNNFE 218

Query: 270 SEAEKW----KPPPWWYVKLWDRNISPFTLVRNSRQ-------FGSKITSGWSYRRFKHI 318
            E +       P   +Y + ++    P  L  N           G ++   +    +K +
Sbjct: 219 LETKYTLDFENPASLYYARSFN---VPSILFNNQLNILRWMGPLGGRMARQYIDMAYKKV 275

Query: 319 LNGDLKQSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILR 378
            +          A   Y Y +F    S   +            L   + + +    N+L+
Sbjct: 276 PD---------VAYKNYLYYVFYDGKSFPKVTINNFTNMFSKNLLARDPIMD----NLLK 322

Query: 379 SSNYEWLWLYGDDDWMDVNGGIRVSKFL---NEKLRQKSNVIIVPHAGHHLYLDNSKFFN 435
               + + +YG+ DWMD   G  + + L   N KL+   + + +P AGH+L+LDN   F+
Sbjct: 323 LRAKKVMLVYGEHDWMDKYAGYNMVELLSKSNYKLKDTVHYVEIPDAGHNLFLDNPTDFS 382

Query: 436 DILV 439
           + +V
Sbjct: 383 ENVV 386

>ZYRO0D06666g Chr4 (576172..577314) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04623 Saccharomyces cerevisiae YDR125C
          Length = 380

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 86/346 (24%), Positives = 133/346 (38%), Gaps = 80/346 (23%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSR------------------ 185
           + IHGY A    + + F+   L +    ++ IDLP  G S                    
Sbjct: 62  LLIHGYAASSMAYYRTFQG--LTDKISDLYTIDLPSNGLSKELPLILDGQTPPPLKVEIH 119

Query: 186 ---PKFPF------EYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLM 236
               KF        E+ R  +   +D++   +  W  K N + + +   ++ HS G Y+ 
Sbjct: 120 KDGSKFKIIERVDAEHCRSVVKQYEDYYLDSIELW-RKHNGIGRFN---LVGHSFGGYIA 175

Query: 237 ALYVQKYKERPSFKKLILCSPAGVSHR--DSNN-----TTSEAEKWKPPPWWYVKLWDRN 289
             Y  KY +  + ++L L SP GV       NN     T  E E   P    Y K W+  
Sbjct: 176 FKYAVKYPK--AVEQLGLISPLGVESNIYSVNNDWKLDTVYEMESTDPASRMYGKNWEIP 233

Query: 290 ISPFT----LVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNKRGS 345
              F     L+R     G+K+   W+Y             ++ +  L    Y        
Sbjct: 234 KVLFERQTELLRWMGPIGAKLC--WNY------------ITAAYNKLPTMEYK------- 272

Query: 346 GEYLLSFALKCGGEPR--------LPLEEQLFNDRNLNIL-RSSNYEWLWLYGDDDWMDV 396
            +Y+       GG P+        L     L  D  ++ + +    + L LYGD DWM+ 
Sbjct: 273 -DYVFELLYGNGGIPKTARKVFGGLFTRSLLARDPIMDSMDKLGARKVLLLYGDSDWMNN 331

Query: 397 NGGIRVSKFLNEKLRQKSNVII--VPHAGHHLYLDNSKFFNDILVK 440
             G R+ + LN+K R K       VP A H+L+LDN   FND L++
Sbjct: 332 YAGYRMVELLNQK-RGKGYATYDEVPDARHNLFLDNPDSFNDKLIQ 376

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 85/359 (23%), Positives = 139/359 (38%), Gaps = 86/359 (23%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP-----------KFPFEY 192
           + +HGYGA    + + F   PL  +   ++AIDLP  G S  P           KF  E 
Sbjct: 48  LLVHGYGASSMAYHRCF--APLSRHIRDLYAIDLPANGLSEAPPLVAEGEAPKAKFKIEE 105

Query: 193 --------------------------------PRDNLHDVQDWFHKRLHTWFNKRNLLNK 220
                                            R  L   +D++ + +  W  + NL   
Sbjct: 106 NKFTVVQGARRAAEPVTDAQVDQELMLRTHREKRRYLQQYEDYYVESIEQWRKENNL--- 162

Query: 221 PDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVS---HRDSN----NTTSEAE 273
            DK  ++ HS G YL   Y  KY E  S  KL L SP G+    H  +N    N   E +
Sbjct: 163 -DKFNLVGHSFGGYLSYKYALKYPE--SVNKLCLLSPLGMERNIHSINNTFEENVVYELQ 219

Query: 274 KWKPPPWWYVKLWDRNISP-------FTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQS 326
           +  P  + Y +   +  +P       F+++R     G K+   +    +  + +   K  
Sbjct: 220 ESDPSSYLYTR---KRKAPKFLFENQFSVLRWMGPIGDKLCLSFINSSYAKVPSQAYK-D 275

Query: 327 SRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEEQLFNDRNLNILRSSNYEWLW 386
             FE+     +       + ++L + +L      R P+ + +     L +   S +    
Sbjct: 276 YLFESFLGKKHFAKQNVHALKHLFTRSLLA----RDPIMDTI---DKLKVPDVSVF---- 324

Query: 387 LYGDDDWMDVNGGI----RVSKF-LNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVK 440
            YGD DWM+   G     R+ KF +       ++ + VP AGH+L+LDN  +F+  LV+
Sbjct: 325 -YGDHDWMNSYAGYLMVERLKKFRVASTSGGSASYLEVPDAGHNLFLDNPDYFSKKLVQ 382

>KNAG0H03120 Chr8 (586146..587450) [1305 bp, 434 aa] {ON} Anc_8.284
           YDR125C
          Length = 434

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 84/365 (23%), Positives = 141/365 (38%), Gaps = 89/365 (24%)

Query: 132 NPSVPETELKH---LIFIHGYGAGLGFFIKNFEDIPLLNNEWC--VHAIDLPGYGFS--- 183
           NPS+  +E      ++ IHGY +    + +NF  +    +  C  V+AIDLP  G S   
Sbjct: 97  NPSLVGSEAAVKPPVLLIHGYASSSMSYFRNFRGL----SSQCKDVYAIDLPANGLSREI 152

Query: 184 ----------------------SRPKFPFEYPRDN------LHDVQDWFHKRLHTWFNKR 215
                                 S  +     P +N      L  ++D++   +  W    
Sbjct: 153 SLSEDADLKDLVKYSLQVKGLDSPGQVKVTKPYNNKLCATQLRILEDYYVDEIERW---- 208

Query: 216 NLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGV--------SHRDSNN 267
            + N+ D+  ++ HS G Y+   Y  KY +  +  KL L SP GV        +H   ++
Sbjct: 209 RVENQIDQLHLVGHSFGGYISYKYALKYPQ--NVMKLALISPLGVERNLYSVNNHLPQDS 266

Query: 268 TTSEAEKWKPPPWWYVKL-WDRNI--SPFTLVRNSRQFGSKITSGWSYRRFKHILNGDLK 324
                 +    P +  KL   R I  +   ++R     G+++   W+Y            
Sbjct: 267 IVQGTFEDPSSPSYLRKLEVPRYIFENQLKILRWGGPMGARLC--WNYIT---------- 314

Query: 325 QSSRFEALHRYAYSIFNKRGSGEYLLSFALKCGGEPRLPLEE-QLFNDRNL--------N 375
                      AY+    R   EYL       GG  +  L    L   RNL        +
Sbjct: 315 ----------SAYAKVPSREFKEYLFELFYGDGGITKTALTTFILLFTRNLLARDPIMDS 364

Query: 376 ILRSSNYEWLWLYGDDDWMDVNGGIRVSKFLNEKLRQKSNVII-VPHAGHHLYLDNSKFF 434
           I      + ++ YG  DWM+ N G R ++ L ++    S + + +P +GH+L+LD+ + F
Sbjct: 365 IAELKVKDVMFQYGQYDWMNKNAGARAAELLRKQPYNNSALYLEIPESGHNLFLDSPQSF 424

Query: 435 NDILV 439
           N  L+
Sbjct: 425 NFSLI 429

>AGR062C Chr7 complement(833212..834366) [1155 bp, 384 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR099C
           (ICT1) and YDR125C (ECM18)
          Length = 384

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 1/58 (1%)

Query: 387 LYGDDDWMDVNGGIRVSKFLNE-KLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMR 443
           LYGD DWMD   G  +   LN  + R  +++ IVP AGH+L+LDN + F+  L+  +R
Sbjct: 326 LYGDHDWMDARAGRALVAELNALRGRPDASLAIVPAAGHNLFLDNPEDFHSWLLDFLR 383

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 69/160 (43%), Gaps = 37/160 (23%)

Query: 129 RPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFS----- 183
           R  NP+     +  L+ IHGY A    F +NFE + L   +  V+A+DLPG G S     
Sbjct: 76  RISNPTAKAVGVPTLM-IHGYAASSMTFFRNFEQLSLSLKD--VYAVDLPGNGLSKELPL 132

Query: 184 -----SRPK------------FPFEYPRD------NLHDVQDWFHKRLHTWFNKRNLLNK 220
                 +P             F  + P D      +L   +D++   L  W  K N L+K
Sbjct: 133 SVDSMQKPDRVEFNETVKGQYFRLQNPVDEEKYKKHLAHYEDYYVDALEKW-RKENKLSK 191

Query: 221 PDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGV 260
            +   ++ HS G YL   Y  KY +  +  KL L SP GV
Sbjct: 192 IN---LVGHSYGGYLTFKYSLKYPD--NVHKLCLVSPLGV 226

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 385 LWLYGDDDWMD-VNGGIRVSKFLNEKLRQKSNVIIVPHAGHHLYLDNSKFFNDILVKEMR 443
           + +YG+ DWM+ V G + + +F + +        IV  AGH+L LDN   FN  LV  +R
Sbjct: 349 MLVYGEHDWMNKVAGRLAIEEFNSIRKSYDGTFDIVSRAGHNLVLDNPSEFNSKLVDFLR 408

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 12/116 (10%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDN--LHDVQ 201
           IFIHG G  L  F+   +   L N  +   A+DLPG+G   + +F  EY   N  +  + 
Sbjct: 93  IFIHGLGGSLEQFLPLLKLTDLSNKSFI--AVDLPGFG---QSEFNDEYNIANYSMSSII 147

Query: 202 DWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSP 257
            +   ++ + +     L    K ++  HS+G YL   + Q+YK     +K++L +P
Sbjct: 148 GFLKSQVFSRY-----LTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAP 198

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 55/118 (46%), Gaps = 20/118 (16%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLN----NEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHD 199
           +FIHG    LG  ++ FE  PLL     NE    A+DLPG+G S       EY   N+ D
Sbjct: 93  LFIHG----LGGVLEQFE--PLLRLLDLNENKFLALDLPGFGKSD------EYEDYNMFD 140

Query: 200 VQDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSP 257
           V    H  +     +R   N     V++ HS+G Y+      K   R SFKKL+  SP
Sbjct: 141 VISIIHTIVDRLIPERTTSNI----VLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSP 194

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 83/202 (41%), Gaps = 25/202 (12%)

Query: 59  EIIYKVPGLFPRPVGDSVKDFRDFIKSEDVFQTELLKTLPFYPNPSKLKKSRVIRTVVDD 118
           E++ +   L    V   V D     K E V Q EL + +       +  K R    VV  
Sbjct: 2   EVLREACSLEGELVNGRVDDI--LAKYEQVPQRELSRVIDSRDFEVRFLKERT--RVVTL 57

Query: 119 DGNYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLP 178
           DG  I+  C   I     E      + IHG G  +  F    + + LL  ++ V A+DLP
Sbjct: 58  DG--IDMRCFDNIRDG--ERRDSVFLLIHGLGGSMDQFQPLMKLLTLL--KYRVIALDLP 111

Query: 179 GYG--FSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPDKNV-VMAHSLGSYL 235
           G+G   SS   +   Y    +  V D             N+ NK D +  V+ HS+G Y+
Sbjct: 112 GFGQSGSSTNGYDMLYVTSVVKKVVD------------NNIENKTDIDFKVVGHSMGCYI 159

Query: 236 MALYVQKYKERPSFKKLILCSP 257
            + +VQ Y E  +  KL+L  P
Sbjct: 160 ASHFVQMYHEEYNIDKLVLTCP 181

>NCAS0B03710 Chr2 (664097..665389) [1293 bp, 430 aa] {ON} Anc_8.284
          Length = 430

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 79/341 (23%), Positives = 126/341 (36%), Gaps = 90/341 (26%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKF----------PFEYP 193
           + +HGY A    F + F  +PL  +   ++A DLPG G S    F            +Y 
Sbjct: 112 LLLHGYAASSLCFFRTF--VPLSRSIKNLYATDLPGNGLSKNKSFFSVMYGNEYMKVKYE 169

Query: 194 RDNLHDV----------------QDWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMA 237
            +N   +                +D++   +  W    NL   P  N+V  HS G YL  
Sbjct: 170 ENNKFSIKYLNSLKDQTNSIKHSEDYYIDAIREWQLSNNL---PKINLV-GHSFGGYLSF 225

Query: 238 LYVQKYKERPSFKKLILCSPAGVSHR--DSNNTTSE-----AEKWKPPPWWYVKLWDRNI 290
            Y  +Y +  +  KL L SP GV       NN+  E      +   P   +Y     RN 
Sbjct: 226 KYALRYPD--NVNKLCLVSPLGVESNLYSVNNSLKENYLYDVDYSDPKSSYY----SRNF 279

Query: 291 S--------PFTLVRNSRQFGSKITSGWSYRRFKHILNGDLKQSSRFEALHRYAYSIFNK 342
           +         F ++R     G+++   +    +K + +   K                  
Sbjct: 280 AIPKSLFEGQFGILRWMGPIGARVCWNYILSSYKRVPSMKYK------------------ 321

Query: 343 RGSGEYLLSFALKCGGEPRLPLEEQLFND---RNL--------NILRSSNYEWLWLYGDD 391
               EYL  F L  G   +L    + F +   RNL        +I +    + + +YG  
Sbjct: 322 ----EYL--FHLLFGNAKKLVTSAKTFTNLFTRNLLAKDPIMDSIEKLQCEKLMVMYGQH 375

Query: 392 DWMDVNGG-IRVSKFLNEKLRQKSNVII-VPHAGHHLYLDN 430
           DWM+   G   ++K  N +  + +     +P AGH+L LDN
Sbjct: 376 DWMNKYAGYCLIAKLNNYRSTKDAGYFTEIPEAGHNLILDN 416

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 15/114 (13%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDW 203
           +FIHG G  L  F    + + LLN  +   ++DLPG+G S       E     + ++   
Sbjct: 133 VFIHGLGGTLAQFEPLLKLLSLLNKGF--FSMDLPGFGSSD------EVESYGMLEIVAI 184

Query: 204 FHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSP 257
             K        RNL       V++ HS+G YL   +   ++E+ SF++L+L +P
Sbjct: 185 VQKTFAKLTPSRNL-------VLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAP 231

>TBLA0H01400 Chr8 (312727..313992) [1266 bp, 421 aa] {ON} Anc_8.284
           YDR125C
          Length = 421

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 37/57 (64%), Gaps = 2/57 (3%)

Query: 385 LWLYGDDDWMDVNGGIRVSKFLN--EKLRQKSNVIIVPHAGHHLYLDNSKFFNDILV 439
           L  YG++DWM+   G  +++ LN  +   + +N I VP++GH+L LD+ KFF+  L+
Sbjct: 360 LLFYGENDWMNKEAGFLMAEKLNILKGDSKYANWIEVPNSGHNLILDDPKFFSKNLI 416

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 74/201 (36%), Gaps = 56/201 (27%)

Query: 121 NYINEFCIRPINPSVPETELKHLIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGY 180
           N IN++     N S  +T     + IHGY A    + K F    L  +   ++ IDLPG+
Sbjct: 34  NEINQWHFHNANASTIKTPT---VLIHGYAASSMAYYKTFR--YLTGSIKDLYTIDLPGF 88

Query: 181 GFSSRPKF-------------------------PFEYPRDNLHDVQ-------------- 201
           G S+ PK                           F   + NL  ++              
Sbjct: 89  GLSASPKIIINDHNRKKSQFDIKLIDSKDSNNNKFSISKKNLKLLENGNIEDKAFISAFD 148

Query: 202 DWFHKRLHTW--FNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAG 259
           D++  R+  W  FN    +N      V+ HS G Y+   Y  KY +  S + L L SP G
Sbjct: 149 DYYIDRIEKWRKFNNLGKIN------VIGHSFGGYISFKYAIKYPD--SIENLCLVSPFG 200

Query: 260 VSHR--DSNNTTSEAEKWKPP 278
           +       NN     EK+  P
Sbjct: 201 MESNVYSINNYDDWKEKFSNP 221

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 52/116 (44%), Gaps = 18/116 (15%)

Query: 143 LIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSR-PKFPFEYPRDNLHDVQ 201
            +FIHG G  L  F      +  ++  +   A+DLPG+G S    ++P     + + ++ 
Sbjct: 86  FLFIHGLGGELEQFEPLLRLVDAMDQRFL--ALDLPGFGKSDEWDEYPMLKVVETIEEIA 143

Query: 202 DWFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSP 257
             F+                 K V++ HS+G YL + + + Y +  S  +++L SP
Sbjct: 144 AKFNAA---------------KIVLVGHSMGCYLTSHFYEAYHKVHSINRIVLLSP 184

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 12/115 (10%)

Query: 143 LIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQD 202
            +FIHG G  L  F     ++   N  +   A DLPG+G S       +YP  ++    D
Sbjct: 81  FLFIHGLGGTLEQFEPVLRELDQRNKSFL--AFDLPGFGKSDEWD---QYPMLDVVKSID 135

Query: 203 WFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSP 257
           W   +L       NL  K +K  ++ HS+G YL   +   + E     +L+L +P
Sbjct: 136 WLIHQL-----TNNL--KFEKLNLIGHSMGCYLAVHFYLLFHESWCISRLVLLAP 183

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 49/115 (42%), Gaps = 8/115 (6%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSR-PKFPFEYPRDNLHDVQD 202
           +FIHG G  LG F        L   ++    +DLPG+G S     +  +   + +  V D
Sbjct: 85  LFIHGLGGSLGQFEPLLRLTHLKGKKFL--TLDLPGFGQSDELESYSMKSVIETIRSVVD 142

Query: 203 WFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSP 257
                L T   K    N   K ++  HS+G YL   + + Y +    +K+ L SP
Sbjct: 143 -----LATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSP 192

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 53/115 (46%), Gaps = 12/115 (10%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLN-NEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQD 202
           IFIHG G  L  F   F  + LL+ +E    AIDLPG+G S       +YP   +  V  
Sbjct: 86  IFIHGLGGSLDQF---FPLLKLLDLSEKYFVAIDLPGFGKSDEHT---DYP---MIQVVK 136

Query: 203 WFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSP 257
                +    N+  L    D   ++ HS+G YL   ++  + ++    K++L +P
Sbjct: 137 HIDAVISELLNEARL--AFDTVRLIGHSMGCYLTLHFMTLFSKKYRIGKVVLLAP 189

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 13/86 (15%)

Query: 174 AIDLPGYGFSSRPKFPFEYPRDNLHDVQDWFHKRLHTWFNKRNLLNKPD--KNVVMAHSL 231
           AIDLPG+G S       +Y   ++  +     + L T          PD  K  VM HS+
Sbjct: 112 AIDLPGFGKSE------DYSNYSMTHIATLIDQMLETVIG-----TAPDNYKINVMGHSM 160

Query: 232 GSYLMALYVQKYKERPSFKKLILCSP 257
           G++L   + + + ++ + +KLIL SP
Sbjct: 161 GTHLALHFYELFNKKYTVEKLILVSP 186

>KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {ON}
           similar to uniprot|P53750 Saccharomyces cerevisiae
           YNR064C
          Length = 294

 Score = 36.6 bits (83), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 64/161 (39%), Gaps = 29/161 (18%)

Query: 143 LIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQD 202
           ++ +HGY      F      IPL+++++ V A DLPG+GF+  P+  + Y  DNL     
Sbjct: 33  IVLLHGYPTSSTMFRHL---IPLISDKFHVIAPDLPGFGFTEVPE-DYHYSFDNLAATVR 88

Query: 203 WFHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGVSH 262
            F K +               NV           A+YV  Y     F +L L  P+ ++ 
Sbjct: 89  EFLKEI---------------NVTR--------FAIYVFDYGSPVGF-RLALKDPSSITG 124

Query: 263 RDSNNTTSEAEKWKPPPWWYV-KLWDRNISPFTLVRNSRQF 302
             + N  +  E      W ++ K W    +    V+   QF
Sbjct: 125 IVTQNGNAYEEALGDEFWGFIKKYWQTTQTDPVFVKPLSQF 165

>Skud_14.400 Chr14 complement(717609..718490) [882 bp, 293 aa] {ON}
           YNR064C (REAL)
          Length = 293

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 143 LIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQD 202
           ++ +HG+ +    F +N   IPLL +++ V A DLPG+GFS  P   + +  D L D   
Sbjct: 32  IVLLHGFPSSSNMF-RNL--IPLLASQFHVIAPDLPGFGFSETPD-DYTFSFDALSDTVG 87

Query: 203 WFHKRL 208
           +    L
Sbjct: 88  YLLDAL 93

>Suva_14.424 Chr14 complement(736902..737771) [870 bp, 289 aa] {ON}
           YNR064C (REAL)
          Length = 289

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 143 LIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP---KFPFEYPRDNL 197
           ++ +HG+      F +N   IPLL   + V A DLPG+GFS  P   KF F    D +
Sbjct: 32  IVLLHGFPTSSNMF-RNL--IPLLAGHFHVIAPDLPGFGFSETPDDYKFTFGALSDTI 86

>Kwal_27.10170 s27 complement(227197..228078) [882 bp, 293 aa] {ON}
           YNR064C - Hypothetical ORF [contig 41] FULL
          Length = 293

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 4/55 (7%)

Query: 143 LIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNL 197
           ++ +HGY      F +N   IPL+   + V A DLPG+GF++  + PF +  +NL
Sbjct: 33  ILLLHGYPTSSNMF-RNL--IPLIAASFHVVAPDLPGFGFTTMDE-PFSFSFENL 83

>TDEL0G00150 Chr7 complement(22315..23214) [900 bp, 299 aa] {ON} 
          Length = 299

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 4/67 (5%)

Query: 143 LIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQD 202
           ++ +HG+ +    F +N   IPLL   + V A D+PG+GF+  P+  +E+   NL +  +
Sbjct: 38  ILLLHGFPSSSNMF-RNL--IPLLAARFYVVAPDIPGFGFTEYPE-DYEFNFANLTNSIE 93

Query: 203 WFHKRLH 209
            F K L+
Sbjct: 94  QFLKALN 100

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 51/116 (43%), Gaps = 7/116 (6%)

Query: 144 IFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRPKFPFEYPRDNLHDVQDW 203
           +F+ G G  L  +      + +LN ++     DLPG+G S        Y   N+  V   
Sbjct: 98  VFLPGLGGSLDQYEPLLRLMDILNEKFI--GFDLPGFGGSEEDTSEGGY---NMIKVCHI 152

Query: 204 FHKRLHTWFNKRNLLNKPDKNVVMAHSLGSYLMALYVQKYKERPSFK--KLILCSP 257
            ++ L +   +        +  ++ HS+G YL+  +   ++ +  +K  +LIL SP
Sbjct: 153 INEALQSIITQNYSTRDTIELRLVGHSMGCYLVLHFFNSFQTKTEYKISQLILTSP 208

>Skud_13.99 Chr13 (170491..171426) [936 bp, 311 aa] {ON} YML050W
           (REAL)
          Length = 311

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 5/90 (5%)

Query: 350 LSFALKCGGEPRLPLEEQLFNDRNLNILRSSNY--EWLWLYGD---DDWMDVNGGIRVSK 404
           LSF     G+ ++P E Q  + +NL   +   +  +W  + G    D      G   ++ 
Sbjct: 173 LSFQDYLIGKAKVPQETQQVHHKNLTKFQGDIFLRDWSLVCGHYKRDAKCGEMGPDIIAA 232

Query: 405 FLNEKLRQKSNVIIVPHAGHHLYLDNSKFF 434
           F +EKL   +N+ ++ H G H++  N  F+
Sbjct: 233 FQDEKLLTDNNLGLISHVGGHVFAGNVIFY 262

>Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON}
           (14238..15287) [1050 nt, 350 aa]
          Length = 349

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 56/120 (46%), Gaps = 26/120 (21%)

Query: 144 IFIHGYGAGLGFFIKNFEDI-PLLN----NEWCVHAIDLPGYGFSSRPKFPFEYPRDNLH 198
           +FIHG G        NFE   PLL     ++     +DLPG+G S   +    Y   ++ 
Sbjct: 86  LFIHGLGG-------NFEQFEPLLRLVDASDKKFLTMDLPGFGKSDELE---SYGMFDII 135

Query: 199 DVQDWFHKRLHTWFNKRNLLNKPDKNV-VMAHSLGSYLMALYVQKYKERPSFKKLILCSP 257
           +V ++  K+            K  K++ V+ HS+G  L   +++K+ +  +  +L+L +P
Sbjct: 136 EVINYVAKKFI----------KDGKSINVIGHSMGCLLSIHFMEKFSKELNITQLVLLTP 185

>YNR064C Chr14 complement(749136..750008) [873 bp, 290 aa] {ON}
           Epoxide hydrolase, member of the alpha/beta hydrolase
           fold family; may have a role in detoxification of
           epoxides
          Length = 290

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 6/52 (11%)

Query: 143 LIFIHGYGAGLGFFIKNFEDIPLLNNEWCVHAIDLPGYGFSSRP---KFPFE 191
           ++ +HG+      F +N   IPLL  ++ + A DLPG+GF+  P   KF F+
Sbjct: 32  ILLLHGFPTSSNMF-RNL--IPLLAGQFHIIAPDLPGFGFTETPENYKFSFD 80

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 98  PFYPNPSKLKKSRVIRTVVDDDGNYINEFCIRPINPSVPETELKHLIFIH-GYGAGLGFF 156
           P++PN  K      +  V+D++   I+E  ++P N  V   + +H+  I  G   G G F
Sbjct: 15  PYFPNQMKENMKASVNEVIDEEQGSISELEVKPQNEMVRGLKSRHIQLIALGDAIGTGLF 74

Query: 157 IKN 159
           I +
Sbjct: 75  IGS 77

>SAKL0E06138g Chr5 complement(498976..501027) [2052 bp, 683 aa] {ON}
           similar to gnl|GLV|KLLA0E01694g Kluyveromyces lactis
           KLLA0E01694g and weakly similar to YMR163C
           uniprot|Q03824 Saccharomyces cerevisiae YMR163C Protein
           of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 683

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 3/79 (3%)

Query: 225 VVMAHSLGSYLMALYVQKYKERP-SFKKLILCSPAGVSHRDSNNTTSEAEKWKPPPWWYV 283
           V + HS+ +   A  VQ   ER  S KK ILC    ++H+ S  T       K  P +  
Sbjct: 338 VDLHHSMNNE--AREVQDKVERVHSIKKFILCCLLSINHKTSTATDMTNSLHKIFPGYEP 395

Query: 284 KLWDRNISPFTLVRNSRQF 302
           + W      F  +RN+ Q+
Sbjct: 396 RNWTNENDKFLTIRNNLQY 414

>TDEL0A07680 Chr1 (1336496..1337884) [1389 bp, 462 aa] {ON}
           Anc_6.353 YCR079W
          Length = 462

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 219 NKPDKNVVMAHSLGSYLMALYVQKYKERPSFKKLILCSPAGV 260
           N P    + A+S GS   ++++  Y+E+ SF +    SPAG+
Sbjct: 217 NLPFSKRIEAYSGGSTASSIFISSYEEQRSFDESFFVSPAGL 258

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,863,548
Number of extensions: 2717223
Number of successful extensions: 6236
Number of sequences better than 10.0: 80
Number of HSP's gapped: 6223
Number of HSP's successfully gapped: 106
Length of query: 445
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 332
Effective length of database: 40,524,141
Effective search space: 13454014812
Effective search space used: 13454014812
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)