Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_5.316.9ON42742722200.0
YEL056W (HAT2)6.9ON40140118570.0
Skud_5.336.9ON40140018200.0
Suva_5.126.9ON40140118150.0
NDAI0K029006.9ON43841112651e-172
NCAS0F001906.9ON41140612271e-167
ZYRO0F00462g6.9ON39340011731e-159
TDEL0G046206.9ON39240511721e-159
Kpol_1045.786.9ON39240511601e-157
KNAG0E009806.9ON41440011561e-156
Ecym_30126.9ON39739011261e-152
SAKL0E00814g6.9ON39839510921e-147
KLLA0D00814g6.9ON40840210801e-145
CAGL0B03575g6.9ON41939710811e-145
KAFR0L003206.9ON39140410711e-144
ACR017W6.9ON42339810631e-142
TPHA0M001906.9ON39140010561e-141
KLTH0C11550g6.9ON39838610331e-138
Kwal_56.223456.9ON3963869921e-132
TBLA0A071206.9ON4074259691e-128
TPHA0L017208.548ON4194373134e-31
KLTH0E12694g8.548ON4184093063e-30
TBLA0H036508.548ON4194163064e-30
KLLA0E23541g8.548ON4174073054e-30
Kpol_1024.398.548ON4174133021e-29
SAKL0H09900g8.548ON4254083002e-29
CAGL0M05291g8.548ON4194132984e-29
ZYRO0A13068g8.548ON3974062967e-29
Smik_2.3358.548ON4224362961e-28
TDEL0B029808.548ON4124132951e-28
YBR195C (MSI1)8.548ON4224372923e-28
Kwal_27.120708.548ON4184112906e-28
Skud_2.3218.548ON4224392889e-28
Suva_4.4498.548ON4244242872e-27
NDAI0C055108.548ON4194202862e-27
Ecym_70428.548ON4144142862e-27
KAFR0I008408.548ON4134252844e-27
KNAG0A036708.548ON4264222844e-27
AEL250C8.548ON4174132835e-27
NCAS0B021708.548ON4144172642e-24
Suva_13.3112.401ON5104101668e-12
KAFR0A003802.401ON5164051589e-11
CAGL0K03861g2.401ON5133951561e-10
YMR131C (RRB1)2.401ON5114051525e-10
TPHA0G026502.401ON5164051501e-09
Skud_13.2912.401ON5094011491e-09
Smik_13.3292.401ON5094041472e-09
TDEL0G033402.401ON5144051462e-09
Sklu_YGOB_Anc_2.4012.401ON5202861445e-09
ADR242C2.401ON5212531401e-08
NCAS0F019702.401ON5114031331e-07
KNAG0E021802.401ON5174031312e-07
KLLA0F17237g2.401ON5232381284e-07
TBLA0B092502.401ON5264011284e-07
Kwal_47.178272.401ON5234141284e-07
Kpol_1041.202.401ON5152531275e-07
NDAI0H027502.401ON5122511275e-07
ZYRO0A08690g2.401ON5164021267e-07
KLTH0E09394g2.401ON5224031241e-06
Ecym_60672.401ON5222391222e-06
KLLA0E08449g2.283ON4221991212e-06
KLLA0E19515g7.356ON5721551195e-06
Kpol_1060.246.276ON4861991161e-05
Suva_10.2927.356ON5801501161e-05
KNAG0B025807.356ON5801331142e-05
Smik_6.3488.672ON4511291133e-05
NCAS0G011206.276ON4941811123e-05
YLR196W (PWP1)7.356ON5761501124e-05
Suva_16.1598.672ON4511291114e-05
NCAS0B036908.288ON11451221125e-05
Skud_12.2617.356ON5801501115e-05
AEL269C7.534ON4551821106e-05
SAKL0F11506g7.356ON5681541107e-05
Kwal_56.236858.288ON11021191108e-05
KAFR0L015207.356ON5841551091e-04
KNAG0I010508.288ON11591231081e-04
AAR078W7.356ON5621571072e-04
Skud_4.637.310ON12732141072e-04
Skud_16.1318.672ON4511291062e-04
NDAI0J011808.288ON11341201072e-04
TDEL0A068906.276ON4472201052e-04
YPL151C (PRP46)8.672ON4511291053e-04
Smik_12.2567.356ON5761501053e-04
TBLA0C018408.672ON4231241043e-04
TBLA0E007607.534ON3841341043e-04
ZYRO0E08184g6.276ON5063451044e-04
TBLA0D040208.288ON11781311044e-04
TDEL0C019207.356ON5631501044e-04
SAKL0H06666g8.672ON4411251034e-04
KAFR0A033801.247ON6661711035e-04
KNAG0A032208.631ON4231531035e-04
YCR072C (RSA4)6.340ON5152801026e-04
CAGL0A04037g7.356ON5831501026e-04
KAFR0H033402.283ON3672041016e-04
YMR093W (UTP15)2.469ON5131951027e-04
SAKL0H16390g8.288ON11401191028e-04
Suva_16.606.276ON5262231018e-04
Smik_13.2772.469ON5131951018e-04
Skud_13.2492.469ON5132191019e-04
Suva_3.1096.340ON5152801000.001
KLTH0G13068g8.288ON11011231010.001
Ecym_47177.356ON6031571000.001
TPHA0G031002.469ON509185990.001
ZYRO0B02486g7.356ON575148990.001
ZYRO0D06556g8.288ON1147244990.002
KAFR0E012303.259ON369133980.002
NDAI0E044407.356ON581156990.002
ZYRO0F07282g8.672ON427124980.002
Ecym_33212.283ON409267980.002
Smik_4.457.310ON1270207990.002
Smik_3.1726.340ON515280980.002
KNAG0I028406.340ON519249980.002
KLTH0G10296g2.283ON426214970.002
TBLA0A038908.316ON362212960.002
Suva_13.2702.469ON513219970.003
CAGL0J03476g6.340ON517278960.003
Kpol_530.257.356ON574150960.003
KAFR0B055808.288ON1120130970.003
KLTH0D11132g8.672ON437125960.003
TBLA0C050107.356ON572150960.003
TBLA0F041306.340ON514296960.003
KLTH0H02508gna 1ON309152950.003
KAFR0A056104.309ON620127960.004
TPHA0G016108.672ON414125940.004
KNAG0J016808.672ON398129940.005
AER114W4.309ON633130940.005
TPHA0F030307.356ON582150940.005
ZYRO0D08206g6.340ON515266940.005
Kwal_56.246617.356ON561157940.005
Kwal_27.115502.283ON407158930.006
KLLA0F15598g5.201ON478200930.006
NDAI0G001501.534ON722136940.006
Kwal_33.151365.201ON473122930.006
Kwal_56.24399na 1ON369148930.007
AAL157C5.201ON47996930.007
CAGL0J01265g2.469ON517184930.007
CAGL0D05588g5.201ON477120930.007
Kpol_2002.995.201ON487120930.007
AEL314W1.247ON715172930.008
NCAS0E028407.356ON607147930.008
Skud_16.326.276ON522228930.008
KLLA0D02530g4.309ON707119930.009
Kpol_2001.657.322ON1206269930.009
NCAS0D027305.201ON475295920.009
KNAG0B064504.309ON634128920.009
Skud_12.5214.309ON645130920.010
Kwal_55.220673.25ON451173910.011
CAGL0H00781g6.276ON513171910.012
NDAI0F012406.276ON524176910.012
YPL247C6.276ON523181910.012
TDEL0G021402.283ON392139910.012
Skud_4.3898.288ON1151124910.013
Smik_4.3748.288ON1152124910.014
KLTH0A06754g6.340ON514280900.015
Kwal_26.87768.672ON433125900.015
Skud_3.1456.340ON515278900.015
YDL195W (SEC31)7.310ON1273207910.017
Smik_6.4516.276ON523181900.017
CAGL0M02277g8.672ON427125890.020
TBLA0G020904.309ON640126900.020
KLLA0F11231g8.672ON434125890.020
TPHA0B005904.309ON588130890.021
KAFR0F010606.276ON553183890.022
Ecym_42808.288ON1132126900.023
NDAI0G025808.324ON958141890.023
KLTH0B03410g5.201ON47797890.025
NDAI0I003506.340ON515269880.027
NCAS0C032608.324ON98383890.029
KLTH0C07634g3.259ON425214880.030
Suva_14.3112.283ON389129870.031
YLR429W (CRN1)4.309ON651130880.031
KLLA0D12760g6.276ON493141880.032
Suva_2.2918.288ON1151124880.033
AGR067W8.288ON1125129880.034
KNAG0F038707.534ON465236870.036
Ecym_24018.672ON426126870.039
YNL035C2.283ON389192870.040
TDEL0E042805.201ON481128870.040
SAKL0G12892g5.201ON476120870.042
KLTH0F19294g3.25ON451157860.043
TPHA0D035906.276ON598334870.043
CAGL0L02761g8.631ON419152860.045
SAKL0E07766g2.283ON398122860.046
TPHA0E030805.201ON488120860.047
Kpol_1019.307.310ON1252182870.047
KAFR0I028403.25ON456173860.050
Kpol_1002.946.143ON379124860.051
Kpol_1028.416.340ON512274860.053
KLLA0B01958g6.239ON890133860.053
KAFR0J009805.201ON48097860.057
Skud_14.2982.283ON389120850.067
Kwal_23.63246.340ON514252850.067
TDEL0A061808.672ON434184850.069
KLTH0H01122g7.356ON579160850.069
TBLA0D055601.247ON589185850.072
Kpol_1013.377.534ON468202850.074
Kwal_26.77382.470ON61137850.078
KAFR0H024508.672ON417181840.081
CAGL0K11836g3.259ON522132840.082
KLTH0D05368g2.470ON61039840.084
TDEL0D010904.309ON642172840.086
KLLA0E11331g3.344ON512147840.088
Ecym_70284.309ON625139840.091
TPHA0I032407.534ON477134840.091
Kpol_1061.63.259ON451126840.094
NDAI0I021805.201ON479120840.095
Skud_14.223.25ON467173840.099
Ecym_80727.322ON1201113840.10
ZYRO0B10450g5.201ON482263830.10
SAKL0A01276g6.340ON515222830.11
Kpol_1036.698.324ON936134840.11
ACR137W8.672ON425125830.11
YNL317W (PFS2)3.25ON465185830.12
TPHA0D045007.322ON1208269830.12
TPHA0C033702.283ON413170830.12
NCAS0C044503.25ON461127830.12
NDAI0E024008.672ON434126830.13
TBLA0H020005.201ON473120830.13
Kpol_1001.234.309ON610128830.13
Ecym_24986.340ON542270830.14
NDAI0J010408.316ON398189820.15
YDR128W (MTC5)8.288ON1148127830.16
Smik_12.5254.309ON652130820.16
Suva_10.645.201ON490122820.16
Suva_10.5454.309ON642130820.16
Kwal_26.87008.651ON381110810.16
KLLA0F19734g8.288ON1133126820.16
Smik_12.525.201ON489122810.18
NDAI0D047304.309ON66168820.18
Smik_16.4427.534ON47098810.19
Kpol_1048.598.544ON850152820.19
NCAS0C016808.672ON431124810.19
TBLA0B059202.283ON403152810.19
ZYRO0A01804g2.283ON376119810.20
NCAS0G043001.534ON725134810.20
SAKL0H07150g8.651ON441214810.21
Suva_14.223.25ON469185810.21
Ecym_71055.201ON484183810.22
ADL184W3.25ON449138810.22
TPHA0M018306.340ON515223810.22
CAGL0F06853g2.663ON388126800.22
KNAG0A012503.25ON452115810.23
Kpol_1003.342.283ON388120800.23
ZYRO0C03124g3.25ON445115800.24
NDAI0G038303.25ON510117800.25
Kpol_1072.178.672ON433131800.25
CAGL0M04081g3.25ON455172800.25
ADR077C7.322ON1204114810.25
TBLA0A023106.276ON531186800.26
Smik_14.143.25ON466185800.27
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_5.31
         (427 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   859   0.0  
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   719   0.0  
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   705   0.0  
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   703   0.0  
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     491   e-172
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   477   e-167
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   456   e-159
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   456   e-159
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   451   e-157
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   449   e-156
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   438   e-152
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   425   e-147
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   420   e-145
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   421   e-145
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   417   e-144
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   414   e-142
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   411   e-141
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   402   e-138
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   386   e-132
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   377   e-128
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   125   4e-31
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   122   3e-30
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   122   4e-30
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   122   4e-30
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   120   1e-29
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   120   2e-29
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   119   4e-29
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   118   7e-29
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   118   1e-28
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   118   1e-28
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   117   3e-28
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   116   6e-28
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   115   9e-28
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   115   2e-27
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   114   2e-27
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   114   2e-27
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   114   4e-27
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   114   4e-27
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   113   5e-27
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   106   2e-24
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    69   8e-12
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    65   9e-11
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    65   1e-10
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    63   5e-10
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    62   1e-09
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    62   1e-09
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    61   2e-09
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    61   2e-09
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    60   5e-09
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    59   1e-08
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    56   1e-07
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    55   2e-07
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    54   4e-07
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    54   4e-07
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    54   4e-07
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    54   5e-07
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    54   5e-07
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    53   7e-07
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    52   1e-06
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    52   2e-06
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    51   2e-06
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    50   5e-06
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    49   1e-05
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    49   1e-05
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    49   2e-05
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    48   3e-05
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    48   3e-05
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    48   4e-05
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    47   4e-05
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    48   5e-05
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    47   5e-05
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    47   6e-05
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    47   7e-05
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    47   8e-05
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    47   1e-04
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    46   1e-04
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    46   2e-04
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    46   2e-04
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    45   2e-04
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    46   2e-04
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    45   2e-04
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    45   3e-04
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    45   3e-04
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    45   3e-04
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               45   3e-04
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    45   4e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    45   4e-04
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    45   4e-04
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    44   4e-04
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    44   5e-04
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    44   5e-04
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    44   6e-04
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    44   6e-04
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    44   6e-04
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    44   7e-04
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    44   8e-04
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    44   8e-04
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    44   8e-04
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    44   9e-04
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    43   0.001
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    44   0.001
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    43   0.001
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    43   0.001
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    43   0.001
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    43   0.002
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    42   0.002
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    43   0.002
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    42   0.002
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    42   0.002
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    43   0.002
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    42   0.002
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    42   0.002
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    42   0.002
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    42   0.002
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    42   0.003
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    42   0.003
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    42   0.003
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    42   0.003
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    42   0.003
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    42   0.003
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    42   0.003
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    41   0.003
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    42   0.004
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    41   0.004
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    41   0.005
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    41   0.005
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    41   0.005
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    41   0.005
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    41   0.005
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    40   0.006
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    40   0.006
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    41   0.006
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    40   0.006
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    40   0.007
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    40   0.007
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    40   0.007
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    40   0.007
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    40   0.007
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    40   0.008
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    40   0.008
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    40   0.008
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    40   0.009
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    40   0.009
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     40   0.009
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    40   0.009
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    40   0.010
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    40   0.011
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    40   0.012
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    40   0.012
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    40   0.012
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    40   0.012
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    40   0.013
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    40   0.014
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    39   0.015
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    39   0.015
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    39   0.015
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    40   0.017
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    39   0.017
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    39   0.020
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    39   0.020
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    39   0.020
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    39   0.021
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    39   0.022
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    39   0.023
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    39   0.023
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    39   0.025
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       39   0.027
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    39   0.029
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    39   0.030
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    38   0.031
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    39   0.031
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    39   0.032
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.033
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    39   0.034
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    38   0.036
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    38   0.039
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    38   0.040
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    38   0.040
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    38   0.042
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    38   0.043
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    38   0.043
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    38   0.045
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    38   0.046
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    38   0.047
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    38   0.047
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    38   0.050
Kpol_1002.94 s1002 (240130..241269) [1140 bp, 379 aa] {ON} (2401...    38   0.051
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    38   0.053
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    38   0.053
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    38   0.057
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    37   0.067
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    37   0.067
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    37   0.069
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    37   0.069
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    37   0.072
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    37   0.074
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    37   0.078
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    37   0.081
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    37   0.082
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    37   0.084
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    37   0.086
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    37   0.088
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    37   0.091
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    37   0.091
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    37   0.094
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    37   0.095
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    37   0.099
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    37   0.10 
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    37   0.10 
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    37   0.11 
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    37   0.11 
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    37   0.11 
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    37   0.12 
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    37   0.12 
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    37   0.12 
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      37   0.12 
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     37   0.13 
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    37   0.13 
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    37   0.13 
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    37   0.14 
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    36   0.15 
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    37   0.16 
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    36   0.16 
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    36   0.16 
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    36   0.16 
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    36   0.16 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    36   0.16 
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    36   0.18 
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    36   0.18 
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    36   0.19 
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    36   0.19 
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     36   0.19 
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    36   0.19 
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    36   0.20 
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    36   0.20 
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    36   0.21 
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    36   0.21 
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    36   0.22 
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    36   0.22 
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    36   0.22 
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    35   0.22 
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    36   0.23 
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    35   0.23 
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    35   0.24 
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      35   0.25 
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    35   0.25 
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    35   0.25 
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    36   0.25 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    35   0.26 
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    35   0.27 
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    35   0.29 
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    35   0.30 
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    35   0.31 
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    35   0.32 
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    35   0.34 
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    35   0.35 
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    35   0.35 
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    35   0.36 
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    35   0.38 
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    35   0.39 
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    35   0.39 
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    35   0.39 
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    35   0.39 
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    35   0.40 
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    35   0.40 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    35   0.41 
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    35   0.42 
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    35   0.42 
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    35   0.42 
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    35   0.43 
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    35   0.44 
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    35   0.44 
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    35   0.45 
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    35   0.47 
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    35   0.47 
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    35   0.47 
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    35   0.47 
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    35   0.49 
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    35   0.49 
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    35   0.49 
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    35   0.51 
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    35   0.51 
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    35   0.52 
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    34   0.52 
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    35   0.54 
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    34   0.59 
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    35   0.59 
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    34   0.61 
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    34   0.61 
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    34   0.61 
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    34   0.61 
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     34   0.62 
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    34   0.63 
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    34   0.63 
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    34   0.64 
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    34   0.66 
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    34   0.67 
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    34   0.67 
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    34   0.69 
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    34   0.69 
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    34   0.69 
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    34   0.70 
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    34   0.71 
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    34   0.76 
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    34   0.78 
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    34   0.80 
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    34   0.81 
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    34   0.81 
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    34   0.84 
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    34   0.85 
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    33   0.91 
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    33   0.94 
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    34   0.95 
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    33   0.96 
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    34   0.96 
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    34   0.97 
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    34   0.97 
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    34   0.97 
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               33   0.99 
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    33   1.0  
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    33   1.0  
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    33   1.0  
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    33   1.1  
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    33   1.1  
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    34   1.1  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    33   1.1  
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    33   1.1  
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    33   1.1  
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    33   1.1  
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    33   1.1  
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    33   1.2  
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    33   1.2  
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    33   1.2  
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    33   1.2  
TPHA0N01190 Chr14 (253021..256467) [3447 bp, 1148 aa] {ON} Anc_6...    33   1.3  
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    33   1.3  
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    33   1.4  
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    33   1.4  
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    33   1.4  
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    33   1.4  
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    33   1.5  
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    33   1.5  
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    33   1.5  
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    33   1.5  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    33   1.5  
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    33   1.5  
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    33   1.6  
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    33   1.6  
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    33   1.6  
ZYRO0F03256g Chr6 (274828..276807) [1980 bp, 659 aa] {ON} simila...    33   1.6  
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    33   1.7  
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    33   1.7  
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    33   1.7  
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    33   1.8  
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    33   1.8  
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    33   1.8  
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    33   1.9  
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     33   1.9  
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    33   1.9  
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               33   1.9  
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             33   1.9  
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    32   2.0  
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    33   2.0  
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    33   2.0  
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    32   2.0  
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    33   2.0  
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    33   2.0  
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    33   2.1  
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    33   2.1  
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    33   2.1  
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    32   2.1  
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    33   2.2  
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    33   2.2  
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    32   2.3  
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    33   2.3  
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     32   2.3  
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    32   2.4  
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    32   2.4  
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    32   2.4  
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    32   2.4  
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    32   2.5  
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    32   2.5  
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     32   2.6  
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    32   2.7  
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    32   2.7  
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    32   2.8  
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    32   2.8  
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    32   3.0  
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    32   3.0  
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    32   3.1  
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    32   3.1  
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    32   3.1  
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    32   3.1  
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    32   3.1  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    32   3.1  
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    32   3.1  
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    32   3.2  
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    32   3.2  
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    32   3.2  
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    32   3.3  
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    32   3.3  
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    32   3.3  
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    32   3.4  
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    32   3.4  
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    32   3.5  
KLTH0F16830g Chr6 complement(1361983..1364532) [2550 bp, 849 aa]...    32   3.5  
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    32   3.6  
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    32   3.7  
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    32   3.7  
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               32   3.7  
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    32   3.8  
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    32   3.8  
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    32   3.9  
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    32   4.0  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    32   4.0  
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    32   4.0  
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    32   4.1  
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    32   4.2  
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    32   4.2  
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    32   4.3  
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    32   4.3  
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    32   4.3  
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    32   4.5  
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    32   4.5  
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    32   4.5  
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    32   4.5  
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    32   4.5  
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    32   4.5  
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    32   4.6  
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    32   4.6  
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    32   4.7  
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    31   4.7  
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    31   4.8  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    32   4.8  
YOR229W Chr15 (768409..769812) [1404 bp, 467 aa] {ON}  WTM2Trans...    32   4.9  
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    32   4.9  
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    32   4.9  
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    32   4.9  
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    31   5.0  
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    31   5.0  
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    31   5.2  
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    31   5.2  
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    31   5.2  
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    31   5.3  
SAKL0G07040g Chr7 (577213..578250) [1038 bp, 345 aa] {ON} simila...    31   5.4  
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    31   5.4  
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    31   5.4  
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    31   5.5  
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    31   5.6  
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    31   5.7  
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    31   5.8  
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    31   5.9  
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    31   5.9  
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    31   6.0  
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    31   6.0  
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    31   6.1  
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    31   6.2  
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    31   6.2  
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    31   6.2  
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    31   6.3  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    31   6.4  
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    31   6.5  
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    31   6.8  
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    31   6.8  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    31   6.9  
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    31   7.1  
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    31   7.4  
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    31   7.4  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    31   8.1  
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    31   8.4  
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    31   8.5  
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    30   8.6  
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    30   8.8  
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    31   8.8  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    31   9.5  
ACR162C Chr3 complement(637642..640224) [2583 bp, 860 aa] {ON} S...    30   9.8  

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/427 (97%), Positives = 416/427 (97%)

Query: 1   MSQARTFLLSIVLKLTVSTTANNRAAMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLT 60
           MSQARTFLLSIVLKLTVSTTANNRAAMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLT
Sbjct: 1   MSQARTFLLSIVLKLTVSTTANNRAAMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLT 60

Query: 61  WPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEA 120
           WPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEA
Sbjct: 61  WPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEA 120

Query: 121 EEDDKATLNAPKSNIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQS 180
           EEDDKATLNAPKSNIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQS
Sbjct: 121 EEDDKATLNAPKSNIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQS 180

Query: 181 TLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDI 240
           TLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDI
Sbjct: 181 TLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDI 240

Query: 241 KWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDS 300
           KWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDS
Sbjct: 241 KWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDS 300

Query: 301 HVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTP 360
           HVYLYDLRNMREPLHHMSGHEDAVTNIEFSTH           NRLIMWDLKQIGAEQTP
Sbjct: 301 HVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTP 360

Query: 361 DDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPK 420
           DDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPK
Sbjct: 361 DDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPK 420

Query: 421 VNKDIIS 427
           VNKDIIS
Sbjct: 421 VNKDIIS 427

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/401 (85%), Positives = 368/401 (91%)

Query: 27  METQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI 86
           ME QEK LSVDEEYDLWKSNVPLMYDFVSETRLTWPSL+VQWLPTP+QE +GGFI+QELI
Sbjct: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60

Query: 87  IGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEE 146
           IGTHTSGEEENYLKFAEIN+PKEIL+N+DPQEEA E+ +++L AP+SNIRITAKY HEEE
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120

Query: 147 ITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGS 206
           ITRARYMPQ+P+ VAT+NGQGTVFLYSRS GLQSTLKFHKDNGYALSF+ LV+G+LLSGS
Sbjct: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180

Query: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266
           DDHTVALWEVGS      PVRTWNDLHSDI+ND KWHNFN+ LFGTVSEDSLLKINDVRA
Sbjct: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240

Query: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326
           +N TID VKCPQPFNTLAFSHHSSNLLAAAGMDS+VYLYDLRNM+EPLHHMSGHEDAV N
Sbjct: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300

Query: 327 IEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386
           +EFSTH           NRL+MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL
Sbjct: 301 LEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360

Query: 387 NAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDIIS 427
           N QIPWLVAS+EEENILQVWKCSH+LPIVGGPPKVNKDIIS
Sbjct: 361 NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDIIS 401

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/400 (82%), Positives = 364/400 (91%)

Query: 27  METQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI 86
           ME QEK LSVDEEYDLWKSNVPLMYDFVSETRLTWPSL+VQWLPTP+Q+ +GGFI+QELI
Sbjct: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI 60

Query: 87  IGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEE 146
           IGTHTSGEEENYLKFAEIN+PKE+LNN++PQE+AE  D+A+L  P+SNIRITAKY HEEE
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120

Query: 147 ITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGS 206
           ITRARYMPQ+P+ VAT+NGQGTVFLYSRS GLQSTLKFHKDNGYALSF+ L++G LLSGS
Sbjct: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180

Query: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266
           DDH+VALW+V   S S +P+RTW+DLHSDIVND KWHNFN+ LFGTVSEDSLLKIND+RA
Sbjct: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240

Query: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326
            N TID  KCPQPFNTLAFSHHSSN+LAAAGMDSHVYLYDLRNM+EPLHHMSGHEDAVTN
Sbjct: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 327 IEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386
           +EFS H           NRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRS+VNDFDL
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360

Query: 387 NAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426
           NAQ+PWL+AS+EEENILQVWKCSH+LPIVGG PK+NKDI+
Sbjct: 361 NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/401 (82%), Positives = 361/401 (90%)

Query: 27  METQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI 86
           METQEK LSVDEEYDLWKSNVPLMYDFVSETRLTWPSL+VQWLPTP+QE EGGFI+QELI
Sbjct: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60

Query: 87  IGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEE 146
           IGTHTSGEEENYLKFAEIN+PKEILNN+DPQEEA EDD+ +  AP+SNI+ITAKY HEEE
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120

Query: 147 ITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGS 206
           ITRARYMPQNP  VAT+NGQGTVF+YSRS GLQSTLKFH++NGYALSF+ LVEG LLSGS
Sbjct: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGS 180

Query: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266
           DDHTVALW+V  NS S  P+RTW+DLHSDIVND KWHNFN+ LFGTVSEDSLLKIND+R 
Sbjct: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240

Query: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326
            N T    KCP+PFNTLAFSHHSSNLLAAAG DSHVYLYDLRNM+EPLHHMSGHEDAVTN
Sbjct: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 327 IEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386
           +EFS H           NRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGH+S+VNDFDL
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360

Query: 387 NAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDIIS 427
           NAQIPWLVAS+EEENILQVWKCSH+LP+VGGPPKV+ D+IS
Sbjct: 361 NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMIS 401

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  491 bits (1265), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 239/411 (58%), Positives = 306/411 (74%), Gaps = 20/411 (4%)

Query: 30  QEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLP-----TPIQEAEGGFIRQE 84
           + K L++DEEYDLWKSNVPLMYDFVSET+LTWP+L+V+WLP     TP+        RQE
Sbjct: 33  ENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSN------RQE 86

Query: 85  LIIGTHTSGEEENYLKFAEINIPKEIL----NNQDPQEEAEEDDKATLNAPKSNIRITAK 140
           LI+GTHTSGEE+NYLK A I++P E++    N+   Q E +ED+      P+SNI+I  K
Sbjct: 87  LILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKK 146

Query: 141 YVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRS----GGLQSTLKFHKDNGYALSFNA 196
           + HEEEITRAR+MPQN D +AT+NG GTVF+Y++S      L STL+FHK+NGY LSFN 
Sbjct: 147 FKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNP 206

Query: 197 LVEGQLLSGSDDHTVALWEVGSNST-SISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSE 255
             +G+LLSGSDD T+ALW++  NST +  P++ W+ +H+DIVND KW+ FN  +F +VSE
Sbjct: 207 NDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSE 266

Query: 256 DSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLH 315
           DS L+++D R  N  I+++K   PFNTLAFS HS  L+AAAG DS VYLYD RN+  PL+
Sbjct: 267 DSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLY 326

Query: 316 HMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHA 375
            M+GHED++TN+EFS H            R+IMWD+  IGAEQ PDDAEDG PE+IM+HA
Sbjct: 327 SMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHA 386

Query: 376 GHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426
           GHRS+VNDF +N  IPWL+AS+EEENI+QVWKCSH LPIVGG P+V+  I+
Sbjct: 387 GHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSIL 437

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  477 bits (1227), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 236/406 (58%), Positives = 292/406 (71%), Gaps = 16/406 (3%)

Query: 25  AAMETQE----KALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGF 80
           AA++ +E    K LS+DEEY+LW+SNVPLMYDFVSETRLTWPSLS++WLP   +++    
Sbjct: 9   AAVQGEEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQ--EKSAQAP 66

Query: 81  IRQELIIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAK 140
            RQELIIGTHTSGEE+NYLK A I++P +I+    P  E  ED +      KSNI+I  K
Sbjct: 67  NRQELIIGTHTSGEEDNYLKIAAIDLPNDII----PSTEKLEDQQKGETTTKSNIKIIKK 122

Query: 141 YVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRS----GGLQSTLKFHKDNGYALSFNA 196
           + HEEEITRARYMPQN + VAT+NG G VFLY RS     GL ST ++HK+NGY LSFN 
Sbjct: 123 FKHEEEITRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNC 182

Query: 197 LVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSED 256
              G+LLSGSDD T+ALW V  N+++ SP+  W+ +HSDIVND KW NF+  +FG+VSED
Sbjct: 183 NDAGKLLSGSDDGTIALWNV--NNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSED 240

Query: 257 SLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHH 316
           S L+++D R  +      K   PFNTLAFS HS  L AAAG DSHVYL+D R++  PLH 
Sbjct: 241 STLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHS 300

Query: 317 MSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAG 376
           M+GH+ AVTN+EFS              R I+WD+  IG EQ PDDAEDG PE++M+HAG
Sbjct: 301 MAGHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAG 360

Query: 377 HRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVN 422
           HRS++NDF +N  IPWL+ASSEEENI+QVWKCSH LP VGG P V+
Sbjct: 361 HRSAINDFSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVS 406

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  456 bits (1173), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 219/400 (54%), Positives = 285/400 (71%), Gaps = 19/400 (4%)

Query: 31  EKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTH 90
           EK LS+DEEYDLWKSNVPLMYDFVSET LTWPSL+++WLP           RQE+I+GTH
Sbjct: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLP-----GSRSSNRQEMILGTH 62

Query: 91  TSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRA 150
           TS EE+NYLK A I +P E++ + +P+EE E          KSN++I  K+ HE E+TRA
Sbjct: 63  TSDEEQNYLKIAAIYLPDEVVPDAEPKEEEE--------VLKSNVKIIKKFEHENEVTRA 114

Query: 151 RYMPQNPDFVATLNGQGTVFLYSRS----GGLQSTLKFHKDNGYALSFNALVEGQLLSGS 206
           RYMPQ+ + +AT++G GT++LY+R+     GL ST +FH +NGY LSFN   +G+LLSGS
Sbjct: 115 RYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGS 174

Query: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266
           DD  + LW+V   S    P+ T+ D HSDIVND KWHNF++ +FG+VSEDS L+++D R 
Sbjct: 175 DDSNIVLWDVTGKSQE--PILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI 232

Query: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326
            +  ++ V+  +P+NTLAFS HS+NL AAAG DS VYLYD R   +PLH M GHEDAVT+
Sbjct: 233 RDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTS 292

Query: 327 IEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386
           +EF               R I+WDL +IGAEQ PDDA+DG PE++M+HAGHRSS+NDF +
Sbjct: 293 LEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSM 352

Query: 387 NAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426
           N  IPWL A++EEENI+QVWK S  LP +GG P V+  ++
Sbjct: 353 NPNIPWLTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLL 392

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  456 bits (1172), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 228/405 (56%), Positives = 281/405 (69%), Gaps = 19/405 (4%)

Query: 26  AMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQEL 85
           A E  +K LS+DEEY+LW+SNVPLMYDFVSET LTWP+L+++WLP           RQEL
Sbjct: 2   AEEQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHSN-----RQEL 56

Query: 86  IIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEE 145
           I+GTHTS EE NYLK A I++P EI+    P +E  E D  T    KSNI+I  K+ HE+
Sbjct: 57  ILGTHTSEEEPNYLKIAAIDLPDEIV----PGKEDRERDGFT----KSNIKIIKKFKHEQ 108

Query: 146 EITRARYMPQNPDFVATLNGQGTVFLYSRSG----GLQSTLKFHKDNGYALSFNALVEGQ 201
           E+TRARYMPQ+ + +AT+NG GTVFLY RS     GL S+L FH+DNGY LSFN + +G+
Sbjct: 109 EVTRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGK 168

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
           LLSGSDD  +ALW++ +NST   PV TW   H D VND KWH  N   FG+VSED  L++
Sbjct: 169 LLSGSDDSKIALWDITTNSTK--PVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQL 226

Query: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321
           +D R  +   D +K    FNT+AFS HS+NL AAAG DS +YLYD R     LH MSGHE
Sbjct: 227 HDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHE 286

Query: 322 DAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSV 381
             VTN+EF               R+IMWDL +IGAEQ PDDA+DG PE++M+HAGHRS V
Sbjct: 287 SNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPV 346

Query: 382 NDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426
           NDF +N  IPWL+AS+EEENI+QVWKCS  LP VGG PKV+  ++
Sbjct: 347 NDFSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVL 391

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  451 bits (1160), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/405 (53%), Positives = 295/405 (72%), Gaps = 20/405 (4%)

Query: 26  AMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQEL 85
           A   QE+ L+VD+EY+LWK+NVPLMYDFVSETRLTWPSL+ QWLP   ++      RQ +
Sbjct: 3   AQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDT-----RQYM 57

Query: 86  IIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEE 145
           I+GTHTSGEE +YLK A +++P E++       EA +D++ T    KSNI+I  K+ H+ 
Sbjct: 58  ILGTHTSGEEVDYLKVAALDLPDEVVTG-----EANDDNRRT----KSNIKIVKKFEHDG 108

Query: 146 EITRARYMPQNPDFVATLNGQGTVFLY----SRSGGLQSTLKFHKDNGYALSFNALVEGQ 201
           EI RARYMP++ + +AT+NG+G V +Y    SRS GL++TLK+HK+NGY LSFN  V  +
Sbjct: 109 EINRARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNE 168

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
           L+SGSDD T+ALW++ S S S  P   W+++HSDIVND  WH+F+E LFG+VSEDS LK+
Sbjct: 169 LISGSDDFTIALWDIDSGSKS--PKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKL 226

Query: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321
           +D R+ +  I+ ++    FNTLAFS HS+NL AAAG+D+++YLYD R   +PLH M+GHE
Sbjct: 227 HDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHE 286

Query: 322 DAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSV 381
           DA+T ++F               R+I+WDL +IGAEQ PD+A+DG PE++M+HAGHRS++
Sbjct: 287 DAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAI 346

Query: 382 NDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426
           NDF L+  IPWL AS EE+N++QVWKCS NL  VGG P+++  ++
Sbjct: 347 NDFTLHPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKML 391

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  449 bits (1156), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 217/400 (54%), Positives = 282/400 (70%), Gaps = 16/400 (4%)

Query: 30  QEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGT 89
           + + L   EEYDLWKSNVP+MYDFVSETRL WPSL+VQWLP     A     RQELI+GT
Sbjct: 27  ENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLP---HSAPNPVTRQELILGT 83

Query: 90  HTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITR 149
           HTS EE+NYLK A +++P E+ +  +  E  EE         +SNIR+T K+ H+ E+TR
Sbjct: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEE-------QVRSNIRVTRKFKHDSEVTR 136

Query: 150 ARYMPQNPDFVATLNGQGTVFLYSRSGGLQS---TLKFHKDNGYALSFNALVEGQLLSGS 206
           ARYMPQ+P+ +AT++G GTV++Y RS    +   TL++H DNGY L+FN L++G LLSGS
Sbjct: 137 ARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSGS 196

Query: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266
           DD  VALW+V S+     PV+ W ++HSDIVND +WHNF + LFGTVSEDS L+I+D R 
Sbjct: 197 DDSNVALWDVTSDRNE--PVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRE 254

Query: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326
               +  +   +PFNTL+FSHHS NLLA  G++S VYLYD R + EPLH MSGH DAVT+
Sbjct: 255 SK-PVATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTS 313

Query: 327 IEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386
           ++FS+             R+I+WD+  IGAEQ  +DAED   E++M+HAGHRS +NDF +
Sbjct: 314 LDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAI 373

Query: 387 NAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426
           N  IPWLVAS+EEENI+Q+WKCSH LP + G P V  D++
Sbjct: 374 NPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDML 413

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  438 bits (1126), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 277/390 (71%), Gaps = 18/390 (4%)

Query: 27  METQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI 86
           +E  E  L+VD+EY+LWKSNV LMYDFVSET+LTWPSLS+QWLP+   +A     +QE+I
Sbjct: 7   IEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPS--VDANVPLKQQEMI 64

Query: 87  IGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEE 146
           +GTHTSG+E NYLK A I++P E++   D    +E          KS I++T K+ HE+E
Sbjct: 65  LGTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSE--------PVKSMIKVTKKFEHEDE 116

Query: 147 ITRARYMPQNPDFVATLNGQGTVFLYSRSG----GLQSTLKFHKDNGYALSFNALVEGQL 202
           + RARYMP+N   +AT+NG+G +F+Y RS     GL  TL +HKDNGY L+FN  +EG+L
Sbjct: 117 VIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGEL 176

Query: 203 LSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIN 262
           LS SDD TVALW++ S    +S V      H+DIVND KWH F+E +FGTVSED  L+++
Sbjct: 177 LSASDDTTVALWDINSTDRPVSIVMN----HTDIVNDSKWHEFDENIFGTVSEDKTLQVH 232

Query: 263 DVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHED 322
           D R+ + +   +   +P N LAFS HS NL+AAAG D+ VYLYDLR + EPLH M+GH+D
Sbjct: 233 DKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292

Query: 323 AVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVN 382
           AVT+IEFS+H            RL +WDL QIGAEQ  +DA+DGVPEL+M+HAGHRS++N
Sbjct: 293 AVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAIN 352

Query: 383 DFDLNAQIPWLVASSEEENILQVWKCSHNL 412
           DF  N Q+PWL+AS+EE+N++QVWK S  L
Sbjct: 353 DFSFNPQVPWLIASAEEDNVVQVWKISKKL 382

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  425 bits (1092), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 216/395 (54%), Positives = 271/395 (68%), Gaps = 13/395 (3%)

Query: 26  AMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQEL 85
           ++E + K LS++EEY+LWK+NVPLMYDFVSET+LTWPSL++QWLP           +QE+
Sbjct: 2   SIEEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLP-----GNSSSTKQEM 56

Query: 86  IIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEE 145
           I+GTHTSGE++NYLK A I +P++IL  +  +     ++       +S I+IT K  HEE
Sbjct: 57  ILGTHTSGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEE 116

Query: 146 EITRARYMPQNPDFVATLNGQGTVFLYSRSG----GLQSTLKFHKDNGYALSFNALVEGQ 201
           EITRAR+MPQ+P+F+AT+NG G VFL+ RS      L S   FHKDNGY LSFN   +G+
Sbjct: 117 EITRARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGE 176

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
           LLS SDD T+ALW V   +TS S   T    H DIVND  WH FNE LFG+VSED  L+I
Sbjct: 177 LLSCSDDGTIALWNVMGTNTSPSKAVT---THEDIVNDCTWHEFNENLFGSVSEDKTLQI 233

Query: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321
           +D R  N T+  +    PFNTL FS HS NL AAAG DS VYLYDLRN  + LH MSGHE
Sbjct: 234 HDKRT-NSTVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHE 292

Query: 322 DAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSV 381
           D+VT++EFS H            R+++WDL QIG+EQ  +DA DGVPEL+M+HAGH+S+V
Sbjct: 293 DSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAV 352

Query: 382 NDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVG 416
           NDF  N  IPWL+AS EE+NI+ VWK S  L   G
Sbjct: 353 NDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPG 387

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  420 bits (1080), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 213/402 (52%), Positives = 285/402 (70%), Gaps = 15/402 (3%)

Query: 27  METQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQ--EAEGG-FIRQ 83
           +E  E+  +++EEYDLW SNVP+MYDFVSETRLTWPSL+VQWLPT +Q  E +G   +RQ
Sbjct: 4   VEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQ 63

Query: 84  ELIIGTHTSGEEENYLKFAEINIPKEILNNQDP-QEEAEEDDKATLNAPKSNIRITAKYV 142
           EL+IGT T+  E NYLK A I++P+ + +++    ++A+E++   L+  +S I+I  K+ 
Sbjct: 64  ELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENE---LSHRQSKIKIVRKFK 120

Query: 143 HEEEITRARYMPQNPDFVATLNGQGTVFLYSRS-----GGLQSTLKFHKDNGYALSFNAL 197
           HE+E+TRARYMPQ+P+ +ATLNG G V+++ R+      G  ++  +HK+NGY L+FN  
Sbjct: 121 HEQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPT 180

Query: 198 VEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDS 257
           V GQLLS SDD TVALW+V S +   SP +T+ D+H+DIVND KWH F   LFGTVSED+
Sbjct: 181 VSGQLLSASDDGTVALWDVTSTANK-SPSQTF-DVHTDIVNDCKWHEFQSSLFGTVSEDN 238

Query: 258 LLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHM 317
            L I+D  + +  I  +     FNTLAFS  S NLLAAAG DS+VYLYDLR +++PLH M
Sbjct: 239 TLIIHDTNS-DRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSM 297

Query: 318 SGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGH 377
           +GHED+VT++EFS H            R+IMWDL  IGAEQ PDDA DGVPEL M+H GH
Sbjct: 298 AGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGH 357

Query: 378 RSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPP 419
           RS VN+F  N+ +PWL+ S EEEN+LQ+WK ++ +     PP
Sbjct: 358 RSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPP 399

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  421 bits (1081), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 204/397 (51%), Positives = 285/397 (71%), Gaps = 10/397 (2%)

Query: 34  LSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSG 93
           ++VDEEY+LWKSNVP++YDFVSETRLTWP+L+V+WLP   +       RQ+LI+GTHTSG
Sbjct: 28  MTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQ--KNLVAARTRQQLILGTHTSG 85

Query: 94  EEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRARYM 153
           EE+NYLK   +++P E+  N     E +E+D+  +    SN++I  K+ H+ EITRARYM
Sbjct: 86  EEQNYLKIGAVDLPVEVTENSKKDREIDEEDEDMV---LSNVKIVKKFPHDGEITRARYM 142

Query: 154 PQNPDFVATLNGQGTVFLYSRSG----GLQSTLKFHKDNGYALSFNALVEGQLLSGSDDH 209
           PQ+ + +AT+NG+G +F+Y RS      L STL++H +NGY L+FNA  +  LLSGSDD 
Sbjct: 143 PQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDS 202

Query: 210 TVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNI 269
            +ALW++ +   +I P  T+ D H+DI+ND+KWH+    +FG+VSEDS +K+ D R+  I
Sbjct: 203 NIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQI 262

Query: 270 TIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEF 329
            I  +   +P+NTLAFS  SSNL AAAG D+ VYLYD+R++  PL+ M+GHEDAVT IEF
Sbjct: 263 -IHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEF 321

Query: 330 STHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQ 389
             +            R I+WDL++IGAEQT D+ EDG PE++M+HAGH++S+ND  +N  
Sbjct: 322 DPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPN 381

Query: 390 IPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426
           I WLVAS+EE+NI+Q+WKCS N+P +GG P+V+  I+
Sbjct: 382 INWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  417 bits (1071), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 211/404 (52%), Positives = 282/404 (69%), Gaps = 22/404 (5%)

Query: 28  ETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELII 87
           + +E+ LS+DEEY LWKSNVPLMYDFVSET+LTWPSL+V+WLP    + +    +QE+II
Sbjct: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLP---HDPQAPLTQQEMII 60

Query: 88  GTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAP-KSNIRITAKYVHEEE 146
           GTHTS +E NY+K A I +P E++   DP   ++        AP KSN+RIT K+  E+E
Sbjct: 61  GTHTSDQEPNYVKIASIELPNEVI---DPHNVSD--------APVKSNVRITKKFKLEKE 109

Query: 147 ITRARYMPQNPDFVATLNGQGTVFLYSR--SGGLQSTLKFHKDNGYALSFNALVEGQLLS 204
           ITR+RYM Q+P+ ++T++G GTV ++ R  S     T  +HKDNGY LSFN + +GQLLS
Sbjct: 110 ITRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLS 169

Query: 205 GSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSED-SLLKIND 263
            +DD  +A++++  N+ S  PV TW    + I+NDIKWH+F+  LFGTVSE+ + L I D
Sbjct: 170 AADDGYIAMYDI--NAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYD 227

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +R  +  + +++  QPFN+LAFS HS NL +AAG D +VYLYDLRN R+ LH MSGHE  
Sbjct: 228 LRTKD-KVTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGP 286

Query: 324 VTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 383
           VTN+EF               R+I+WDL +IG+EQ  +DA+D  PEL+M+HAGHRSSVND
Sbjct: 287 VTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVND 346

Query: 384 FDLNAQIPWLVASSEEENILQVWKCSHNLP-IVGGPPKVNKDII 426
           F LN+ IPWL+AS+EEENI+QVWK S  LP I    P +N D+I
Sbjct: 347 FSLNSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFINYDLI 390

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  414 bits (1063), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 206/398 (51%), Positives = 268/398 (67%), Gaps = 21/398 (5%)

Query: 29  TQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIG 88
           T  ++L+V+EEY+LW SNVP+MY+FVSET+LTWPSL++QWLP+  Q  E     Q LI G
Sbjct: 37  TDVQSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPE-----QSLIFG 91

Query: 89  THTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEIT 148
           THT+GEE NYLK A IN+P  I       EE E +D        S+  I  K+ H EE+ 
Sbjct: 92  THTAGEEVNYLKVATINLPAGIAGLDQGDEEDEANDH-------SSFAIANKFPHIEEVI 144

Query: 149 RARYMPQNPDFVATLNGQGTVFLYSR----SGGLQSTLKFHKDNGYALSFNALVEGQLLS 204
           RARYMP N + +AT+NG+GT+ ++ R    S    STL FHK+NGY L+FN  + G+LLS
Sbjct: 145 RARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLS 204

Query: 205 GSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDV 264
           GSDD TVALW++ +     S + +    H DIVND+KWH F   +FGTVSED  L+++D 
Sbjct: 205 GSDDTTVALWDIEAAKKPKSILTS----HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260

Query: 265 RAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAV 324
           R     +  +    PFNTL+FS HS NLLAAAG+DS +YLYD+R+M  PLH MSGH+D+V
Sbjct: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSV 320

Query: 325 TNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDF 384
           T +EFS H            R I+WDL QIGAEQ+ DDA+DG PEL+M+HAGHRS VN+F
Sbjct: 321 TTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEF 380

Query: 385 DLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVN 422
             N QIPWL+AS+EE+N++Q WK S  L +   PP ++
Sbjct: 381 SFNPQIPWLLASTEEDNVIQAWKVSMKL-VNASPPAIS 417

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  411 bits (1056), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 201/400 (50%), Positives = 272/400 (68%), Gaps = 21/400 (5%)

Query: 27  METQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI 86
           +E QE+ L+VD+EYDLWKSNVPL+YDFVSETRLTWPSL++QWLP      +    RQ LI
Sbjct: 4   VEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLP-----GDKTSTRQHLI 58

Query: 87  IGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEE 146
           +GT TSG E +YLK A +++P EI+         ++ DK      KSN+++  K+ H+ E
Sbjct: 59  LGTLTSGAETDYLKIAALDLPDEII-------IGKKSDKVV----KSNLKVVKKFAHDGE 107

Query: 147 ITRARYMPQNPDFVATLNGQGTVFLYS----RSGGLQSTLKFHKDNGYALSFNALVEGQL 202
           I RARYMPQN + +AT+NG+GT+F+Y     +   L STLK+HKDN Y L+FN   EG+L
Sbjct: 108 INRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGEL 167

Query: 203 LSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIN 262
           +SGSDD T+ALW+  +N     P++ W   HSDIVND +WH FN  +FG+VSEDS L++ 
Sbjct: 168 ISGSDDSTIALWD-ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226

Query: 263 DVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHED 322
           D R    +   +     +N++AFS  S NL AAAG  +++YLYD+RN  + LH M+GHE+
Sbjct: 227 DKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEE 286

Query: 323 AVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVN 382
            VT++EFS              R+IMWDL +IGAEQ PD+A+DG+PE++M+HAG RS++N
Sbjct: 287 PVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAIN 346

Query: 383 DFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVN 422
           D   +  IPWL AS EE NI+QVWKCS  LP + G P+V+
Sbjct: 347 DISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVS 386

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  402 bits (1033), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 198/386 (51%), Positives = 269/386 (69%), Gaps = 13/386 (3%)

Query: 31  EKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTH 90
           E  +SVDEEYDLWKSNVPLMYDFVSET+L WPSL++QWLP+  +  E     QELI+GTH
Sbjct: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNE-----QELILGTH 61

Query: 91  TSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRA 150
           TSG E+NYLK A +++P E++++      + +D K + + P+S I+I  K+ H +E+TRA
Sbjct: 62  TSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRA 121

Query: 151 RYMPQNPDFVATLNGQGTVFLYSRS----GGLQSTLKFHKDNGYALSFNALVEGQLLSGS 206
           RY P NP+ +AT++G G VFLY RS      L +   FHK+NGY L+F+ +  G+LLS S
Sbjct: 122 RYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCS 181

Query: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266
           DD ++A+W+V S   +  PV+  +  H++IVN+ KWH  +  LFG+VS+DS L I+D R 
Sbjct: 182 DDGSIAIWDVCSGKNT--PVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238

Query: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326
               +  ++  +P+NTLAFS HSSNL AAAG DS V LYDLR    P+H MSGH D+VT+
Sbjct: 239 DKPVVKILQS-EPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTS 297

Query: 327 IEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386
           +EF+ H            R+++WDL QIGAEQ  +DA+DGVPEL+M+HAGH+S VNDF  
Sbjct: 298 LEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSC 357

Query: 387 NAQIPWLVASSEEENILQVWKCSHNL 412
           +  IPWL+AS EEEN++Q+WK S  L
Sbjct: 358 SPNIPWLMASVEEENVVQIWKASKKL 383

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  386 bits (992), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 196/386 (50%), Positives = 266/386 (68%), Gaps = 15/386 (3%)

Query: 31  EKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTH 90
           E+ LS+D+EYDLWKSNVPLMYDFVSETRL WPSL++QWLP      E     QEL++GTH
Sbjct: 7   ERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTE-----QELLVGTH 61

Query: 91  TSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRA 150
           TS  E+NYLK AEIN+P+EIL+N+ P    + D+  +     S I+I  K+ HE E+TRA
Sbjct: 62  TSDSEQNYLKIAEINLPQEILSNEGPV--LQNDNNGSDEQVPSKIKIIKKFKHENEVTRA 119

Query: 151 RYMPQNPDFVATLNGQGTVFLYSRS----GGLQSTLKFHKDNGYALSFNALVEGQLLSGS 206
           RY P + + +AT++G GTVFLY R+      L+    +HK+NGY L+F+    G+L+S S
Sbjct: 120 RYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCS 179

Query: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266
           DD ++A+W++ S  T  + V   N LHSDIVN+ KWH  +  ++G+VSEDS L I+D R+
Sbjct: 180 DDGSIAIWDIKSGKTVPTSV---NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRS 236

Query: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326
               +  +   +PFNT+AFS HSSNL AAAG D+ VYL+D R   E LH MSGH++AVT+
Sbjct: 237 EK-PLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTS 295

Query: 327 IEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386
           +EF+ H            R+++WDL QIG EQ  +DA+DG PEL+M+HAGH+S++NDF  
Sbjct: 296 LEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSF 355

Query: 387 NAQIPWLVASSEEENILQVWKCSHNL 412
           +  +PWL+AS EEENI+Q+WK S  L
Sbjct: 356 SPNVPWLMASVEEENIVQIWKPSRKL 381

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  377 bits (969), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 281/425 (66%), Gaps = 42/425 (9%)

Query: 20  TANNRAAMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPT------PI 73
           T   ++ ++ +E+ L+ D+EY+LWKSNVPL+YDFVSET+L WPSL+V+WLP+      P 
Sbjct: 6   TNEQKSTIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPS 65

Query: 74  QEAEGGFIRQELIIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKS 133
            E       Q L++GTHTSGEE+NYLK AEI +P +I+N     E+ E++    +   KS
Sbjct: 66  NE-------QRLLLGTHTSGEEQNYLKIAEITLPDQIIN-----EKTEDNSDKHV---KS 110

Query: 134 NIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLY------SRSGGLQSTLKFHKD 187
           NIRI  K+ HE E+TRA YMPQ+   +AT+NG GTVF+Y      ++S  + S L  HK+
Sbjct: 111 NIRIIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKE 170

Query: 188 NGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNE 247
           NGY L+FN L +G+LLS SDD +VA W +     SI P+ T  +  + I+ND++W+ FN+
Sbjct: 171 NGYGLAFNPLDKGKLLSSSDDGSVAYWNI---QKSI-PLLTLQE--TSIINDVRWNQFNQ 224

Query: 248 KLFGTVSEDSLLKINDVRAHN-----ITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHV 302
            LFG V+E S L + DVR +N     ++   +K P  FN +AFS HS  L+AA+G DS +
Sbjct: 225 NLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLI 284

Query: 303 YLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDD 362
           YLYD RN+ +PLH+M GHED+VT+++F               R+ +WDLKQIG EQT D+
Sbjct: 285 YLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDE 344

Query: 363 AEDG-VPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKV 421
            EDG VPEL+M+HAGHRS +NDF ++  + WL AS EE+NI+QVWK +++L      P V
Sbjct: 345 IEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSL---REDPLV 401

Query: 422 NKDII 426
           N ++I
Sbjct: 402 NMNVI 406

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  125 bits (313), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 106/437 (24%), Positives = 192/437 (43%), Gaps = 74/437 (16%)

Query: 19  TTANNRAAMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEG 78
           TT NN   +E    +  + E Y  WK N  L+YD+++     WPSLS Q+     Q+   
Sbjct: 9   TTVNN---IEATAISQDLQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFF----QDVNT 61

Query: 79  GFIRQELIIGTHTSG-----EEENYLKFAEI-NIPKEILNNQDPQEEAEEDDKATLNAPK 132
                 +++ + TSG     E  N +  + + ++P   LNN D  E   +        P 
Sbjct: 62  KNDSHRILLSSFTSGLMPEQESINIMSISTLKHVPWASLNNFDMDEMEFK--------PD 113

Query: 133 SNIRITAKYVHEEE--------ITRARYMPQNPDFVATLNGQGTVFLYSRS---GGLQST 181
           +N+++  K +H E+          RARY+PQN D +A  +  GTV++++R+     L+ T
Sbjct: 114 NNLKLPPKNLHTEQTITFPNGDCNRARYLPQNQDIIAGASSDGTVYIFNRTKYGSTLRQT 173

Query: 182 LKFHK-------------------DNGYALSFNALVEGQLLSGSDDHTVALWEV----GS 218
             F                     +   ++ +N   EG L +   D  +  W++     +
Sbjct: 174 SSFQSYQARFAEPENTVQSVDSNPNEALSIDWNVQREGLLAASYSDGEIKTWDLKKFSNA 233

Query: 219 NSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA--HNITIDAVKC 276
           N+T  +P  +   + ++  ND+ W   ++ L     E + L I D+R    + TI +   
Sbjct: 234 NTTITTPTVSIM-MDTNGANDVTWMPLHDSLLAACGESNKLIIYDIRGSREHTTISSGIH 292

Query: 277 PQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXX 336
               N   F++ ++ ++A+A    +V+++D+R   E +  +  H  +++ IE++ +    
Sbjct: 293 EDGINACRFNYANNLIVASADTVGNVHIWDIRKSNEIVKTIP-HGSSISTIEWNPNMDTI 351

Query: 337 XXXXXXXNRLI-MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVA 395
                  + L+ +WD+                 ELI  H GH   VND   N   PWL+ 
Sbjct: 352 LATAGQDDGLVKLWDVTD--------------SELIFTHGGHMLGVNDISWNRHDPWLMC 397

Query: 396 SSEEENILQVWKCSHNL 412
           S   +N +Q+W+ +HNL
Sbjct: 398 SVARDNSVQIWRPAHNL 414

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  122 bits (306), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 100/409 (24%), Positives = 182/409 (44%), Gaps = 51/409 (12%)

Query: 38  EEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE--E 95
           + Y  WK N  L YD+++     WPSL+ Q  P    + +       +++ + TS +  E
Sbjct: 23  KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFP----DLDLATDEHRILLSSFTSSQVPE 78

Query: 96  ENYLKFAEIN----IPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRAR 151
           +  L  A ++    IP   LNN D +E+  + D +     KS +          +  +AR
Sbjct: 79  DESLYVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFPAGDCNKAR 138

Query: 152 YMPQNPDFVATLNGQGTVFLYSR-----------SGG---------LQSTLKFHKDNGYA 191
           Y P NPD + + +  G+++++ R           S G         L ++L+ HK+   +
Sbjct: 139 YCPSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAVS 198

Query: 192 LSFNALVEGQLLSGSDDHTVALWEV----GSNSTSISPVRTWNDLHSDIVNDIKWHNFNE 247
           L++N   +G L +      V +W++     ++ T I+P+   + +     N++ W   ++
Sbjct: 199 LAWNWQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAM-STVDPRGSNEVSWMVRHD 257

Query: 248 KLFGTVSEDSLLKINDVRAHNITIDAVKCPQ---PFNTLAFSHHSSNLLAAAGMDSHVYL 304
            L    SED+L+ I D+R       +   P      NT  F++H   LL +A     + L
Sbjct: 258 SLLAYCSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGRINL 317

Query: 305 YDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDLKQIGAEQTPDDA 363
           +D+RN  +PL  +  H D+++ ++++               L+ +WDL Q   +      
Sbjct: 318 WDIRNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQ------ 370

Query: 364 EDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNL 412
                ELI  H GH   VND   +    W++ S   +N +QVW+ S++L
Sbjct: 371 -----ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  122 bits (306), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 99/416 (23%), Positives = 182/416 (43%), Gaps = 63/416 (15%)

Query: 36  VDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE- 94
           + + Y  WK N  L+YD+++     WPSL+ Q+ P   +  +       L++ T TS + 
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSND----THRLLLSTFTSSQI 68

Query: 95  -EENYLKFAEINIPKEI----LNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITR 149
            ++  +  + I+    +    LNN D  E   + D       K+ I   +    E +  +
Sbjct: 69  PDDESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFPEGDCNK 128

Query: 150 ARYMPQNPDFVATLNGQGTVFLYSRS----------------------GGLQSTLKFHKD 187
           ARYMPQNPD +   +  G ++++ R+                        L    KF  +
Sbjct: 129 ARYMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIE 188

Query: 188 NG--------YALSFNALVEGQLLSGSDDHTVALW----EVGSNSTSISPVRTWNDLHSD 235
           +G         ++++N   EGQLLS   +  + LW    E  S +  I+    W+    D
Sbjct: 189 DGTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNT-IWDTNFDD 247

Query: 236 I-VNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNI--TIDAVKCPQPFNTLAFSHHSSNL 292
           +  N++ W N +  +F T  E++ + + D R   I  +I+        N+  F++ ++ L
Sbjct: 248 LGCNEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAML 307

Query: 293 LAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDL 351
           LA+   +  + L+D+R + +P+ ++  H  +++ IE+S             + L+ +WD 
Sbjct: 308 LASGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWD- 365

Query: 352 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
             I  E+ P          I +H GH   +ND   +   PWL+ S   +N +Q+WK
Sbjct: 366 --ISNEEEP----------IFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWK 409

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  122 bits (305), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 97/407 (23%), Positives = 186/407 (45%), Gaps = 43/407 (10%)

Query: 36  VDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE- 94
           V + Y  WK N  L+YD+++     WPSLS Q+ P      +    +Q +++ + TS + 
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTND----KQRILLSSFTSQQL 75

Query: 95  -EENYLKFAEINIPKEI----LNNQDPQE-EAEEDDKATLNAP--KSNIRITAKYVHEEE 146
            ++  +    I+    +    +NN D  E E + D+   LN    +  +RIT     + +
Sbjct: 76  PQDESIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYP---DGD 132

Query: 147 ITRARYMPQNPDFVATLNGQGTVFLYSRS---GGLQSTLKFH----------KDNGYALS 193
             R RYMPQNPD + T +  G+V+++ R+     + +  KF           +D   +L+
Sbjct: 133 CNRCRYMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDESLSLA 192

Query: 194 FNALVEGQLLSGSDDHTVALWEVGSNSTSIS----PVRTWNDLHSDIVNDIKWHNFNEKL 249
           +N  +EG L +   +  V +W++     S      P R  + + ++ VND+ W   +  +
Sbjct: 193 WNYQLEGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERE-SVMDANGVNDVSWMVNHTSI 251

Query: 250 FGTVSEDSLLKINDVRAHNI--TIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDL 307
             +  E +++ + D+R      T+         N + F++ +  +L        + ++D+
Sbjct: 252 LASCGESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDI 311

Query: 308 RNMREPLHHMS-GHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDLKQIGAEQTPDDAED 365
           R+ +EP+     G +D ++ I+++             + L+ +WD      EQ   +AE+
Sbjct: 312 RDFKEPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWD---ASGEQEDSNAEN 368

Query: 366 GVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNL 412
            +  L+ VH GH   VND   +   PW + S   +N + +WK + NL
Sbjct: 369 NM--LLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANL 413

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  120 bits (302), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 100/413 (24%), Positives = 177/413 (42%), Gaps = 60/413 (14%)

Query: 38  EEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSG--EE 95
           + Y  WK N  L+Y++++     WPSL+ Q+ P    + +       +++ + TS    E
Sbjct: 23  DRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDS----HRILLSSFTSSLVPE 78

Query: 96  ENYLKFAEINIPKEI----LNNQDPQEEAEEDDKATLNAPKSNI--RITAKYVHEEEITR 149
           +  L    I+  K +    LNN D  E   + D + +  P  N+   +  ++ + +   R
Sbjct: 79  DESLYITRISTLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLTTELVIRFPNGD-CNR 137

Query: 150 ARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALV----------- 198
           ARY+PQNPD +A  +  G+V+++ R+     T    + +G+  S+ A +           
Sbjct: 138 ARYLPQNPDLIAAASSDGSVYIFDRTK--HGTAMHSRQSGFTQSYQAKLAVNNNSQSLNG 195

Query: 199 -------------EGQLLSGSDDHTVALWEVGSNSTSISPVRT--WN-DLHSDIVNDIKW 242
                        EG L+    D  V  W++     S   ++   +N  L     ND  W
Sbjct: 196 ENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESGCNDAVW 255

Query: 243 HNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQP--FNTLAFSHHSSNLLAAAGMDS 300
              +  LF   SED+ L + D R  +  ID          N   F+  +S LLA+     
Sbjct: 256 MPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLASGDSIG 315

Query: 301 HVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDLKQIGAEQT 359
           ++ L+D+R    P++ +  H  +++ IE++ +           + L+ +WD         
Sbjct: 316 NICLWDIRKKETPINILD-HGSSISTIEWNPNLSTVLASAGQDDGLVKLWDA-------- 366

Query: 360 PDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNL 412
                 G  + + +H GH   VND   N   PWL+ S  ++N +Q+WK +HNL
Sbjct: 367 ------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNL 413

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  120 bits (300), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 96/408 (23%), Positives = 179/408 (43%), Gaps = 47/408 (11%)

Query: 36  VDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE- 94
           V   Y  WK N  L+YD+++     WPSL+ Q+ P    + +    +  L++ + TS + 
Sbjct: 30  VQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTNDQHRLLLSSFTSSQL 85

Query: 95  -EENYLKFAEIN----IPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITR 149
            E+  +  + ++    +P   LNN D  E   + D ++    K+ I+         +   
Sbjct: 86  PEDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFPMGDCNG 145

Query: 150 ARYMPQNPDFVATLNGQGTVFLYSRS-----------GGLQSTLKFHKDN------GYAL 192
           ARY+PQNPD +A  +  G+++++ R+           GG    L+F   +        +L
Sbjct: 146 ARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSMFELEFQSSSLEEHQEVVSL 205

Query: 193 SFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHS---DIVNDIKWHNFNEKL 249
           ++N   EG L +      V +W+V   S +   +   +  H+      ND+ W   +  +
Sbjct: 206 AWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMVNHASI 265

Query: 250 FGTVSEDSLLKINDVRAHNITIDAVK----CPQPFNTLAFSHHSSNLLAAAGMDSHVYLY 305
                E + + + D RA    + + K      +  N+  F++H+  LL +      V L+
Sbjct: 266 LACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTGRVNLW 325

Query: 306 DLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDLKQIGAEQTPDDAE 364
           D+R++  PL  +  H  +++  +++ +           + L+ +WD+ Q   E       
Sbjct: 326 DIRDLETPLKSLD-HGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPGE------- 377

Query: 365 DGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNL 412
               EL+ VH GH   VND   N   PWL+ S   +N +Q+W+ + NL
Sbjct: 378 ----ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNL 421

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  119 bits (298), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 102/413 (24%), Positives = 182/413 (44%), Gaps = 55/413 (13%)

Query: 36  VDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE- 94
           V   Y  WK N  L+YD+++     WPSL+ Q+ P    + +    +  L++ + TS + 
Sbjct: 21  VQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTSSDQHRLLLSSFTSSQL 76

Query: 95  -EENYLKFAEINIPKEI----LNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITR 149
            E+  +  ++I+  K +    LNN D  E   + D +    PK+     +      +  R
Sbjct: 77  PEDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVSIRFPNGDCNR 136

Query: 150 ARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGY------------------- 190
           +RY+PQNPD +A  +  G+V++++++    S L+    + +                   
Sbjct: 137 SRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSHDAQNLDNFNE 196

Query: 191 --ALSFNALVEGQLLSGSDDHTVALWEVGSNSTS---ISPVRTWNDLHSDIVNDIKWHNF 245
             +LS+N   EG L          +W+V   S S   IS         S+  ND+ W   
Sbjct: 197 AVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFDSNGCNDLDWMPM 256

Query: 246 NEKLFGTVSEDSLLKINDVRAHN----ITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH 301
           ++ +F    E + L + D+R +      +I   K     NT  F+  +S L+A+A     
Sbjct: 257 HDSMFIACGESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPGNSLLVASADTCGR 316

Query: 302 VYLYDLRNM-REPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDLKQIGAEQT 359
           + L+D+R + +EP+  M  H  +++ IE++ +           + L+ +WD   +G E  
Sbjct: 317 INLWDIRKLDQEPISTMQ-HGSSISTIEWNPNIGVVFASAGQEDGLVKLWD-ASVGKE-- 372

Query: 360 PDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNL 412
                      I VH GH   VND   +   PWL+AS   +N +Q+W+ + N+
Sbjct: 373 -----------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWRPAKNI 414

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  118 bits (296), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 102/406 (25%), Positives = 179/406 (44%), Gaps = 51/406 (12%)

Query: 38  EEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE--E 95
           + Y LWK N  L+YD+++     WPSLS Q+ P    + +       L+  + TS +  +
Sbjct: 10  QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFP----DLDTSSDTHRLLFTSFTSSQLPQ 65

Query: 96  ENYLKFAEIN----IPKEILNNQDPQEEAEEDDKATLNAPKS-NIRITAKYVHEEEITRA 150
           +  +  A I+    +P   LNN D  E   + D +T   PK+  I++T  + H  +  RA
Sbjct: 66  DENVTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPH-GDCNRA 124

Query: 151 RYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLK----------FHKDNG------YALSF 194
            Y+PQNPD ++T +  G+V+++ R+   +S +              +NG       AL +
Sbjct: 125 TYLPQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDW 184

Query: 195 NALVEGQLLSGSDDHTVALWEVGS----NSTSISPVRTWNDLHSDIVNDIKWHNFNEKLF 250
           N  +EG L S   +  + +W++      N     P   + D  S   ND+ W   ++ L 
Sbjct: 185 NRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLL 244

Query: 251 GTVSEDSLLKINDVRAH-NI--TIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDL 307
               ED+++ + D R + NI  T  +       N   F+     L+A A  D  V L+D+
Sbjct: 245 SIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDI 304

Query: 308 RNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDLKQIGAEQTPDDAEDG 366
           R +  P+  ++  E  ++ +E++             + L+ +W            +A +G
Sbjct: 305 RKLHNPIKTINC-ESPLSALEWNPQLPTVLATGGQEDGLVKLW------------NASNG 351

Query: 367 VPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNL 412
             +L+  H GH   VND   +    WL+ S   +N   +WK +  L
Sbjct: 352 --QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  118 bits (296), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 103/436 (23%), Positives = 188/436 (43%), Gaps = 65/436 (14%)

Query: 21  ANNRAAMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGF 80
             N  A E      ++ E Y  WK N  L+Y++++     WPSL+ Q+ P    + +   
Sbjct: 4   CTNDTANEASNIPPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFP----DLDTTL 59

Query: 81  IRQELIIGTHTSGE--EENYLKFAEINIPKEI----LNNQDPQEEAEEDDKATLNAPKSN 134
               +++ + TS +  E+  +  ++I+    I    LNN D  E   + + +T   PK  
Sbjct: 60  DEHRILLSSFTSSQKPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHL 119

Query: 135 IRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHK-------- 186
           +   + +    E  RARY+PQNPD +A  +  G ++++ R+    + ++  K        
Sbjct: 120 VNDISIFFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAK 179

Query: 187 ---------------------DNGYALSFNALVEGQLLSGSDDHTVALWEVGS----NST 221
                                +   ++++N   E  LLS   +  V +W++      N  
Sbjct: 180 LFGSHGVIQDVETMDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPI 239

Query: 222 SISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQ--- 278
              P+ + N   S  VND+ W   ++ LF   +E + + + D+R     + +  C     
Sbjct: 240 IDLPLVSINSDGSG-VNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKS-NCRSHNG 297

Query: 279 PFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMRE-PLHHMSGHEDAVTNIEFSTHXXXXX 337
             N+  F++ +S +LA+A  +  + L+D+RNM + PL  M  H  +V+ +E+S +     
Sbjct: 298 GVNSCKFNYRNSLILASADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVL 356

Query: 338 XXXXXXNRLI-MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVAS 396
                 + L+ +WD  +               E I  H GH   VND   +A  PWL+ S
Sbjct: 357 ATAGQEDGLVKLWDTSR--------------EENIFTHGGHMLGVNDISWDAHDPWLMCS 402

Query: 397 SEEENILQVWKCSHNL 412
              +N + +WK + NL
Sbjct: 403 VANDNSVHIWKPAVNL 418

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  118 bits (295), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 97/413 (23%), Positives = 184/413 (44%), Gaps = 61/413 (14%)

Query: 38  EEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE--E 95
           + Y  WK N  L+YD+++     WPSL+ ++ P    + +       L++ + TS +  E
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFP----DLDTTTDSHRLLLSSFTSSQLPE 72

Query: 96  ENYLKFAEINIPKEI----LNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRAR 151
           +  +  + I+  K +    LNN D  E   + + +T   P++     +  +   +  RAR
Sbjct: 73  DESIYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSGDSNRAR 132

Query: 152 YMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGY--------------------A 191
           Y+PQNPD ++  +  G+++++ R+    +  +      Y                    +
Sbjct: 133 YLPQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVVS 192

Query: 192 LSFNALVEGQLLSGSDDHTVALWEVG----SNSTSISPVRTWNDLHSDIVNDIKWHNFNE 247
           L +N   EG L S      + +W++     SN T  +P+ + +D      NDI W   ++
Sbjct: 193 LDWNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPSHD 252

Query: 248 KLFGTVSEDSLLKINDVRAHNITIDAVKCPQP------FNTLAFSHHSSNLLAAAGMDSH 301
            L     E + + I D R+ +     V   QP       N+  F+ H+  LLA+A     
Sbjct: 253 SLLAACGESNTVAIYDTRSKS----QVSKIQPGLHNGGINSCDFNAHNDYLLASADSIGT 308

Query: 302 VYLYDLRNM-REPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDLKQIGAEQT 359
           V+++D+R + ++P+  +S H  +++ ++++ +           + L+ +WD         
Sbjct: 309 VHMWDIRKLDQDPIQSVS-HGSSISTVKWNPNVATIIAVAGQEDGLVKLWD--------- 358

Query: 360 PDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNL 412
              A +G  +LI  H GH   VND   NA  PWL+ S   +N + +W+ S +L
Sbjct: 359 ---ASNG--QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHL 406

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  117 bits (292), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 103/437 (23%), Positives = 188/437 (43%), Gaps = 67/437 (15%)

Query: 23  NRAAMETQEKALSV----DEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEG 78
           N+ A +   +A S+     E Y  WK N  L+YD+++     WPSL+ Q+ P     ++ 
Sbjct: 2   NQCAKDITHEASSIPIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSD- 60

Query: 79  GFIRQELIIGTHTSGE--EENYLKFAEINIPKEI----LNNQDPQEEAEEDDKATLNAPK 132
                 +++ + TS +  E+  +  ++I+    I    LNN D  E   + + +T    K
Sbjct: 61  ---EHRILLSSFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSK 117

Query: 133 SNIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHK------ 186
             +   + +    E  RARY+PQNPD +A  +  G ++++ R+    + ++  K      
Sbjct: 118 HLVNDISIFFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFE 177

Query: 187 -----------------------DNGYALSFNALVEGQLLSGSDDHTVALWEVGS----N 219
                                  +   +L++N   E  LLS   +  V +W++      N
Sbjct: 178 TKLFGSHGVIQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHEN 237

Query: 220 STSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA--HNITIDAVKCP 277
                P+ + N      VND+ W   ++ LF   +E + + + D+R     +  +  K  
Sbjct: 238 PIIDLPLVSINS-DGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHD 296

Query: 278 QPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNM-REPLHHMSGHEDAVTNIEFSTHXXXX 336
              N+  F++ +S +LA+A  +  + L+D+RNM + P+  M  H  +V+ +E+S +    
Sbjct: 297 GGVNSCRFNYKNSLILASADSNGRLNLWDIRNMNKSPIATME-HGTSVSTLEWSPNFDTV 355

Query: 337 XXXXXXXNRLI-MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVA 395
                  + L+ +WD                  E I  H GH   VND   +A  PWL+ 
Sbjct: 356 LATAGQEDGLVKLWDT--------------SCEETIFTHGGHMLGVNDISWDAHDPWLMC 401

Query: 396 SSEEENILQVWKCSHNL 412
           S   +N + +WK + NL
Sbjct: 402 SVANDNSVHIWKPAGNL 418

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  116 bits (290), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 100/411 (24%), Positives = 177/411 (43%), Gaps = 55/411 (13%)

Query: 38  EEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE--E 95
           + Y  WK N  L+Y++++     WPSL+ Q  P    + +       +++ + TS +  E
Sbjct: 23  QRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFP----DLDLAGDEHRILLSSFTSSQLPE 78

Query: 96  ENYLKFAEIN----IPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRAR 151
           +  +  A ++    IP   LNN D  E   + D +    PK+ +          +  +AR
Sbjct: 79  DEAIYVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFPAGDCNKAR 138

Query: 152 YMPQNPDFVATLNGQGTVFLYSR-----------SGG---------LQSTLKFHKDNGYA 191
           Y P NPD +++ +  G+V+++ R           SGG         L ++L+  ++    
Sbjct: 139 YCPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEERQNEALN 198

Query: 192 LSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIV------NDIKWHNF 245
           L++N   +G L +      V +W++     + SP  T  D HS ++      NDI W   
Sbjct: 199 LAWNWQQQGLLATCYSGGEVCVWDLAKYDKA-SP--TLIDPHSSLLADPQGSNDISWMVN 255

Query: 246 NEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQ---PFNTLAFSHHSSNLLAAAGMDSHV 302
           ++ L     E + L + D R       +   P      N   F+++   LL +A     +
Sbjct: 256 HDSLLAYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSADSAGRI 315

Query: 303 YLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDLKQIGAEQTPD 361
            L+D+R+   P+  +  H  +V+ ++++ H           + L+ +WDL Q      P 
Sbjct: 316 NLWDIRDFSSPIRSLD-HHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQ------PV 368

Query: 362 DAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNL 412
           D E     L   H GH   VND   +   PW++ S   +N +Q+WK S NL
Sbjct: 369 DQE-----LKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNL 414

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  115 bits (288), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 107/439 (24%), Positives = 189/439 (43%), Gaps = 68/439 (15%)

Query: 24  RAAMETQEKA-LSVD--EEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGF 80
           RA   T+E + +S D  E Y  WK N  L+YD+++     WPSL+ Q+ P    + +   
Sbjct: 4   RAGEATKEASYISADLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTL 59

Query: 81  IRQELIIGTHTSGE--EENYLKFAEINIPKEI----LNNQDPQEEAEEDDKATLNAPKSN 134
               +++ + TS +  E+  +  + I+    I    LNN D  E   + +  T    K  
Sbjct: 60  NEHRILLSSFTSSQKPEDETIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHL 119

Query: 135 IRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHK-------- 186
           +     +    E  RARY+PQNPD +A  +  G ++++ R+    + ++  K        
Sbjct: 120 VDDIRIFFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIK 179

Query: 187 ---------------------DNGYALSFNALVEGQLLSGSDDHTVALWEVG--SNSTSI 223
                                +   +L++N   E  LLS   +  + +W++   S+   I
Sbjct: 180 LLGSHGVIQDVETMDTSLVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPI 239

Query: 224 SPVRTWN-DLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCP---QP 279
             V   + D     VND+ W   ++ LF   +E + + + D+R     + +  C      
Sbjct: 240 IDVPLMSIDSDGSSVNDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKS-NCKIHGGG 298

Query: 280 FNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMRE-PLHHMSGHEDAVTNIEFSTHXXXXXX 338
            N+  F++ +S +LA+A  +  + L+D+RNM E P+  M  H  +V+ +E+S +      
Sbjct: 299 VNSCKFNYKNSLILASADSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLA 357

Query: 339 XXXXXNRLI-MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASS 397
                + L+ +WD  +               E I  H GH   VND   +   PWL+ S 
Sbjct: 358 TAGQEDGLVKLWDTTR--------------EESIFTHGGHMFGVNDISWDVHDPWLMCSV 403

Query: 398 EEENILQVWKCSHNLPIVG 416
             +N + +WK + N  IVG
Sbjct: 404 ANDNSVHIWKPAEN--IVG 420

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  115 bits (287), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 96/424 (22%), Positives = 185/424 (43%), Gaps = 67/424 (15%)

Query: 34  LSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSG 93
           + + E Y  WK N  L+YD+++     WPSL+ Q+ P    + +       +++ + TS 
Sbjct: 17  IDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTLDEHRILLSSFTSS 72

Query: 94  E--EENYLKFAEINIPKEI----LNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEI 147
           +  E+  +  ++I+    I    LNN D  E   + +  T   P   +   + +    + 
Sbjct: 73  QKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPNGDC 132

Query: 148 TRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDN------------------- 188
            RARY+PQNPD +A  +  G ++++ R+    + ++  K++                   
Sbjct: 133 NRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEA 192

Query: 189 ----------GYALSFNALVEGQLLSGSDDHTVALWEVGS----NSTSISPVRTWNDLHS 234
                       +L++N   E  LLS   +  V +W++      N    SP+ +   + S
Sbjct: 193 MDTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVS---IES 249

Query: 235 DI--VNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQP--FNTLAFSHHSS 290
           D   VND+ W   ++ LF   +E +++ + D+R     + + +       N+  F++ +S
Sbjct: 250 DASGVNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNS 309

Query: 291 NLLAAAGMDSHVYLYDLRNMRE-PLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-M 348
            +LA+A  +  + L+D+R M E P+  M  H  +++ +E++ +           + L+ +
Sbjct: 310 LVLASADSNGRLNLWDIRKMNESPITTME-HGASISTLEWNPNFSTVLATAGQQDGLVKL 368

Query: 349 WDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKC 408
           WD  +               E I  H GH   VND   +   PWL+ S   +N + +WK 
Sbjct: 369 WDTAR--------------EETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKP 414

Query: 409 SHNL 412
           + NL
Sbjct: 415 AENL 418

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  114 bits (286), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 103/420 (24%), Positives = 185/420 (44%), Gaps = 67/420 (15%)

Query: 36  VDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE- 94
           + + Y  WK N  L+YD+++     WPSL+ Q+ P    + +       ++I + TS + 
Sbjct: 17  LQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFP----DLDTTSDTHRILISSFTSSQL 72

Query: 95  -EENYLKFAEINIPKEI----LNNQDPQEEAEEDDKATLNAPKSNI--RITAKYVHEEEI 147
            E+  +  ++I+  K +    +NN D  +E E      L  P  ++   +T K+ + +  
Sbjct: 73  PEDEAIHISKISTLKHLNWASVNNFD-MDEMEFKPDTNLKLPSKHLVNDLTIKFPNGD-C 130

Query: 148 TRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKD-------------------- 187
            RARY+PQNPD +A  +  G+V+++ R+    S ++  K+                    
Sbjct: 131 NRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSETVEELHE 190

Query: 188 ---NGYALSFNALVEGQLLSGSDDHTVALWEVG----SNSTSISPVRTWNDLHSDI--VN 238
                 +L++N   EG L S      V +W++     SN     PV    ++  D   VN
Sbjct: 191 NTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVL---NIQFDALGVN 247

Query: 239 DIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQ-----PFNTLAFSHHSSNLL 293
           D+ W   ++ LF    E   L + D R   I  +  +  Q       N+  F++ ++ LL
Sbjct: 248 DVSWMPSHDSLFVACGESDTLALFDQR---IGKEVSRIAQNRHNGGVNSCKFNYQNNMLL 304

Query: 294 AAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDLK 352
           A+A  +  V ++D+RN+ +       H  +++ IE++ +           + L+ +WD+ 
Sbjct: 305 ASADSEGLVNMWDIRNLDQYPIKSINHGSSISTIEWNPNLDTIIATAGQNDGLVKLWDVS 364

Query: 353 QIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNL 412
               E            L+ VH GH   VND   +    WL+ S   +N +Q+WK +HNL
Sbjct: 365 NTDNE------------LLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAHNL 412

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  114 bits (286), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 105/414 (25%), Positives = 186/414 (44%), Gaps = 55/414 (13%)

Query: 36  VDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE- 94
           + + Y  WK N  L+Y++++     WPSL+ Q++P    + +    +  +++ + TS + 
Sbjct: 21  LQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMP----DMDIASDKHRILLSSFTSAQL 76

Query: 95  -EENYLKFAEINIPKEI----LNNQDPQE-EAEEDDKATLNAPKSNIRITAKYVHEE-EI 147
            E+  +  +EI+  K I    LNN   +E E + D++  L+    N+  T K    E + 
Sbjct: 77  PEDEAIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKLS---KNLTETIKIQFPEGDC 133

Query: 148 TRARYMPQNPDFVATLNGQGTVFLYSRSGG-------LQSTLKFHKD----------NGY 190
            RARYMPQNPD +A+ +  G+V+++ R+         L +T K+  +             
Sbjct: 134 NRARYMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNYEAS 193

Query: 191 ALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI----VNDIKWHNFN 246
           +L++N    G L +   D  V +W++ +      P  T  DL   +     N++ W   +
Sbjct: 194 SLAWNYQRSGILAASYSDGDVKIWDI-TKYNKAQPQLTVPDLRWQVDKEGANEVSWMVHH 252

Query: 247 EKLFGTVSEDSLLKINDVRA-HNITIDAVKC-PQPFNTLAFSHHSSNLLAAAGMDSHVYL 304
             +     E + L I D R     +     C     N + F++ +  LL +A  +  + +
Sbjct: 253 SSILAVCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGTLNI 312

Query: 305 YDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDLKQIGAEQTPDDA 363
            D+R +  P+   S H DAV+ I+++             + L+ +WDL Q   E  P   
Sbjct: 313 CDIRQLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQ---EDDP--- 365

Query: 364 EDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGG 417
                 L+ +H GH   VND   N   PW++ S   +N + +WK + N  IV G
Sbjct: 366 ------LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAAN--IVNG 411

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  114 bits (284), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 99/425 (23%), Positives = 189/425 (44%), Gaps = 58/425 (13%)

Query: 25  AAMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQE 84
           A +E       + E Y  WK N  L+Y +++     WPSL+ Q+ P    + +       
Sbjct: 5   APIEPSSIPDDLQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFP----DLDTTTDTHR 60

Query: 85  LIIGTHTSGE--EENYLKFAEINIPKEI----LNNQDPQE-EAEEDDKATLNAPKSNIRI 137
           +++ T TS +  E+  L  A ++    +    LNN D  E E + D+     +   N+ I
Sbjct: 61  ILLSTFTSSQLPEDESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDI 120

Query: 138 TAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRS---------------GGLQSTL 182
           +  + + +   RARY+PQNPD +A  +  G++++++R+                 L ST 
Sbjct: 121 SIPFPNGD-CNRARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTD 179

Query: 183 KF-----HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDL----H 233
           K      + +   ++++N    G L S     ++ +W++   S S   +R  N+L     
Sbjct: 180 KMDENFTNSNEAVSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRE-NELTIPFD 238

Query: 234 SDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAH----NITIDAVKCPQPFNTLAFSHHS 289
            +  N++ W   ++ +F   SE + L + DVR       +T +        N+  F++++
Sbjct: 239 PEGCNEVTWMVNHDSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYN 298

Query: 290 SNLLAAAGMDSHVYLYDLRNM-REPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI- 347
             LLA+A     + ++D+R + +EP+   + H  +++ +E++ +           + L+ 
Sbjct: 299 DMLLASADSTGKINMWDIRKLDKEPIKSFN-HNSSISTLEWNPNLETILVTAGQDDGLVK 357

Query: 348 MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
           +WD                  + I VH GH   VND   +   PWL++S   +N + VWK
Sbjct: 358 IWDTAN--------------GQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWK 403

Query: 408 CSHNL 412
            + NL
Sbjct: 404 PATNL 408

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  114 bits (284), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 111/422 (26%), Positives = 185/422 (43%), Gaps = 68/422 (16%)

Query: 39  EYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE--EE 96
            Y  WK N  L+YD+++     WPSL+ Q+ P    + +       +++ ++TS +  E+
Sbjct: 18  RYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFP----DVDANTDTHRILLSSYTSCQLPED 73

Query: 97  NYLKFAEINIPKEI----LNNQDPQEEAEEDDKATLNAPK---SNIRITAKYVHEEEITR 149
             +  A I+    +    LNN D  E   + D+ T   PK   +N+ IT       +  R
Sbjct: 74  ENVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSIT---FPRGDCNR 130

Query: 150 ARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFH------KDNG-------------- 189
           ARYMPQNPD +A  +  G V++++R+      ++ H      +D G              
Sbjct: 131 ARYMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEA 190

Query: 190 ---------YALSFNALVEGQLLSGSDDHTVALWEV---GSNSTSISPVRTW--NDLHSD 235
                     +L++N   EG L        V +W++     ++T+IS    W  ++  S 
Sbjct: 191 RRTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETE-WECSNFDSR 249

Query: 236 IVNDIKWHNFNEKLFGTVSEDS-LLKINDVRAHNIT--IDAVKCPQPFNTLAFSHHSSNL 292
            VND+ W + ++ +     E S  L + D RA N    I      +  N   F+  ++ L
Sbjct: 250 GVNDVSWMSQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLL 309

Query: 293 LAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWD 350
           LA+        L+D+R +  EP+ H   H  +V+ +E++ H           + LI +WD
Sbjct: 310 LASTDSTGRTNLWDVRKLSAEPIVHFD-HGGSVSTLEWNPHDHSVLATAGQSDGLIKIWD 368

Query: 351 LKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSH 410
                   T  + ED   + I VH+GH   VND   +   PWL+ S   +N + VWK + 
Sbjct: 369 --------TSLEIED---KTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAA 417

Query: 411 NL 412
           NL
Sbjct: 418 NL 419

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  113 bits (283), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 106/413 (25%), Positives = 183/413 (44%), Gaps = 56/413 (13%)

Query: 36  VDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE- 94
           + + Y  WK N  L+YD+++     WPSL+ Q++P    + E    +  L++ + TS + 
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMP----DLEVPTDKHRLLLSSFTSSQL 76

Query: 95  -EENYLKFAEIN----IPKEILNNQDPQE-EAEEDDKATLNAPKSNIRITAKY-VHEEEI 147
            E+  +  +E++    +P   LNN D  E E + D++A L  P  N+  T +      + 
Sbjct: 77  PEDEAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKL--PNKNLVETVRIQFPSGDC 134

Query: 148 TRARYMPQNPDFVATLNGQGTVFLYSRSG---------GLQSTLKFH---------KDNG 189
            RA YMPQNPD +  +   G V ++ R+          G  ++ +            D+ 
Sbjct: 135 NRACYMPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSA 194

Query: 190 YALS--FNALVEGQLLSGSDDHTVALWEV----GSNSTSISP-VRTWNDLHSDIVNDIKW 242
            ALS  +N    G + S   +  + +W++     S  T  +P +R   D      ND+ W
Sbjct: 195 EALSLAWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAG--TNDVSW 252

Query: 243 HNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQP--FNTLAFSHHSSNLLAAAGMDS 300
              +  +     E + + + D RA +        P     N L F++ +  LL AA  + 
Sbjct: 253 MVHHSSILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNG 312

Query: 301 HVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDLKQIGAEQT 359
            + L+D R   +PL  +  H D+V+ ++++ +           + LI +WD       + 
Sbjct: 313 GIALWDCRAFSKPLS-VFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWD-----TSRE 366

Query: 360 PDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNL 412
           P+D+      L+ VH GH   VND   N   PWL+ S   +N + VWK + NL
Sbjct: 367 PEDS------LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  106 bits (264), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 98/417 (23%), Positives = 187/417 (44%), Gaps = 64/417 (15%)

Query: 36  VDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGE- 94
           + + Y  WK N  L+YD+++     WPSL+ Q+      + +       +++   TS + 
Sbjct: 18  LQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFF----HDLDTTSDTHRILLSAFTSSQL 73

Query: 95  -EENYLKFAEINIPKEI----LNNQDPQEEAEEDDKATLNAPKSNIR--ITAKYVHEEEI 147
            E+  +  A+++  K +    +NN D  +E E   +  +  P  N+   I+ ++  + + 
Sbjct: 74  PEDEAIYIAKLSTLKHLEWASINNFD-MDEMEFKPENNIKLPSKNLTNDISIRFP-DGDC 131

Query: 148 TRARYMPQNPDFVATLNGQGTVFLYSRS--GGLQ----STLKFHKDNGY----------- 190
             ARY+PQNPD +A  +  G+++++ R+  G L+      LK ++   Y           
Sbjct: 132 NIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPPKGIENVEN 191

Query: 191 -----ALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRT--WN-DLHSDIVNDIKW 242
                ++S+N   EG L S      + LW++   S S   + T   N D  +  VND+ W
Sbjct: 192 TNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDALGVNDVNW 251

Query: 243 HNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPF-----NTLAFSHHSSNLLAAAG 297
           H  ++ +     E +++ + D R   +  + ++  +       N+  F+ H  +LL +  
Sbjct: 252 HPSHDSILAASGESNIIGLFDNR---LGTEILRSNEKMHNGGINSCKFNSHCDSLLISGD 308

Query: 298 MDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI-MWDLKQIG 355
            +  + L+DLR +  EP+  +  H  +++ +E++ +           + L+ +WD+    
Sbjct: 309 SEGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPNLETIVASAGQDDGLVKLWDV---- 363

Query: 356 AEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNL 412
                        EL+  H GH   VND   N    WL+ S   +N +QVWK +HNL
Sbjct: 364 ----------STDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPAHNL 410

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 94/410 (22%), Positives = 171/410 (41%), Gaps = 67/410 (16%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELII-GTHTSGEEENYLK-FAEIN 105
           P +Y+ +    + WP L++  +P  +      + +  L+   T +S ++EN L   A  N
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 106 IPKEILNNQDPQEEAE-----------EDDKATLNAPKSNIRITAKYVHEEEITRARYMP 154
           + K +L + + +++ E           E++   L    + ++++   V  +E+  A  M 
Sbjct: 174 LTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNRLKVSPFAVSNQEVLTAT-MS 232

Query: 155 QNPD-FVATLNGQGTVFLYSRSGGLQ---------STLKFHKD-NGYALSFNALVE-GQL 202
           +N D ++  L  Q   F    + G Q          T+K H +  GY L ++ L++ G L
Sbjct: 233 ENGDVYIYDLAAQSKAF---STPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGAL 289

Query: 203 LSGSDDHTVAL-------WEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSE 255
           LSG     + L       W     S ++S        +++ + DI+W      +F T + 
Sbjct: 290 LSGDCSGQIYLTQRHTSRWVTDKQSFTVS--------NNESIEDIQWSRTESTVFATAAC 341

Query: 256 DSLLKINDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-- 311
           D  ++I D R+  H   I         N +++S     LLA+   +    ++DLR     
Sbjct: 342 DGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPS 401

Query: 312 -----EPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL---------KQIGAE 357
                +P+     H+ A+T+I F+             N + +WDL         KQ  AE
Sbjct: 402 NADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAE 461

Query: 358 QTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
               + +D  P+L+ VH   +  V D   + QIP  + S+  +  L VWK
Sbjct: 462 TK--ELQDIPPQLLFVH--WQREVKDVKWHKQIPGCLVSTGTDG-LNVWK 506

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 88/405 (21%), Positives = 161/405 (39%), Gaps = 56/405 (13%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELII-GTHTSGEEENYLKFAEINI 106
           P +YD +    + WP L++  +P  +      + +  L+   T  S ++EN L    ++ 
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 107 PKEILNNQDPQEEAE-------------EDDKATLNAPKSNIRITAKYVHEEEITRARYM 153
             + L   D +  ++             E++  +L    + +R++      +E+  A   
Sbjct: 179 LAKTLVKDDDEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNKEVLTATMS 238

Query: 154 PQNPDFVATLNGQGTVFLYSRSGGLQS---------TLKFHKD-NGYALSFNALVE-GQL 202
                ++  L  Q   F    S G Q          T+K H +  GYAL ++ L++ G L
Sbjct: 239 ENGEVYIFDLGPQSKAF---SSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLIKTGAL 295

Query: 203 LSGSDDHTVALWEVGSNS--TSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
           L+G     + L +  ++   T   P    N+     V DI+W      +F +   D  ++
Sbjct: 296 LTGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKS---VEDIQWSRTEATVFASCGCDGYVR 352

Query: 261 INDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR-------NMR 311
           I D R+  H   +         N ++++     LLA+   +    ++DLR       N  
Sbjct: 353 IWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNINNV 412

Query: 312 EPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDD 362
           +P+     H+ A+T+I F+             N + +WDL         KQ  AE    +
Sbjct: 413 QPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETK--E 470

Query: 363 AEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
            E   P+L+ VH   +  V D   + QIP  + S+  +  L +WK
Sbjct: 471 LESIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 512

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 80/395 (20%), Positives = 165/395 (41%), Gaps = 39/395 (9%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI-IGTHTSGEEENYLKFAEI-N 105
           P +Y+ +    + WP LS+  +P  +      + +  L+   T  S ++EN L    + N
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQASKKKENELMVLSLSN 178

Query: 106 IPKEILNNQDPQ---------EEAEEDDKATLNAPKSNIRITAKYVHEEEITRARYMPQN 156
           + K +L +++ +         E   E++   L    + I+++      +E+  A      
Sbjct: 179 LTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPFASQSQEVLTATMSENG 238

Query: 157 PDFVATLNGQGTVF------LYSRSGGLQSTLKFHKD-NGYALSFNALVE-GQLLSGSDD 208
             ++  +  Q   F      +  +S     T++ H +  GY L ++ L++ G LLSG   
Sbjct: 239 EVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSGDCS 298

Query: 209 HTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-- 266
             + L +  + S  ++  + ++  ++  + DI+W      +F T   D  +++ D R+  
Sbjct: 299 GQIYLTQRHT-SKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTRSKK 357

Query: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-------EPLHHMSG 319
           H   I         N ++++     LLA+   +    ++DLR          +P+   + 
Sbjct: 358 HKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYNF 417

Query: 320 HEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIG-----AEQTPDDAE--DGVPELIM 372
           H+ A+T+I F+             N + +WDL          +QT +  E  +  P+L+ 
Sbjct: 418 HKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLLF 477

Query: 373 VHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
           VH   +  + D   + QIP  + S+  +  L +WK
Sbjct: 478 VH--WQKEIKDVKWHKQIPGCLVSTGTDG-LNIWK 509

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 92/405 (22%), Positives = 167/405 (41%), Gaps = 57/405 (14%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELII-GTHTSGEEENYLK-FAEIN 105
           P +Y+ +    + WP L++  +P  +      + +  L+   T +S ++EN L   A  N
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 106 IPKEILNNQDPQEEAE-----------EDDKATLNAPKSNIRITAKYVHEEEITRARYMP 154
           + K +L + +  E+ E           E++   L    + ++++   +  +E+  A  M 
Sbjct: 175 LAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTAT-MS 233

Query: 155 QNPD-FVATLNGQGTVFLYSRSGGLQ---------STLKFHKD-NGYALSFNALVE-GQL 202
           +N D ++  L  Q   F    + G Q          T+K H +  GY L ++ L++ G L
Sbjct: 234 ENGDVYIYNLAPQSKAF---STPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGAL 290

Query: 203 LSGSDDHTVALWEVGSNS--TSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
           LSG     +   +  ++   T   P    N+     + DI+W      +F T   D  ++
Sbjct: 291 LSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKS---IEDIQWSRTESTVFATAGCDGYIR 347

Query: 261 INDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR------- 311
           I D R+  H   I         N +++S     LLA+   +    ++DLR          
Sbjct: 348 IWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAV 407

Query: 312 EPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDD 362
           +P+     H+ A+T+I F+             N + +WDL         KQ  AE    +
Sbjct: 408 QPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETK--E 465

Query: 363 AEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
            ++  P+L+ VH   +  V D   + QIP  + S+  +  L VWK
Sbjct: 466 LQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 507

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 56/141 (39%), Gaps = 15/141 (10%)

Query: 278 QPFNT--------LAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIE 328
           QPF          + +S   S + A AG D ++ ++D R+ + +P   +      V  I 
Sbjct: 314 QPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVIS 373

Query: 329 FSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNA 388
           +S                 +WDL+Q     TP +A+   P  +  +  H+ ++     N 
Sbjct: 374 WSDKIGYLLASGDDNGTWGVWDLRQF----TPSNADAVQP--VAQYDFHKGAITSIAFNP 427

Query: 389 QIPWLVASSEEENILQVWKCS 409
               +VA   E+N + +W  S
Sbjct: 428 LDESIVAVGSEDNTVTLWDLS 448

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 90/405 (22%), Positives = 161/405 (39%), Gaps = 56/405 (13%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELII-GTHTSGEEENYLKFAEIN- 105
           P +Y+ +    L WP L++  +P  +      + +  L+   T  S +++N L   +++ 
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLSH 178

Query: 106 IPKEILNNQDPQ-------------EEAEEDDKATLNAPKSNIRITAKYVHEEEITRARY 152
           + K ++ + D               E   E++   L    + +RI+     ++EI  +  
Sbjct: 179 LTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEILTSTM 238

Query: 153 MPQNPDFVATLNGQGTVFLYSRSGGLQ---------STLKFHKD-NGYALSFNALVE-GQ 201
                 F+  L  Q   F    + G Q          T++ H +  GY L ++ L++ G 
Sbjct: 239 SENGEVFIYDLTPQTRAF---ETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGA 295

Query: 202 LLSGSDDHTVALWEVGSNS--TSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLL 259
           LL+G     V L +  ++   T  +P    N+     + DI+W      +F T   D  +
Sbjct: 296 LLTGDCSGMVYLTQRHTSKWVTDKTPFTVGNNKS---IEDIQWSRTESTVFATAGCDGYI 352

Query: 260 KINDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMRE----- 312
           +I D R+  H   I  V      N ++++     LLA+        ++DLR         
Sbjct: 353 RIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNSEKA 412

Query: 313 -PLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDD 362
            P+     H+ A+T+I F+             N + +WDL         KQ  AE    +
Sbjct: 413 LPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEI--KE 470

Query: 363 AEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
            E   P+L+ VH   +  V D   + QIP  + S+  +  L VWK
Sbjct: 471 LEQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/128 (19%), Positives = 53/128 (41%), Gaps = 8/128 (6%)

Query: 283 LAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIEFSTHXXXXXXXXX 341
           + +S   S + A AG D ++ ++D R+ + +P+         V  I ++           
Sbjct: 333 IQWSRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGD 392

Query: 342 XXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEEN 401
                 +WDL+Q        ++E  +P  +  +  H+ ++     N     +VA + E+N
Sbjct: 393 DKGTWGIWDLRQFSP-----NSEKALP--VAQYDFHKGAITSISFNPLDESIVAVASEDN 445

Query: 402 ILQVWKCS 409
            + +W  S
Sbjct: 446 TVTLWDLS 453

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 91/401 (22%), Positives = 166/401 (41%), Gaps = 50/401 (12%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI-IGTHTSGEEENYLK-FAEIN 105
           P +Y+ +    + WP L++  +P  +      + +  L+   T +S + EN L   A  N
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLALSN 173

Query: 106 IPKEILNNQDPQEEAE----------EDDKATLNAPKSNIRITAKYVHEEEITRARYMPQ 155
           + K +L + + +++ E          E++   L    + ++++      +E+  A  M +
Sbjct: 174 LTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEVLTAT-MSE 232

Query: 156 NPD-FVATLNGQGTVFL---YSRSGGLQS---TLKFHKD-NGYALSFNALVE-GQLLSGS 206
           N D ++  L  Q   F    Y  S   +    T+K H +  GY L ++ L++ G LLSG 
Sbjct: 233 NGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKTGALLSGD 292

Query: 207 DDHTVALWEVGSNS--TSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDV 264
               +   +  ++   T   P    N+     + DI+W      +F T   D  ++I D 
Sbjct: 293 CSGQIYFTQRHTSRWVTDKQPFTVSNNKS---IEDIQWSRTESTVFATAGCDGYIRIWDT 349

Query: 265 RA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-------EPLH 315
           R+  H   I         N +++S     LLA+   +    ++DLR          +P+ 
Sbjct: 350 RSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVA 409

Query: 316 HMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAEDG 366
               H+ A+T+I F+             N + +WDL         KQ  AE    + ++ 
Sbjct: 410 QYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETK--ELQEI 467

Query: 367 VPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
            P+L+ VH   +  V D   + QIP  + S+  +  L VWK
Sbjct: 468 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 56/141 (39%), Gaps = 15/141 (10%)

Query: 278 QPFNT--------LAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIE 328
           QPF          + +S   S + A AG D ++ ++D R+ + +P   +      V  I 
Sbjct: 312 QPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVIS 371

Query: 329 FSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNA 388
           +S                 +WDL+Q     TP +A+   P  +  +  H+ ++     N 
Sbjct: 372 WSDKIGYLLASGDDNGTWGVWDLRQF----TPSNADTVQP--VAQYDFHKGAITSIAFNP 425

Query: 389 QIPWLVASSEEENILQVWKCS 409
               +VA   E+N + +W  S
Sbjct: 426 LDESIVAVGSEDNTVTLWDLS 446

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 94/404 (23%), Positives = 169/404 (41%), Gaps = 56/404 (13%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELII-GTHTSGEEENYLK-FAEIN 105
           P +Y+ +    + WP L++  +P  +      + +  L+   T +S ++EN L   A  N
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 106 IPKEILNNQDPQEEAEE----------DDKATLNAPKSNIRITAKYVHEEEITRARYMPQ 155
           + K +L +++ +E+ EE          ++   L    + ++++   V  +E+  A  M +
Sbjct: 174 LTKTLLKDENEEEDEEEDDDDIDPIIENENIPLRDTTNRLKVSPFAVSNQEVLTAT-MSE 232

Query: 156 NPD-FVATLNGQGTVFLYSRSGGLQ---------STLKFHKD-NGYALSFNALVE-GQLL 203
           N D ++  L  Q   F    + G Q          T+K H +  GY L ++ L++ G LL
Sbjct: 233 NGDVYIYDLAPQSKAFA---TPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGSLL 289

Query: 204 SGSDDHTVALWEVGSNS--TSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
           SG     V   +  ++   T   P    N+     + DI+W      +F T   D  ++I
Sbjct: 290 SGDCSGQVYFTQRHTSRWVTDKQPFTVSNNKS---IEDIQWSRSESTVFATAGCDGYIRI 346

Query: 262 NDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-------E 312
            D R+  H   I         N +++S     LLA+   +    ++DLR          +
Sbjct: 347 WDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADSVQ 406

Query: 313 PLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDA 363
           P+     H+ A+T+I F+             N + +WDL         KQ  AE    + 
Sbjct: 407 PVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETK--EL 464

Query: 364 EDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
           ++  P+L+ VH   +  V D   + QIP  + S+  +  L VWK
Sbjct: 465 QEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 56/141 (39%), Gaps = 15/141 (10%)

Query: 278 QPFNT--------LAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIE 328
           QPF          + +S   S + A AG D ++ ++D R+ + +P   +      V  I 
Sbjct: 312 QPFTVSNNKSIEDIQWSRSESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVIS 371

Query: 329 FSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNA 388
           +S                 +WDL+Q     TP +A+   P  +  +  H+ ++     N 
Sbjct: 372 WSDKIGYLLASGDDNGTWGVWDLRQF----TPSNADSVQP--VAQYDFHKGAITSIAFNP 425

Query: 389 QIPWLVASSEEENILQVWKCS 409
               +VA   E+N + +W  S
Sbjct: 426 LDESIVAVGSEDNTVTLWDLS 446

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 87/405 (21%), Positives = 169/405 (41%), Gaps = 57/405 (14%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI-IGTHTSGEEEN---YLKFAE 103
           P +Y+ +    + WP L++  +P  +      + +  L+   T  S ++EN    LK ++
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATATQASKKKENELMVLKLSQ 177

Query: 104 INIPKEILNNQDPQEEAE------------EDDKATLNAPKSNIRITAKYVHEEEITRAR 151
           +N  K ++ +   +EE +            E+++ +L    + ++I+  +   +E+  A 
Sbjct: 178 LN--KTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISP-FASSQEVLTAT 234

Query: 152 YMPQNPDFVATLNGQGTVFLYSRSGGLQ---------STLKFHKD-NGYALSFNALVE-G 200
                  ++  L  Q   F    + G Q          T++ H +  GY L ++ L++ G
Sbjct: 235 MSENGEVYIHDLGPQTKAF---ETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTG 291

Query: 201 QLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
            LL+G     V L +  + S  ++  + +   ++  + DI+W      +F T   D  ++
Sbjct: 292 ALLTGDCSGQVYLTQRHT-SKWVTDKQPFTFSNNKSIEDIQWSRTESTVFATSGCDGYIR 350

Query: 261 INDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR------- 311
           I D R+  H   I         N ++++     LLA+   D    ++DLR +        
Sbjct: 351 IWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSPNNSENV 410

Query: 312 EPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDD 362
           +P+     H+ A+T+I F+             N + +WDL         KQ  AE    +
Sbjct: 411 QPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETK--E 468

Query: 363 AEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
            +   P+L+ VH   +  V D   + QIP  + S+  +  L VWK
Sbjct: 469 LQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWK 510

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 25/128 (19%), Positives = 57/128 (44%), Gaps = 7/128 (5%)

Query: 283 LAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIEFSTHXXXXXXXXX 341
           + +S   S + A +G D ++ ++D R+ + +P          V  I ++           
Sbjct: 330 IQWSRTESTVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGD 389

Query: 342 XXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEEN 401
              R  +WDL+Q+    +P+++E+  P  +  +  H+ ++     N     ++A + E+N
Sbjct: 390 DDGRWGVWDLRQL----SPNNSENVQP--VAQYDFHKGAITSISFNPLDESIIAVASEDN 443

Query: 402 ILQVWKCS 409
            + +W  S
Sbjct: 444 TVTLWDLS 451

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 119/286 (41%), Gaps = 43/286 (15%)

Query: 159 FVATLNGQGTVFLYSRSGGLQS-----------------TLKFHKD-NGYALSFNALVE- 199
             AT++  G V+++  +  +++                 T+K H +  GYAL ++ L++ 
Sbjct: 237 LTATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKT 296

Query: 200 GQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLL 259
           G LL+G     V L +  + S  IS    +   ++  V DI+W      +F +   D  +
Sbjct: 297 GALLTGDCSGQVYLTQRHT-SKWISDKEPFTVANNQSVEDIQWSRTESTVFASCGCDGYI 355

Query: 260 KINDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR-------NM 310
           ++ D R+  H   I         N +++S     LLA+   +    ++DLR       N 
Sbjct: 356 RVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFSPSNSNN 415

Query: 311 REPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPD 361
             P+     H+ A+T+I F+             N + +WDL         KQ  AE    
Sbjct: 416 TSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAET--K 473

Query: 362 DAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
           + +   P+L+ VH   +  V D   + QIP  + S+  +  L +WK
Sbjct: 474 ELQQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNIWK 516

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 26/133 (19%), Positives = 55/133 (41%), Gaps = 7/133 (5%)

Query: 278 QPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIEFSTHXXXX 336
           Q    + +S   S + A+ G D ++ ++D R+ + +P   +      V  I +S      
Sbjct: 331 QSVEDIQWSRTESTVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYL 390

Query: 337 XXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVAS 396
                      +WDL+Q     +P ++ +  P  +  +  H+ ++     N     +VA 
Sbjct: 391 LASGDDNGTWGVWDLRQF----SPSNSNNTSP--VAQYDFHKGAITSISFNPLDESIVAV 444

Query: 397 SEEENILQVWKCS 409
           + E+N + +W  S
Sbjct: 445 ASEDNTVTLWDLS 457

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 107/253 (42%), Gaps = 35/253 (13%)

Query: 179 QSTLKFHKD-NGYALSFNALVE-GQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI 236
           Q T+K H +  GY L ++ L++ G LL+G     V L +  S S  I+  + +   ++  
Sbjct: 276 QYTIKNHGNVEGYGLDWSPLIKTGALLTGDCSGRVFLTQRTS-SKWITDKQPFTVDNNKS 334

Query: 237 VNDIKWHNFNEKLFGTVSEDSLLKINDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLA 294
           + DIKW      +F T   D  ++I D+R+  H   +         N ++++   S LLA
Sbjct: 335 IEDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLA 394

Query: 295 AAGMDSHVYLYDLRNMR------EPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIM 348
               +    ++DLR          P+     H+ A+T+I F+             N + +
Sbjct: 395 TGDDNGTWGVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTL 454

Query: 349 WDL---------KQIGAE-----QTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLV 394
           WDL         KQ  AE     Q P       P+L+ VH   +  V D   + QIP  +
Sbjct: 455 WDLSVEADDEEIKQQAAEVKELQQIP-------PQLLFVH--WQKEVKDVKWHKQIPGCL 505

Query: 395 ASSEEENILQVWK 407
            S+  +  L VWK
Sbjct: 506 VSTGTDG-LNVWK 517

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/141 (18%), Positives = 56/141 (39%), Gaps = 16/141 (11%)

Query: 278 QPFNT--------LAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIE 328
           QPF          + +S   + + A  G+D HV ++D+R+ + +P   +   +  V  + 
Sbjct: 325 QPFTVDNNKSIEDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMS 384

Query: 329 FSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNA 388
           ++                 +WDL+Q   +Q       G    +  +  H+ ++     N 
Sbjct: 385 WNQKISYLLATGDDNGTWGVWDLRQFSNQQ-------GGVSPVAQYDFHKGAITSISFNP 437

Query: 389 QIPWLVASSEEENILQVWKCS 409
               ++A + E+N + +W  S
Sbjct: 438 LDESIIAVASEDNTVTLWDLS 458

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 174 RSGGLQSTLK--FHKDNGYALSFNALVEGQLLSGSDDHTVALWEV 216
           + GG+    +  FHK    ++SFN L E  +   S+D+TV LW++
Sbjct: 413 QQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDL 457

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 86/403 (21%), Positives = 165/403 (40%), Gaps = 50/403 (12%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHT--SGEEENYLKFAEI- 104
           P +Y+ +    + WP +++  +P  +      +  Q L++ T T  S ++EN L    + 
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNY-PQSLLMATATQASRKKENELMVLSLS 170

Query: 105 NIPKEILNNQDPQEEAE--------------EDDKATLNAPKSNIRITAKYVHEEEITRA 150
           N+ K ++ + + +EE +              E++   L    + ++I+     +EE+  A
Sbjct: 171 NLVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEVLAA 230

Query: 151 RYMPQNPDFVATLNGQGTVFL---YSRSGGLQS---TLKFHKD-NGYALSFNALVE-GQL 202
                   ++  L  Q   F    Y      +    T+K H +  GYAL ++ L + G L
Sbjct: 231 TMSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKTGAL 290

Query: 203 LSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIN 262
           L+G     +   +  + S  I+  + +   ++  + DI+W      +F +   D  ++I 
Sbjct: 291 LTGDCSGQIYFTQRHT-SKWITDKQPFTVANNQSIEDIQWSRTESTVFASAGCDGYIRIW 349

Query: 263 DVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-------EP 313
           D R+  H   I         N +++S     LLA+   +    ++DLR          +P
Sbjct: 350 DTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENAGSVQP 409

Query: 314 LHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAE 364
           +     H+ A+T+I F+             N + +WDL         KQ  AE    + +
Sbjct: 410 VAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETK--ELQ 467

Query: 365 DGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
              P+L+ VH   +  V D   + QIP  + S+  +  L +WK
Sbjct: 468 QIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 507

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/133 (20%), Positives = 56/133 (42%), Gaps = 7/133 (5%)

Query: 278 QPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIEFSTHXXXX 336
           Q    + +S   S + A+AG D ++ ++D R+ + +P   +      V  I +S      
Sbjct: 322 QSIEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYL 381

Query: 337 XXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVAS 396
                      +WDL+Q     +P++A  G  + +  +  H+ ++     N     ++A 
Sbjct: 382 LASGDDNGTWGVWDLRQF----SPENA--GSVQPVAQYDFHKGAITSISFNPLDESIIAV 435

Query: 397 SEEENILQVWKCS 409
             E+N + +W  S
Sbjct: 436 GSEDNTVTLWDLS 448

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 83/403 (20%), Positives = 163/403 (40%), Gaps = 52/403 (12%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELII-GTHTSGEEENYLKFAEINI 106
           P +Y+ +    L WP +++  +P  +      + +  L+   T  S ++EN L    ++ 
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTTATQASKKKENELMVLSLSQ 179

Query: 107 PKEILNNQDPQEEAE-------------EDDKATLNAPKSNIRITAKYVHEEEITRARYM 153
             + L   +  E+ +             E++   LN   + ++++     ++E+  A   
Sbjct: 180 LNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLNDTTNRLKVSPFASTDKEVLTATMS 239

Query: 154 PQNPDFVATLNGQGTVFLYSRSGGLQ---------STLKFHKD-NGYALSFNALVE-GQL 202
                ++  L  Q   F    + G Q          T++ H +  GYAL ++ +++ G L
Sbjct: 240 ENGEVYIFDLAPQSKAF---STPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKNGAL 296

Query: 203 LSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIN 262
           L+G     +   +  + S  I+  + +   ++  V DI+W      +F +   D  ++I 
Sbjct: 297 LTGDCSGQIYFTQRHT-SKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIW 355

Query: 263 DVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR-------NMREP 313
           D R+  H   +         N +++S     LLA+   +    ++DLR       N  +P
Sbjct: 356 DTRSKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVWDLRQFSPDNINDVQP 415

Query: 314 LHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAE 364
           +     H+ A+T+I F+             N + +WDL         KQ  AE    + E
Sbjct: 416 VAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETK--ELE 473

Query: 365 DGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
              P+L+ VH   +  V D   + QIP  + S+  +  L +WK
Sbjct: 474 KIPPQLLFVH--WQKDVKDVKWHKQIPGCLVSTGTDG-LNIWK 513

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 59/141 (41%), Gaps = 15/141 (10%)

Query: 278 QPFNT--------LAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIE 328
           QPF          + +S   S + A+AG D ++ ++D R+ + +P   +      V  I 
Sbjct: 320 QPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVIS 379

Query: 329 FSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNA 388
           +S                 +WDL+Q     +PD+  D  P  +  +  H+ ++   + N 
Sbjct: 380 WSEKIGYLLASGDDNGLWGVWDLRQF----SPDNINDVQP--VAQYDFHKGAITSINFNP 433

Query: 389 QIPWLVASSEEENILQVWKCS 409
               ++A + E+N + +W  S
Sbjct: 434 LDDSIIAVASEDNTVTLWDLS 454

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 100/238 (42%), Gaps = 25/238 (10%)

Query: 189 GYALSFNALVE-GQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNE 247
           GYA  ++ +++ G +LSG     V L +  + S  I+  + +   ++  + D++W     
Sbjct: 288 GYANDWSPIIKTGAMLSGDCSGQVFLTQRHT-SKWITDKQAFTVANNKSIEDLQWSRTES 346

Query: 248 KLFGTVSEDSLLKINDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLY 305
            +F +   D  ++I D R+  H   I         N +++S     LLA+   D    ++
Sbjct: 347 TVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVW 406

Query: 306 DLRNMR-------EPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL------- 351
           DLR           P+     H+ A+T+I F+             N + +WDL       
Sbjct: 407 DLRQFTPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDE 466

Query: 352 --KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
             KQ  AE    + +   P+L+ VH   +  V D   + QIP  + S+  +  L VWK
Sbjct: 467 EIKQQAAETK--ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 519

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 54/128 (42%), Gaps = 7/128 (5%)

Query: 283 LAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIEFSTHXXXXXXXXX 341
           L +S   S + A+ G+D ++ ++D R+ + +P   +      V  I +S           
Sbjct: 339 LQWSRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGD 398

Query: 342 XXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEEN 401
                 +WDL+Q     TP +A    P  +  +  H+ ++     N     ++A + E+N
Sbjct: 399 DDGTWGVWDLRQF----TPQNASTASP--VAQYQFHKGAITSISFNPLDESIIAVASEDN 452

Query: 402 ILQVWKCS 409
            + +W  S
Sbjct: 453 TVTLWDLS 460

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 183 KFHKDNGYALSFNALVEGQLLSGSDDHTVALWEV 216
           +FHK    ++SFN L E  +   S+D+TV LW++
Sbjct: 426 QFHKGAITSISFNPLDESIIAVASEDNTVTLWDL 459

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 87/401 (21%), Positives = 169/401 (42%), Gaps = 50/401 (12%)

Query: 50  MYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELII-GTHTSGEEENYLKFAEINIPK 108
           +Y+ +    L+WP +S+  +P  +      + +  L+   T  S +++N L   +++   
Sbjct: 129 VYEMLHNVNLSWPCMSLDIIPDSLGNERRNYPQSILLTTATQASKKKDNELMILQLSQLT 188

Query: 109 EILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRARYMPQNPD-----FVATL 163
           + L  +D  +  +EDD+   +     I   A     +   R +  P   +       AT+
Sbjct: 189 KTLLKEDDDDNDDEDDEDDEDRESDPILEDANVALRDTTNRLKVTPFATNNNQEILTATM 248

Query: 164 NGQGTVFLYSRSGGLQS-----------------TLKFHKD-NGYALSFNALVE-GQLLS 204
           +  G V+++     ++S                 T++ H +  G+ L ++ L++ G LL+
Sbjct: 249 SENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKSGALLT 308

Query: 205 GSDDHTVALWEVGSNSTS--ISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIN 262
           G     + L    S  TS  I+  ++++  ++  + DI+W    + +F T   D  ++I 
Sbjct: 309 GDCSGEIFL---TSRHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRIW 365

Query: 263 DVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVY-LYDLRNMR------EP 313
           D R+  H   I         N ++++     LL A+G D  V+ ++DLR          P
Sbjct: 366 DTRSKKHKPAISTRASNVDVNVISWNEKMEYLL-ASGDDKGVWGVWDLRQFSPSQENASP 424

Query: 314 LHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIG-----AEQTPD--DAEDG 366
           +     H+ A+T+I F+             N + +WDL          +QT +  + E  
Sbjct: 425 VAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQTHETKELEQI 484

Query: 367 VPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
            P+L+ VH   +  V D   + QIP  + S+  +  L VWK
Sbjct: 485 PPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWK 522

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 90/414 (21%), Positives = 166/414 (40%), Gaps = 75/414 (18%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELII-GTHTSGEEENYLKFAEINI 106
           P +Y+ +    L WP LS+  +P  +      + +  L+   T  S +++N L   +++ 
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 186

Query: 107 PKEIL---------------NNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRAR 151
             + L                +QDP  E E       N P   +R T        +  + 
Sbjct: 187 LTKTLVKEDEDDDEEDDDEDEDQDPIVENE-------NIP---LRDTTN-----RLKVSP 231

Query: 152 YMPQNPD-FVATLNGQGTVFLYS--------RSGGLQ---------STLKFHKD-NGYAL 192
           +  ++P+   A+++  G V+++          + G Q          T+K H +  GYAL
Sbjct: 232 FASESPEKLTASMSENGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYAL 291

Query: 193 SFNALVE-GQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFG 251
            ++ L + G LL+G     V L +  + S  I+    ++  ++  + DI++      +F 
Sbjct: 292 DWSPLNKSGSLLTGDCSGRVYLTQRHT-SKWITDKTAFSAGNNQSIEDIQFSRTEATVFA 350

Query: 252 TVSEDSLLKINDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRN 309
           T   D  ++I D R+  H   I         N ++++     LLA+   +    ++DLR 
Sbjct: 351 TCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQ 410

Query: 310 MR-------EPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL---------KQ 353
                     P+   S H+ A+T+I F+             N + +WDL         KQ
Sbjct: 411 FSPNNAASVSPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQ 470

Query: 354 IGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
             AE    + +   P+L+ VH   +  V D   + QIP  + S+  +  L +WK
Sbjct: 471 QAAETK--ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 519

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/133 (18%), Positives = 55/133 (41%), Gaps = 7/133 (5%)

Query: 278 QPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIEFSTHXXXX 336
           Q    + FS   + + A  G D ++ ++D R+ + +P   +      V  I ++      
Sbjct: 334 QSIEDIQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYL 393

Query: 337 XXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVAS 396
                      +WDL+Q     +P++A    P  +  ++ H+ ++     N     ++A 
Sbjct: 394 LASGDDNGTWGVWDLRQF----SPNNAASVSP--VAQYSFHKGAITSIAFNPLDDSIIAV 447

Query: 397 SEEENILQVWKCS 409
           + E+N + +W  S
Sbjct: 448 ASEDNTVTLWDLS 460

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 102/253 (40%), Gaps = 39/253 (15%)

Query: 181 TLKFHKD-NGYALSFNALVE-GQLLSGSDDHTVALWEVGSNS--TSISPVRTWNDLHSDI 236
           T++ H +  GYAL ++ L+  G LL+G     V   +  ++   T   P    N+     
Sbjct: 272 TIRNHGNVEGYALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKS--- 328

Query: 237 VNDIKWHNFNEKLFGTVSEDSLLKINDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLA 294
           + DI+W      +F T   D  +++ D R+  H   I         N ++++     LLA
Sbjct: 329 IEDIQWSRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLA 388

Query: 295 AAGMDSHVYLYDLRNMR------EPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIM 348
           +   +    ++DLR         +P+     H+ A+T+I F              N + +
Sbjct: 389 SGDDNGTWGVWDLRQFSPSNENAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTL 448

Query: 349 WDL---------KQIGAE-----QTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLV 394
           WDL         KQ  AE     Q P       P+L+ VH   +  V D   + QIP  +
Sbjct: 449 WDLSVEADDEEIKQQTAETKELAQIP-------PQLLFVH--WQKEVKDVKWHKQIPGCL 499

Query: 395 ASSEEENILQVWK 407
            S+  +  L +WK
Sbjct: 500 VSTGTDG-LNIWK 511

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 108/251 (43%), Gaps = 32/251 (12%)

Query: 181 TLKFHKD-NGYALSFNALVE-GQLLSGSDDHTVALWEVGSNS--TSISPVRTWNDLHSDI 236
           T+K H +  GYAL ++  ++ G LL+G     +   +  ++   T   P    N+     
Sbjct: 268 TIKSHGNVEGYALDWSPSIQTGALLTGDCSGQIYFTQRHTSKWVTDKQPFTVSNNKS--- 324

Query: 237 VNDIKWHNFNEKLFGTVSEDSLLKINDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLA 294
           + DI+W      +F +   D  ++I D R+  H   I         N +++S     LLA
Sbjct: 325 IEDIQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLA 384

Query: 295 AAGMDSHVY-LYDLR-------NMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRL 346
           + G D+ V+ ++DLR       N  +P+     H+ A+T+I F+             N +
Sbjct: 385 S-GDDNGVWGVWDLRQFSPDTANSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTV 443

Query: 347 IMWDL---------KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASS 397
            +WDL         KQ  AE    + +   P+L+ VH   +  V D   + QIP  + S+
Sbjct: 444 TLWDLSVEADDEEIKQQAAETK--ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGALVST 499

Query: 398 EEENILQVWKC 408
             +  L +WK 
Sbjct: 500 GTDG-LNIWKT 509

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 56/141 (39%), Gaps = 15/141 (10%)

Query: 278 QPFNT--------LAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIE 328
           QPF          + +S     + A+AG D ++ ++D R+ + +P   +      V  I 
Sbjct: 315 QPFTVSNNKSIEDIQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVIS 374

Query: 329 FSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNA 388
           +S                 +WDL+Q     +PD A    P  +  +  H+ ++     N 
Sbjct: 375 WSDKLGYLLASGDDNGVWGVWDLRQF----SPDTANSVQP--VAQYDFHKGAITSISFNP 428

Query: 389 QIPWLVASSEEENILQVWKCS 409
               +VA + E+N + +W  S
Sbjct: 429 LDESIVAVASEDNTVTLWDLS 449

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 77/402 (19%), Positives = 159/402 (39%), Gaps = 49/402 (12%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELII-GTHTSGEEENYLKFAEIN- 105
           P +Y+ +    + WP +++  +P  +      + +  L+   T  + +++N L   +++ 
Sbjct: 118 PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQATRKKDNELMVLKLSQ 177

Query: 106 IPKEILNNQDPQEEAE-------------EDDKATLNAPKSNIRITAKYVHEEEITRARY 152
           + K ++ +   + + +             E++   L    + ++++    H +E+  A  
Sbjct: 178 LSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKDTTNRLKVSPFATHGQEVLTATM 237

Query: 153 MPQNPDFVATLNGQGTVF------LYSRSGGLQSTLKFHKD-NGYALSFNALVE-GQLLS 204
                 +V  L  Q   F      +   S     T++ H +  GY L ++ L++ G LL+
Sbjct: 238 CENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIKTGALLT 297

Query: 205 GSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDV 264
           G     + L +  + S  I+  + +   ++  V DI+W      +F T   D  ++I D 
Sbjct: 298 GDCSGQIFLTQRHT-SKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRIWDT 356

Query: 265 RA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-------EPLH 315
           R+  H   I         N ++++     LLA+   +    ++DLR          +P+ 
Sbjct: 357 RSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFSPANSEGVQPVA 416

Query: 316 HMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGV-------- 367
               H   +T+I F+             N + +WDL     E   D+ +           
Sbjct: 417 QYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDL---SVEADDDEIQQQTKEYKELQK 473

Query: 368 --PELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
             P+L+ VH   +  V D   + QIP  + S+  +  L VWK
Sbjct: 474 IPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 53/133 (39%), Gaps = 7/133 (5%)

Query: 278 QPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIEFSTHXXXX 336
           Q    + +S   S + A +G D +V ++D R+ + +P          V  I ++      
Sbjct: 327 QSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYL 386

Query: 337 XXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVAS 396
                      +WDL+Q     +P ++E   P  +  +  HR  +     N     +VA 
Sbjct: 387 LASGDDNGSWGVWDLRQF----SPANSEGVQP--VAQYDFHRGPITSISFNPLDDSVVAV 440

Query: 397 SEEENILQVWKCS 409
           + E+N + +W  S
Sbjct: 441 ASEDNTVTLWDLS 453

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 85/403 (21%), Positives = 172/403 (42%), Gaps = 53/403 (13%)

Query: 48  PLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELII-GTHTSGEEENYLKFAEIN- 105
           P +Y+ +    L WP LS+  +P  +      + +  L+   T  S +++N L   +++ 
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 106 IPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRARYMP---QNPD-FVA 161
           + K ++ + + +EE ++D+    +    N  I  K    +   R +  P   ++P+   A
Sbjct: 186 LAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLK----DTTNRLKVSPFASESPEKLTA 241

Query: 162 TLNGQGTVFLYSRSGGLQS-----------------TLKFHKD-NGYALSFNALVE-GQL 202
           T++  G V+++     +++                 T++ H +  GYAL ++ L + G L
Sbjct: 242 TMSENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGSL 301

Query: 203 LSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIN 262
           L+G     V L +  + S  I+    ++  ++  + DI++      +F +   D  ++I 
Sbjct: 302 LTGDCSGRVYLTQRHT-SKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIW 360

Query: 263 DVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-------EP 313
           D R+  H   I         N ++++     LLA+   +    ++DLR           P
Sbjct: 361 DTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAASTSP 420

Query: 314 LHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL---------KQIGAEQTPDDAE 364
           +   + H+ A+T+I F+             N + +WDL         KQ  AE    + +
Sbjct: 421 VAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETR--ELQ 478

Query: 365 DGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
           +  P+L+ VH   +  V D   + QIP  + S+  +  L +WK
Sbjct: 479 EIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 518

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/133 (18%), Positives = 54/133 (40%), Gaps = 7/133 (5%)

Query: 278 QPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIEFSTHXXXX 336
           Q    + FS   + + A+ G D ++ ++D R+ + +P   +      V  I ++      
Sbjct: 333 QSIEDIQFSRTEATVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISWNEKIGYL 392

Query: 337 XXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVAS 396
                      +WDL+Q     +P+ A    P  +  +  H+ ++     N     ++A 
Sbjct: 393 LASGDDNGSWGVWDLRQF----SPNTAASTSP--VAQYNFHKGAITSISFNPLDDSIIAV 446

Query: 397 SEEENILQVWKCS 409
           + E+N + +W  S
Sbjct: 447 ASEDNTVSLWDLS 459

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 103/239 (43%), Gaps = 27/239 (11%)

Query: 189 GYALSFNALVE-GQLLSGSDDHTVALWEVGSNS--TSISPVRTWNDLHSDIVNDIKWHNF 245
           GY L ++ L++ G +L+G     V L +  ++   T   P    N+     + DI+W   
Sbjct: 287 GYGLDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTDKQPFTVGNNKS---IEDIQWSRA 343

Query: 246 NEKLFGTVSEDSLLKINDVRA--HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVY 303
              +F T   D  ++I D R+  H   +  +      N ++++     LL A+G DS  +
Sbjct: 344 EMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLL-ASGDDSGTW 402

Query: 304 -LYDLRNMRE-------PLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIG 355
            ++DLR           P+   + H+ A+T+I F+             N + +WDL    
Sbjct: 403 GVWDLRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEA 462

Query: 356 -----AEQTPDDAE--DGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWK 407
                 +QT + AE     P+L+ VH   +  V D   + QIP  + S+  +  L +WK
Sbjct: 463 DDEEIKQQTAETAELQQIPPQLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDG-LNIWK 518

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 27/141 (19%), Positives = 57/141 (40%), Gaps = 15/141 (10%)

Query: 278 QPFNT--------LAFSHHSSNLLAAAGMDSHVYLYDLRNMR-EPLHHMSGHEDAVTNIE 328
           QPF          + +S     + A  G+D H+ ++D R+ + +P   +   +  V  + 
Sbjct: 325 QPFTVGNNKSIEDIQWSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMS 384

Query: 329 FSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNA 388
           ++                 +WDL+Q  A+ T    E   P  +  +  H++++     N 
Sbjct: 385 WNEKIGYLLASGDDSGTWGVWDLRQFSAQNT----EKTTP--VAQYNFHKAAITSISFNP 438

Query: 389 QIPWLVASSEEENILQVWKCS 409
               ++A + E+N + +W  S
Sbjct: 439 LDESIIAVASEDNTVTLWDLS 459

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 184 FHKDNGYALSFNALVEGQLLSGSDDHTVALWEV 216
           FHK    ++SFN L E  +   S+D+TV LW++
Sbjct: 426 FHKAAITSISFNPLDESIIAVASEDNTVTLWDL 458

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 94/199 (47%), Gaps = 25/199 (12%)

Query: 182 LKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIK 241
            ++ ++N + L    L +  L++   D +V L + G N  +IS ++     H+  +ND+K
Sbjct: 8   CRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWG-NLKTISSIQ----CHTTSINDMK 62

Query: 242 WHNFN---EKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSNLLAAA- 296
             N +     +F T +ED + K+ D+RA +N+         PF +L   H   N+LA   
Sbjct: 63  VINSDFDTGAVFATAAEDGV-KVWDIRARNNVASLQNDKASPFFSLDSRH---NMLACGT 118

Query: 297 ---GMDSHVYLYDLRNMREPLH-HMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLK 352
                D+ +++YD+RN  +P+   +  H D +T+I+F                + ++DL 
Sbjct: 119 ELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLT 178

Query: 353 QIGAEQTPDDAEDGVPELI 371
           Q       DD ED + ++I
Sbjct: 179 Q-------DDEEDALHQVI 190

>KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]
           {ON} similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 572

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 73/155 (47%), Gaps = 13/155 (8%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +L+ N      L S S DHTV LW++ + + +    R+  ++HS+  V+  +WH
Sbjct: 287 HTDAILSLAHNKQFRAVLASTSADHTVKLWDLNTATAA----RSLINIHSNTNVSASQWH 342

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNITIDA----VKCPQPFNTLAFSHHSSNLLAAAGMD 299
             N  +  T   DS   ++DVR  N    +    V   +    + F+    N+      +
Sbjct: 343 PSNGSVLLTAGYDSRAALSDVRIENDNDMSKYWNVSSGEEIECVRFA--DENIFICGTDN 400

Query: 300 SHVYLYDLRNMRE--PLHHMSGHEDAVTNIEFSTH 332
            +VY +D+RN  E  P+  +  H+  V+++E + H
Sbjct: 401 GNVYSFDIRNGAESKPVWTLKAHDAGVSSVEINRH 435

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 84/199 (42%), Gaps = 27/199 (13%)

Query: 191 ALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLF 250
           +  +N +    L+S S D T  +W++ S++     VRT    H   V D+K+   + +LF
Sbjct: 227 SFHWNPIDTNLLISSSIDTTCIVWDLQSSNY----VRTQLIAHDSEVFDVKFLAHSTQLF 282

Query: 251 GTVSEDSLLKINDVR--AHNITI--------------DAVKCPQPFNTLAFSHHSSNLLA 294
            +   D  +++ D+R  AH+  I              D  K P     L  S    N++A
Sbjct: 283 ASCGGDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMA 342

Query: 295 AAGMDSH-VYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQ 353
              +DS  + + D+RN   P+  + GH  AV  I++               +++ WDL +
Sbjct: 343 TFALDSKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNE 402

Query: 354 ------IGAEQTPDDAEDG 366
                 + A +   +A DG
Sbjct: 403 WLSPTSLSANENKVNANDG 421

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 59/139 (42%), Gaps = 16/139 (11%)

Query: 133 SNIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKD---NG 189
           SN   T    H+ E+   +++  +    A+  G G+V ++       ST+ +  +   NG
Sbjct: 255 SNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFDLRSLAHSTIIYESNSDQNG 314

Query: 190 Y-ALSFNALVEGQLL----SGSDDHTVALWEVGSNSTSI-------SPVRTWNDLHSDIV 237
              L+ N      LL    S SD + +A + + S S  I       SPV T  + HS  V
Sbjct: 315 SDTLTDNEKSPSALLRLQPSPSDPNVMATFALDSKSILILDMRNPGSPVLTL-EGHSAAV 373

Query: 238 NDIKWHNFNEKLFGTVSED 256
           N IKWH     +  +  +D
Sbjct: 374 NQIKWHPKKSNVLLSCGDD 392

>Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 72/150 (48%), Gaps = 13/150 (8%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +++ N      L S S DHTV LW++ S S +    R+ + +HS+  V+  +WH
Sbjct: 289 HTDAVLSMAHNRHFRSVLASTSADHTVKLWDLNSGSAA----RSLDSIHSNKNVSSSEWH 344

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNITID----AVKCPQPFNTLAFSHHSSNLLAAAGMD 299
             N  +  T   DS + + DVR  + +      +V   +   T+ F+    N++      
Sbjct: 345 MLNGSVLLTGGYDSRVALTDVRISDESQMSKHWSVMSGEEIETVTFADE--NIILCGTDS 402

Query: 300 SHVYLYDLRN--MREPLHHMSGHEDAVTNI 327
            +VY +D+RN   R+P+  +  H+  ++ +
Sbjct: 403 GNVYSFDIRNNESRKPVWTLKAHDAGISTL 432

>KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.356
           YLR196W
          Length = 580

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 66/133 (49%), Gaps = 11/133 (8%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +L+ N L    L S S DHTV LW++  N+ S+  VR+++ +HS   V+  +WH
Sbjct: 278 HTDAVLSLAHNKLFRSVLASTSADHTVKLWDL--NNASV--VRSFDSIHSGKNVSASEWH 333

Query: 244 NFNEKLFGTVSEDSLLKINDVR---AHNITID-AVKCPQPFNTLAFSHHSSNLLAAAGMD 299
             N  +  T   DS + + DVR   A N++   +V   +   +  F     N++      
Sbjct: 334 QSNGSILLTAGYDSRIALTDVRSNDAKNLSKYWSVSSGEEIESATFVDE--NIILCGTDT 391

Query: 300 SHVYLYDLRNMRE 312
            +VY +D+RN  E
Sbjct: 392 GNVYSFDIRNNAE 404

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 66/129 (51%), Gaps = 8/129 (6%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
            ++GS+D T+ +W++ +       +RT    H   V DI   + +  LF +VSED  +K 
Sbjct: 155 FITGSNDTTMKVWDLATGK-----LRTTLAGHVMTVRDIAISDRHPYLF-SVSEDKTVKC 208

Query: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321
            D+  + I  D         T++  H + +L+A AG DS + L+D+R  R P+  + GH+
Sbjct: 209 WDLEKNQIIRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVIKLWDIRT-RVPVITLVGHK 266

Query: 322 DAVTNIEFS 330
             +  ++ +
Sbjct: 267 GPINQVQCT 275

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 79/181 (43%), Gaps = 15/181 (8%)

Query: 191 ALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLF 250
           +  +N +    L+S S D T  +W++ S++     V+T    H   V D+++   + +LF
Sbjct: 237 SFHWNPIDTNLLISSSIDTTCIVWDLQSSNY----VKTQLIAHDSEVYDVRFLTQSTQLF 292

Query: 251 GTVSEDSLLKINDVR--AHNITI------DAVKCPQPFNTLAF--SHHSSNLLAAAGMDS 300
            +   D  +++ D+R  AH+  I      D       F  L    S H  N++A    DS
Sbjct: 293 ASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADS 352

Query: 301 H-VYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQT 359
           + + + D+RN   PL  + GH  +V  I++               +++ WDL +  A   
Sbjct: 353 NKILILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTASSD 412

Query: 360 P 360
           P
Sbjct: 413 P 413

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 60/151 (39%), Gaps = 10/151 (6%)

Query: 133 SNIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFH---KDNG 189
           SN   T    H+ E+   R++ Q+    A+  G G+V ++       ST+ +     D  
Sbjct: 265 SNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLN 324

Query: 190 YALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWN------DLHSDIVNDIKWH 243
              S  AL+  +  S  D + +A +   SN   I  +R         + HS  VN IKWH
Sbjct: 325 PDTSQFALLRLE-PSPHDPNVMATFAADSNKILILDMRNPESPLMILEGHSASVNQIKWH 383

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNITIDAV 274
                +  +  +D  +   D+     + D V
Sbjct: 384 PIKRNVLLSGGDDCQVLYWDLNKCTASSDPV 414

>YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Protein
           with WD-40 repeats involved in rRNA processing;
           associates with trans-acting ribosome biogenesis
           factors; similar to beta-transducin superfamily
          Length = 576

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 71/150 (47%), Gaps = 13/150 (8%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +++ N      L S S DHTV LW++ S + +    R+   +HS+  V+  +WH
Sbjct: 285 HTDAVLSMAHNKYFRSVLASTSADHTVKLWDLNSGNAA----RSLASIHSNKNVSSSEWH 340

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNITID----AVKCPQPFNTLAFSHHSSNLLAAAGMD 299
             N  +  T   DS + + DVR  + +      +    +   T+ F+  S N++      
Sbjct: 341 MLNGSILLTGGYDSRVALTDVRISDESQMSKYWSAMAGEEIETVTFA--SENIILCGTDS 398

Query: 300 SHVYLYDLRN--MREPLHHMSGHEDAVTNI 327
            +VY +D+RN   R+P+  +  H+  ++ +
Sbjct: 399 GNVYSFDIRNNENRKPVWTLKAHDAGISTL 428

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 65/129 (50%), Gaps = 8/129 (6%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
            ++GS+D T+ +W++ S    ++        H   V DI   + +  LF +VSED  +K 
Sbjct: 155 FVTGSNDTTMKVWDLASGKLKVTLTG-----HVMTVRDIAVSDRHPYLF-SVSEDKTVKC 208

Query: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321
            D+  + I  D         T++  H + +L+A AG DS V L+D+R  R P+  + GH+
Sbjct: 209 WDLEKNQIIRDYHGHLSGVRTVSI-HPTLDLIATAGRDSVVKLWDIRT-RVPVITLVGHK 266

Query: 322 DAVTNIEFS 330
             +  +E +
Sbjct: 267 GPINQVECA 275

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 58/122 (47%), Gaps = 2/122 (1%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSN 291
           HS  + DI ++  N  +  T S D+ +   D+R+ H             + + +++  SN
Sbjct: 116 HSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVKWNYKDSN 175

Query: 292 LLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
           +LA+A   + +Y++DLR    PLH + GH+ +V +I+F+               +  WD+
Sbjct: 176 ILASA-HSNDIYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDI 234

Query: 352 KQ 353
            +
Sbjct: 235 SK 236

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 77/177 (43%), Gaps = 18/177 (10%)

Query: 237 VNDIKWHNFNEKLFGTVS--EDSLLKINDVRAHNITIDAV--KCPQPFNTLAFSHHSSNL 292
           V D++W     K +  VS      L  N  R  +  ID V     +    + F+  + ++
Sbjct: 73  VADVQWSPHPAKPYWVVSTSNQKALIWNLARTSSDAIDHVLHGHSRAITDINFNPENPDI 132

Query: 293 LAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLK 352
           LA   +D++V+ +D+R+   P +  S      + ++++ +           N + +WDL+
Sbjct: 133 LATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVKWN-YKDSNILASAHSNDIYIWDLR 191

Query: 353 QIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCS 409
            +G+  TP      + +L+    GH SSVN  D N      + SS  +  ++ W  S
Sbjct: 192 -MGS--TP------LHKLV----GHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDIS 235

>Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 72/150 (48%), Gaps = 13/150 (8%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +++ N      L S S DHTV LW++ S + +    R+   +HS+  V+  +WH
Sbjct: 289 HTDAVLSMAHNKHFRSVLASTSADHTVKLWDLNSGNAA----RSLASIHSNKNVSSSEWH 344

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNITID----AVKCPQPFNTLAFSHHSSNLLAAAGMD 299
             N  +  T   DS + + DVR  + +      +V   +   T+ F++   N++      
Sbjct: 345 MLNGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETVTFANE--NIILCGTDS 402

Query: 300 SHVYLYDLRN--MREPLHHMSGHEDAVTNI 327
            +VY +D+RN   R+P+  +  H+  ++ +
Sbjct: 403 GNVYSFDIRNNENRKPVWTLKAHDAGISTL 432

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 87/182 (47%), Gaps = 24/182 (13%)

Query: 189 GYALSFNALVEGQ------------LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI 236
           G A S +A  EG+            LLSG  D+ V LW++ SN  S   +R     H+  
Sbjct: 205 GIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSN--SFEELRG----HAGR 258

Query: 237 VNDIKWHNFNEKLFGTVSEDSLLKINDV-RAHNITIDAVKCPQPFNTLAFSHHSSNLLAA 295
           V+ +K H  + +L  + S D    + D+ R   + +        + T+AF    + LLA+
Sbjct: 259 VSRVKVHP-SGRLAASASFDLTWILWDLERKVELQLQEGHSKAVY-TIAFQSDGA-LLAS 315

Query: 296 AGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIG 355
           AG+D+   ++DLR+  EP+  + GH  A++ +++S +             + +WD++ +G
Sbjct: 316 AGLDAVCAIWDLRSG-EPIMKLEGHAGAISGVDWSPNGYQLATAGADGT-VRVWDIRNVG 373

Query: 356 AE 357
            E
Sbjct: 374 TE 375

>SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 568

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 74/154 (48%), Gaps = 11/154 (7%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHN 244
           H D   +LS N      L S S DHTV LW++ +   + S     N+ +   V+  +WH+
Sbjct: 278 HTDAVLSLSHNRHFRAVLASTSADHTVKLWDLNNGIAARSIASIHNNKN---VSSSQWHS 334

Query: 245 FNEKLFGTVSEDSLLKINDVRAHNITID----AVKCPQPFNTLAFSHHSSNLLAAAGMDS 300
            +  +  T   DS + ++DVR  + +      +V   +   ++ F+  S N++       
Sbjct: 335 TDGSILLTGGYDSRVAVSDVRIADDSAMSKYWSVMAGEEIESVRFA--SENVIMCGTDSG 392

Query: 301 HVYLYDLRNMR--EPLHHMSGHEDAVTNIEFSTH 332
           +VY +D+RN    +PL  +  H+  +++++ + H
Sbjct: 393 NVYSFDIRNGEGSKPLWTLKAHDAGISSLDVNQH 426

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 2/119 (1%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSN 291
           HS  + DI +H  + ++  T S D+ +   D+R+       A       + + +++ +SN
Sbjct: 113 HSRAITDINFHPTHPEILATCSIDAYVHAWDMRSPRRAYYSASVWSAGASQVKWNYKNSN 172

Query: 292 LLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           ++A+A  +  VY++DLR    PLH + GH ++V +I+FS               +  WD
Sbjct: 173 VMASAHSND-VYIWDLRKGCTPLHVLQGHVNSVNSIDFSKFDETEIMSSSNDGTVKFWD 230

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 52/118 (44%), Gaps = 14/118 (11%)

Query: 292 LLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
           +LA   +D++V+ +D+R+ R   +  S      + ++++ +           N + +WDL
Sbjct: 129 ILATCSIDAYVHAWDMRSPRRAYYSASVWSAGASQVKWN-YKNSNVMASAHSNDVYIWDL 187

Query: 352 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCS 409
           ++ G   TP          + V  GH +SVN  D +      + SS  +  ++ W  S
Sbjct: 188 RK-GC--TP----------LHVLQGHVNSVNSIDFSKFDETEIMSSSNDGTVKFWDYS 232

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 71/155 (45%), Gaps = 11/155 (7%)

Query: 179 QSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVN 238
           Q     H D   +LS N      L S S DHTV LW++ S + + S     N+ +   V+
Sbjct: 282 QHITSHHTDAVLSLSHNKHFRAVLASTSADHTVKLWDLNSGNAARSMASIHNNKN---VS 338

Query: 239 DIKWHNFNEKLFGTVSEDSLLKINDVRAHN----ITIDAVKCPQPFNTLAFSHHSSNLLA 294
             +WH+ N  +  T   DS + + DVR  N        +V   +   T+ F+    N++ 
Sbjct: 339 SSQWHHGNGSILLTGGYDSRIALTDVRISNENEMSKYWSVSNGEEVETVIFA--DENIIL 396

Query: 295 AAGMDSHVYLYDLRN--MREPLHHMSGHEDAVTNI 327
           A     ++Y +D+RN    +P+  +  H+  ++++
Sbjct: 397 AGTDSGNIYSFDIRNNAGSKPVWTLKAHDAGISSL 431

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (47%), Gaps = 4/123 (3%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSN 291
           HS  + DI +++ +  +  T S D+ +   D+R+ H             + + ++   SN
Sbjct: 114 HSRAITDINFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWNFKDSN 173

Query: 292 LLAAA-GMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           +LA++ G D  V+++DLR+   PLH ++GH   V +I+FS               +  WD
Sbjct: 174 ILASSHGND--VFIWDLRHGSTPLHKLTGHNSGVNSIDFSRFEENKIMSSSNDGTVKFWD 231

Query: 351 LKQ 353
           L +
Sbjct: 232 LSK 234

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 94/247 (38%), Gaps = 32/247 (12%)

Query: 128 LNAPKSNIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLK-FHK 186
           LN P SN    A + H   IT   +  Q+PD +AT     ++  Y  +  ++S  + F+ 
Sbjct: 99  LNKPSSNAIEYALHGHSRAITDINFNSQHPDILATC----SIDTYVHAWDMRSPHRPFYT 154

Query: 187 DNGYALSFNAL----VEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKW 242
            + +  S + +     +  +L+ S  + V +W++   ST +  +      H+  VN I +
Sbjct: 155 TSSWRSSASQVKWNFKDSNILASSHGNDVFIWDLRHGSTPLHKLTG----HNSGVNSIDF 210

Query: 243 HNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPF---NTLAFSHHSSNLLAAAGMD 299
             F E    + S D  +K  D+        A+    P      L F H    ++   G +
Sbjct: 211 SRFEENKIMSSSNDGTVKFWDLSKEEKCQQAITTEFPIWRGRYLPFGHGYC-VMPMIGGN 269

Query: 300 SHVYLYDLRNMRE---------------PLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXN 344
           + VYL DL    E               P+    GH D V +  + +             
Sbjct: 270 NSVYLMDLDVYDEEKELENPESRIEKLKPVQTFKGHSDRVIDFLWRSRHSYDSNIDDREF 329

Query: 345 RLIMWDL 351
           +LI W L
Sbjct: 330 QLITWSL 336

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/127 (19%), Positives = 52/127 (40%), Gaps = 14/127 (11%)

Query: 283 LAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXX 342
           + F+    ++LA   +D++V+ +D+R+   P +  S    + + ++++            
Sbjct: 121 INFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWN-FKDSNILASSH 179

Query: 343 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENI 402
            N + +WDL+      TP          +    GH S VN  D +      + SS  +  
Sbjct: 180 GNDVFIWDLRH---GSTP----------LHKLTGHNSGVNSIDFSRFEENKIMSSSNDGT 226

Query: 403 LQVWKCS 409
           ++ W  S
Sbjct: 227 VKFWDLS 233

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 73/157 (46%), Gaps = 9/157 (5%)

Query: 179 QSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHS-DIV 237
           Q     H D   +L+ N      L S S DHTV LW++     +    R+ + +HS   V
Sbjct: 264 QHVATHHTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHGRAA----RSLDAVHSATAV 319

Query: 238 NDIKWHNFNEKLFGTVSEDSLLKINDVR-AHNITIDAVKCPQPFNTLAFSHHSSNLLAAA 296
           +  +WH  +  +  T   DS + ++DVR A++  +           +  +   S  +  A
Sbjct: 320 SSSQWHPSDGSILLTAGYDSRVALSDVRIANDAGMSKYWKVMKGEEIESATFVSETVFLA 379

Query: 297 GMDS-HVYLYDLRNMRE--PLHHMSGHEDAVTNIEFS 330
           G DS +VY +DLRN  +  PL  ++ H+  ++++  S
Sbjct: 380 GTDSGNVYSFDLRNGEDSAPLWTLNAHDSGISSLSVS 416

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 93/214 (43%), Gaps = 19/214 (8%)

Query: 156 NPDFVATLNGQGTVFLYSRSGG---LQSTLKF--HKDNGYALSFNALVEGQLLSGSDDHT 210
           N + +A     GT+ LYS +     + ST KF  H  +   + FNA  +  L SG ++  
Sbjct: 73  NNEIIAGALDNGTLELYSTNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGE 132

Query: 211 VALWEVGSNSTSIS---PVRTWNDLHS-DIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266
           + +W++   + S S   P+     + S D VN + W+     +F +    +   I D++A
Sbjct: 133 IFIWDMNKCTESPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKA 192

Query: 267 H------NITIDAVKCPQPFNTLAFSHHSSNLLAAAGM---DSHVYLYDLRNMREPLHHM 317
                  + T  +    Q  + + +   +S  +A A     D  + ++DLRN   P+  +
Sbjct: 193 KKEVIHLSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQTL 252

Query: 318 S-GHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           + GH+  + ++++              N +++W+
Sbjct: 253 NQGHQKGILSLDWCDQDENLLLSSGRDNTVLLWN 286

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 67/129 (51%), Gaps = 8/129 (6%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
            ++GS+D T+ +W++ +       ++T    H   V DI   + +  LF +VSED  +K 
Sbjct: 155 FVTGSNDTTMKVWDLATGK-----LKTTLAGHVMTVRDIAVSDRHPYLF-SVSEDKTVKC 208

Query: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321
            D+  ++I  D         T++  H + +L+A AG DS V L+D+R  R P+  + GH+
Sbjct: 209 WDLEKNHIIRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVVKLWDIRT-RMPVITLVGHK 266

Query: 322 DAVTNIEFS 330
             +  ++ +
Sbjct: 267 GPINQVQCT 275

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 4/120 (3%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSN 291
           HS  + DI ++  N  +  T S D+ +   D+R+ H             + + ++   SN
Sbjct: 112 HSRAITDINFNPENPDILATCSIDTYVHAWDMRSPHKPFYSTSAWRSSASQVKWNFKDSN 171

Query: 292 LLAAA-GMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           +LA++ G D  V+++DLRN   PL  + GHE +V +I+FS               +  WD
Sbjct: 172 ILASSHGND--VFIWDLRNGSTPLCQLVGHESSVNSIDFSRFKSTEIMSSSNDGTVKFWD 229

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 57/129 (44%), Gaps = 14/129 (10%)

Query: 283 LAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXX 342
           + F+  + ++LA   +D++V+ +D+R+  +P +  S    + + ++++            
Sbjct: 119 INFNPENPDILATCSIDTYVHAWDMRSPHKPFYSTSAWRSSASQVKWN-FKDSNILASSH 177

Query: 343 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENI 402
            N + +WDL+            +G   L  +  GH SSVN  D +      + SS  +  
Sbjct: 178 GNDVFIWDLR------------NGSTPLCQL-VGHESSVNSIDFSRFKSTEIMSSSNDGT 224

Query: 403 LQVWKCSHN 411
           ++ W  S N
Sbjct: 225 VKFWDYSVN 233

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 83/202 (41%), Gaps = 26/202 (12%)

Query: 143 HEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLK-FHKDNGYALSFNA----L 197
           H   IT   + P+NPD +AT     ++  Y  +  ++S  K F+  + +  S +      
Sbjct: 112 HSRAITDINFNPENPDILATC----SIDTYVHAWDMRSPHKPFYSTSAWRSSASQVKWNF 167

Query: 198 VEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDS 257
            +  +L+ S  + V +W++ + ST +  +      H   VN I +  F      + S D 
Sbjct: 168 KDSNILASSHGNDVFIWDLRNGSTPLCQLVG----HESSVNSIDFSRFKSTEIMSSSNDG 223

Query: 258 LLKINDVRAHNITID-AVKCPQPF---NTLAFSHHSSNLLAAAGMDSHVYLYDLRNMR-- 311
            +K  D   +N  +   V    P      L F +    ++   G ++ VY+ +L++    
Sbjct: 224 TVKFWDYSVNNEDLTRTVTTDFPIWRGRYLPFGNGYC-IMPQVGGNNSVYMMNLKSEEPD 282

Query: 312 ------EPLHHMSGHEDAVTNI 327
                 +P++   GH D + + 
Sbjct: 283 TKTAKLQPIYAFKGHTDRIIDF 304

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 88/220 (40%), Gaps = 25/220 (11%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
           L+S S D T  +W++ S +     ++T    H   V D+++   + +LF +   D  +++
Sbjct: 226 LISSSIDTTCIVWDLQSANY----IKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRV 281

Query: 262 NDVR--AHNITI-------DAVKCPQPFNTLAF-----SHHSSNLLAAAGMD-SHVYLYD 306
            D+R  AH+  I        A   P P    A      S    N++A   +D S V + D
Sbjct: 282 FDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAIDSSKVLILD 341

Query: 307 LRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLK-QIGAEQTPDDAED 365
           +R+   PL  +  H   +  I++               +++ WDL   + +E T D   D
Sbjct: 342 MRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNTHLDSESTKDTTPD 401

Query: 366 GVPELI-----MVHAGHRSSVNDFDLNAQIPWLVASSEEE 400
             P+       M +A     VN+     Q  W  A S + 
Sbjct: 402 SQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGAISHKR 441

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 59/139 (42%), Gaps = 14/139 (10%)

Query: 142 VHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHK--DNGYALSFNALVE 199
            H+ E+   R++ Q+    A+  G G+V ++       ST+ +     +G     +  V 
Sbjct: 252 AHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVP 311

Query: 200 GQLL----SGSDDHTVALWEVGSNSTSI-------SPVRTWNDLHSDIVNDIKWHNFNEK 248
             LL    S  D + +A + + S+   I       SP+ T  + H+  +N IKWH     
Sbjct: 312 PALLRLEPSPFDPNVIATFAIDSSKVLILDMRSPGSPLLTL-EAHTAPINQIKWHPTRRN 370

Query: 249 LFGTVSEDSLLKINDVRAH 267
           +  + S+D  +   D+  H
Sbjct: 371 VLLSASDDCQVLYWDLNTH 389

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 66/129 (51%), Gaps = 8/129 (6%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
            ++GS+D T+ +W++ +       ++T    H   V D+   + +  LF +VSED  +K 
Sbjct: 155 FITGSNDTTMKVWDLATGK-----LKTTLAGHVMTVRDVAVSDRHPYLF-SVSEDKTVKC 208

Query: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321
            D+  + I  D         T++  H + +L+A AG DS + L+D+R  R P+  + GH+
Sbjct: 209 WDLEKNQIIRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVIKLWDMRT-RIPVITLVGHK 266

Query: 322 DAVTNIEFS 330
             +  ++ +
Sbjct: 267 GPINQVQCT 275

>Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196W
           (REAL)
          Length = 576

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 70/150 (46%), Gaps = 13/150 (8%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +++ N      L S S DHTV LW++ S + +    R+   +HS+  V+  +WH
Sbjct: 285 HTDAVLSMAHNKHFRSVLASTSADHTVKLWDLNSGNAA----RSLASIHSNKNVSSSEWH 340

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNITID----AVKCPQPFNTLAFSHHSSNLLAAAGMD 299
             N  +  T   DS + + DVR  + +      +V   +   T  F+  S N++      
Sbjct: 341 MLNGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETATFA--SENIILCGTDS 398

Query: 300 SHVYLYDLRNMR--EPLHHMSGHEDAVTNI 327
            +VY +D+RN    +P+  +  H+  ++ +
Sbjct: 399 GNVYSFDIRNSENCKPVWTLKAHDAGISTL 428

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 8/124 (6%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS+D T+ +W++ S    I+        H+  V DI   N +  LF + SED L K  D
Sbjct: 129 TGSNDTTIKIWDLASGKLKITL-----SGHAMTVRDIAISNRHPYLF-SASEDKLAKCWD 182

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +  +    D        +T+   H + +L+A AG DS V L+D+R+ R P+  + GH+  
Sbjct: 183 LEKNTAIRDYHGHLSGVHTVDI-HPTLDLIATAGRDSVVKLWDIRS-RVPVVTLIGHKSP 240

Query: 324 VTNI 327
           +  +
Sbjct: 241 INKV 244

>TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON} 
          Length = 384

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 54/134 (40%), Gaps = 23/134 (17%)

Query: 230 NDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI-----------NDVRAHNITIDAVKCPQ 278
           N +H   +  + W N + K F +  ED ++K+           N + AH   I AVK   
Sbjct: 137 NSIHRGKITGLDW-NVDGKSFASGGEDGIVKLFSFENEKIQESNSIEAHEARITAVK--- 192

Query: 279 PFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXX 338
                   H  ++LLA +  DS   L+DL  M E      GH   + N++F         
Sbjct: 193 -------YHGCASLLATSSFDSTWKLWDLAKMTELYLQEGGHSTEIFNLDFHPDGSLLSS 245

Query: 339 XXXXXNRLIMWDLK 352
                N  ++WDL+
Sbjct: 246 VGGDGN-CVLWDLR 258

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 79/345 (22%), Positives = 126/345 (36%), Gaps = 76/345 (22%)

Query: 49  LMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGEEENYLKFAEINIPK 108
           L +D V+E  +T+P  ++QW P+             L I +    EEE  L+  +IN+  
Sbjct: 150 LSWDRVAECNVTFPVSTIQWQPSMTHPRRFATCSDSLRIWSFC--EEERNLQ-EQINL-- 204

Query: 109 EILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRARYMPQNPDFVATLNGQGT 168
             L   D Q++                R+ A       I   R  PQ          QG 
Sbjct: 205 -SLCKYDKQQQGAS-------------RVNAAAGGSGSI---RTNPQQ--------QQGL 239

Query: 169 VFLYSRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRT 228
           +      G L     FH        +N +    L+S S D T  +W++ S++     VRT
Sbjct: 240 I------GELPPITSFH--------WNPVDPNLLISSSIDTTCIVWDLQSSNY----VRT 281

Query: 229 WNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVR--AHNITI-DAVKCPQ------- 278
               H   V D+++     +LF +   D  +++ D+R  AH+  I +    P        
Sbjct: 282 QLIAHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSPATLQPTTA 341

Query: 279 -------------PFNTLAFSHHSSNLLAAAGMDS-HVYLYDLRNMREPLHHMSGHEDAV 324
                        P   L  S    N++A   +DS  V + D+RN   P+  + GH  AV
Sbjct: 342 AGSSSAADSDTGVPLLRLEPSPFDPNVIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAV 401

Query: 325 TNIEFSTHXXXXXXXXXXXNRLIMWDLKQI----GAEQTPDDAED 365
             + +               +++ WDL         +Q PD A D
Sbjct: 402 NQMRWHPSKRNVLLSCADDCQVLYWDLNNYIMGHPTDQDPDHAVD 446

>TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1178

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 59/131 (45%), Gaps = 20/131 (15%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNT---------- 282
           HS  V DI ++  +  L  T S D+ +   D+R+ N         +PF T          
Sbjct: 113 HSRAVTDITFNFDHPDLLATCSIDTYIHAWDMRSPN---------RPFYTTTDWHSGASQ 163

Query: 283 LAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXX 342
           + +++  SN+LA+A   + V ++DLR    PL+ +S H  +V NI+F+ H          
Sbjct: 164 VQWNYKQSNILASA-QGNDVCIWDLRMGSTPLYKLSDHSGSVNNIDFNKHRGTEIMTSSN 222

Query: 343 XNRLIMWDLKQ 353
              +  WD  +
Sbjct: 223 DGTVKFWDYSK 233

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/127 (18%), Positives = 56/127 (44%), Gaps = 14/127 (11%)

Query: 283 LAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXX 342
           + F+    +LLA   +D++++ +D+R+   P +  +      + ++++ +          
Sbjct: 120 ITFNFDHPDLLATCSIDTYIHAWDMRSPNRPFYTTTDWHSGASQVQWN-YKQSNILASAQ 178

Query: 343 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENI 402
            N + +WDL+ +G+  TP          +   + H  SVN+ D N      + +S  +  
Sbjct: 179 GNDVCIWDLR-MGS--TP----------LYKLSDHSGSVNNIDFNKHRGTEIMTSSNDGT 225

Query: 403 LQVWKCS 409
           ++ W  S
Sbjct: 226 VKFWDYS 232

>TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.356
           YLR196W
          Length = 563

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 71/150 (47%), Gaps = 13/150 (8%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +L+ N      L S S DHTV LW++ S + +    R+   +HS   V+  +WH
Sbjct: 271 HTDAVLSLTHNKQFRSVLASTSADHTVKLWDLNSATAA----RSMASIHSGKNVSSSEWH 326

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNITID----AVKCPQPFNTLAFSHHSSNLLAAAGMD 299
             N  +  T   DS + ++DVR  + T      +V   +   T+ F+    N++      
Sbjct: 327 TTNGSVLLTGGYDSRIALSDVRIPDETKMSKYWSVVPGEDVETVTFADE--NIMLCGTDS 384

Query: 300 SHVYLYDLRNMR--EPLHHMSGHEDAVTNI 327
            ++Y +D+RN    +P+  +  H+  ++++
Sbjct: 385 GNIYSFDIRNNENSKPVWTLKAHDAGISSL 414

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 63/125 (50%), Gaps = 8/125 (6%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS+D T+ +W++ +    ++        H   V DI     +  +F + SED L+K  D
Sbjct: 147 TGSNDTTIKIWDLATGKLKLTLSG-----HIMTVKDICISKRHPYMF-SASEDKLVKCWD 200

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +  + +  D        +T+   H + NL+A AG DS V L+D+R  + P+  M+GH+  
Sbjct: 201 LEKNRVIRDYHGHLSGVHTVDI-HPTLNLIATAGRDSVVRLWDIRT-KLPVMTMAGHKSP 258

Query: 324 VTNIE 328
           +  ++
Sbjct: 259 INRVK 263

>KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.247
           YKR036C
          Length = 666

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 75/171 (43%), Gaps = 31/171 (18%)

Query: 182 LKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWN------DLHSD 235
           LK HK    +L  + L    ++S   D TV LW V     S +  R +N      D H+D
Sbjct: 404 LKGHKATVNSLQMD-LTYNMVISAGKDATVKLWNVDLGIESFNTERYFNPCIYTFDSHTD 462

Query: 236 IVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNI-----------------TIDAVKCPQ 278
            +  I   +++E L  + S D  ++  D++                     T+D ++ P 
Sbjct: 463 EITAIS--SYHENLV-SGSRDKTIRQWDLKTGKCIQILNIGFLNSQKELLGTVDPIRSPP 519

Query: 279 PFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEF 329
           P   L     +   LA  G D  V L+DLR + + +  +SGHE+A+T ++F
Sbjct: 520 PIGALQCRDAA---LATGGQDGIVRLWDLR-IGKVVRSLSGHENAITALKF 566

>KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {ON}
           Anc_8.631 YOR212W
          Length = 423

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 65/153 (42%), Gaps = 9/153 (5%)

Query: 161 ATLNGQGTVFLYSRSGGLQSTLK--FHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGS 218
           A L+   TV+  S+   +Q  +   F    GY  S + L E Q+LS S D T ALW++  
Sbjct: 153 AGLDNNCTVYKISKENRIQQNVITIFKGHTGYISSIDFLDERQILSASGDMTCALWDI-- 210

Query: 219 NSTSISPVRTWNDLHSDIVNDIKWH--NFNEKLFGTVSEDSLLKINDVRAHNITIDAVKC 276
                  +R + D   D++     H  N N K+F +   D  L I D R+          
Sbjct: 211 --PKAKRIREYTDHLGDVLALALPHNDNANGKIFASCGSDGYLYIWDTRSPANAQSFFIS 268

Query: 277 PQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRN 309
               ++L F     N + A   +  + ++DLR+
Sbjct: 269 SSDASSLQF-FRDDNSIIAGSENGTISMFDLRS 300

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 114/280 (40%), Gaps = 61/280 (21%)

Query: 154 PQNPDFVATLNGQGTVFLY-SRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVA 212
           P +   +A+ +  GT+ ++ + S   Q T+  H ++   + +    +G L SGS D TV 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGG--QGLLYSGSHDRTVR 302

Query: 213 LWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITID 272
           +W++ S    I+ +++    H+  VN +           ++S D  L+I    A + T  
Sbjct: 303 VWDINSQGRCINILKS----HAHWVNHL-----------SLSTDYALRIG---AFDHTGK 344

Query: 273 AVKCPQPFNTLAFSHH---------SSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
               P+     A  ++         S  ++  A  D  ++L++     +P+  M+GH+  
Sbjct: 345 KPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKL 404

Query: 324 VTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 383
           V ++ FS             N + +W            D  DG  + I    GH +SV  
Sbjct: 405 VNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASV-- 447

Query: 384 FDLNAQIPW-----LVASSEEENILQVW-----KCSHNLP 413
                Q+ W     L+ S  ++  L+VW     K S +LP
Sbjct: 448 ----YQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLP 483

>CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P21304 Saccharomyces
           cerevisiae YLR196w PWP1
          Length = 583

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 72/150 (48%), Gaps = 13/150 (8%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +L+ N      L S S DHTV LW++ +N+T+    R+  ++HS+  V+  +WH
Sbjct: 289 HTDAVLSLAHNRQFRTVLASTSADHTVKLWDL-NNATA---ARSMANIHSNKNVSSSQWH 344

Query: 244 NFNEKLFGTVSEDSLLKINDVR----AHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMD 299
             N  +  T   DS   + DVR    A      +V   +   T  F+  S N++      
Sbjct: 345 MQNASILLTAGYDSRAALTDVRISDEAQMSKYWSVLPGEEIETATFA--SENIILCGTDA 402

Query: 300 SHVYLYDLRNMR--EPLHHMSGHEDAVTNI 327
            +VY +D+RN    +P+  +  H+  ++++
Sbjct: 403 GNVYSFDIRNNEGSKPVWTLKAHDAGISSL 432

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 92/204 (45%), Gaps = 29/204 (14%)

Query: 184 FHKDNGYALSFNALVEGQLLSGSDDHTVAL--WEVGSNSTSISPVRTWNDLHSDIVNDIK 241
           F  DN + L F  L    LL+   +  V L  WE      +++PVR +  +    +N +K
Sbjct: 11  FGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLDWE------TLNPVRNFK-IDQVSINSMK 62

Query: 242 WHNF---NEKLFGTVSEDSLLKINDVRAHNI--TIDAVKCPQPFNTLAFSHHSSNLLAAA 296
             N    N  LF T + +S+ KI D+++++   TI   K   PF +L   H   ++LA  
Sbjct: 63  LINNDYNNASLFATATLNSV-KIYDIKSNDCIATITNDK-KSPFLSLDSRH---DMLACG 117

Query: 297 ----GMDSHVYLYDLRNMREPLH-HMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
               G+D+ +Y+YD+RN   P+   +  H D +T+I+F                  ++DL
Sbjct: 118 TELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL 177

Query: 352 KQIGAEQTPDDAEDGVPELIMVHA 375
            Q    Q  DDA   V     +H+
Sbjct: 178 TQ----QEEDDALYQVINYASIHS 197

>YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}
           UTP15Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 513

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 94/195 (48%), Gaps = 13/195 (6%)

Query: 138 TAKYVHEE-EITRARYMPQNP-DFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFN 195
           +A+ V E   +T   + PQ+P DF  T + +  +F  SR+  +  T    KD  Y+ SF 
Sbjct: 32  SAQLVKEHNSVTHISFNPQHPHDFAVTSSTRVQIF-SSRTRQVIKTFSRFKDVVYSASFR 90

Query: 196 ALVEGQLLSGSD-DHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVS 254
           +  +G+LL   D    V++++  +  T +  +    +  +   +  K+H  + K+  T S
Sbjct: 91  S--DGKLLCAGDATGLVSVYDSYNPRTILLSI----NASTHPTHVTKFHTQDNKILATAS 144

Query: 255 EDSLLKINDVR-AHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNM-RE 312
           +D + ++ D+  A+   ++         TL+F   + +L+A    D  + LYD R+    
Sbjct: 145 DDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHLVATGSYDGLIRLYDTRSSGST 204

Query: 313 PLHHMSGHEDAVTNI 327
           P++ ++ H+  V N+
Sbjct: 205 PIYSLN-HDQPVENV 218

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 2/119 (1%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSN 291
           H   + DI +H  + ++  T S D+ +   D+R+         +     + + ++  +SN
Sbjct: 113 HFRAITDINFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVKWNFRNSN 172

Query: 292 LLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           ++A++  D HV ++DLR    PL+ + GHE +V NI+F+               +  WD
Sbjct: 173 IMASSHSD-HVCIWDLRKGCTPLYTLQGHEGSVNNIDFNKAKETEIMSSSNDGTVKFWD 230

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/127 (20%), Positives = 52/127 (40%), Gaps = 14/127 (11%)

Query: 283 LAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXX 342
           + F  H   +LA   +D++V  +D+R+ + P +  S      + ++++            
Sbjct: 120 INFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVKWN-FRNSNIMASSH 178

Query: 343 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENI 402
            + + +WDL++            G   L  +  GH  SVN+ D N      + SS  +  
Sbjct: 179 SDHVCIWDLRK------------GCTPLYTLQ-GHEGSVNNIDFNKAKETEIMSSSNDGT 225

Query: 403 LQVWKCS 409
           ++ W  S
Sbjct: 226 VKFWDYS 232

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 88/223 (39%), Gaps = 40/223 (17%)

Query: 191 ALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLF 250
           +  +N +    ++S S D T  +W++ S+      V+T    H   V D+++   + +LF
Sbjct: 248 SFDWNTVDTNLIISSSIDTTCIVWDLQSSHY----VKTQLIAHDSEVFDVRFLTKSTQLF 303

Query: 251 GTVSEDSLLKINDVR--AHNITI--------------DAVKCPQPFNTLAF-----SHHS 289
            +   D  +++ D+R  AH+  I                   P    + A      S + 
Sbjct: 304 ASCGGDGSVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYD 363

Query: 290 SNLLAAAGMDSH-VYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIM 348
            N+LA    DS+ + + D+RN   P+  + GH  +V  I++               +++ 
Sbjct: 364 PNVLATFAADSNKIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLY 423

Query: 349 WDL------------KQIGAEQTPDDAEDGVPELIMVHAGHRS 379
           WDL            K  GA  TP +  DG  + +M   G  S
Sbjct: 424 WDLNNSFMEINGGSVKSPGASGTPLEDTDG--DTVMADGGEGS 464

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 100/269 (37%), Gaps = 67/269 (24%)

Query: 45  SNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGEEENYLKFAEI 104
           SN  L +D V E  + +P   +QW P+ +   +       L I  + + EE  + +  +I
Sbjct: 160 SNDLLSWDSVVEADVVYPVSRIQWAPSQLHPRKLATCSDSLRIW-NVNPEERQFQE--QI 216

Query: 105 NIPKEILNNQDPQEEAEEDDKATL-----------NAPKSNIRITAK------------- 140
           N+     N Q P   A  +D   +           N   +N+ I++              
Sbjct: 217 NLSLCKYNRQHPTSTATTEDMKVIGTFPPITSFDWNTVDTNLIISSSIDTTCIVWDLQSS 276

Query: 141 -YV------HEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFH-------- 185
            YV      H+ E+   R++ ++    A+  G G+V ++       ST+ +         
Sbjct: 277 HYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSSSS 336

Query: 186 -----------KDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSI-------SPVR 227
                       D  YAL     +E    S  D + +A +   SN   I       SP+ 
Sbjct: 337 SAPAAGTTTPSSDGSYAL---LRLEP---SPYDPNVLATFAADSNKIIILDMRNPESPIL 390

Query: 228 TWNDLHSDIVNDIKWHNFNEKLFGTVSED 256
           T  + HS  VN+IKWH     +  + S+D
Sbjct: 391 TL-EGHSSSVNEIKWHPTKRNVLLSCSDD 418

>Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 91/195 (46%), Gaps = 13/195 (6%)

Query: 138 TAKYVHEE-EITRARYMPQNP-DFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFN 195
           +A+ V E   +T   + PQ+P DF  T + +  +F  SR+  +  T    KD  Y+ SF 
Sbjct: 32  SAQLVKEHNSVTHISFNPQHPHDFAVTSSTRVQIF-SSRTRQVIKTFSRFKDVVYSASFR 90

Query: 196 ALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWN-DLHSDIVNDIKWHNFNEKLFGTVS 254
           +  +G+LL   D     L  V  +    + + + N   H   V   K+H  + K+  T S
Sbjct: 91  S--DGKLLCAGD--ATGLVSVYDSYNPRTILLSMNASTHPTHVT--KFHTQDSKILATAS 144

Query: 255 EDSLLKINDVR-AHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNM-RE 312
           +D + ++ D+  A+   ++         TL+F   + +L+A    D  V LYD R+    
Sbjct: 145 DDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHLIATGSYDGLVRLYDTRSSGST 204

Query: 313 PLHHMSGHEDAVTNI 327
           P++ ++ H+  + N+
Sbjct: 205 PIYSLN-HDQPIENV 218

>Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 100/219 (45%), Gaps = 16/219 (7%)

Query: 138 TAKYVHEE-EITRARYMPQNP-DFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFN 195
           +A+ V E   +T   + PQ+P DF  T + +  +F  SR+  +  T    KD  Y+ SF 
Sbjct: 32  SAQLVKEHNSVTHISFNPQHPHDFAVTSSTRVQIF-SSRTRQVIKTFSRFKDVVYSASFR 90

Query: 196 ALVEGQLLSGSD-DHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVS 254
           +  +G+LL   D    V++++  +  T +  +    +  +   +  K+H  + K+  T S
Sbjct: 91  S--DGKLLCAGDATGLVSVYDSYNPRTILLSI----NASTHPAHVTKFHTQDNKVLATAS 144

Query: 255 EDSLLKINDV-RAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNM-RE 312
           +D + ++ D+  A+   ++         TL+F   + +++A    D  + LYD R+    
Sbjct: 145 DDRVTRLWDISHAYEPQLELTGATDYVRTLSFIPAAPHMVATGSYDGLIRLYDTRSSGST 204

Query: 313 PLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
           P++ ++ H+  + NI   T            N   +WDL
Sbjct: 205 PIYSLN-HDQPIENI---TAVSPTQIVSCGGNNFKVWDL 239

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 115/280 (41%), Gaps = 61/280 (21%)

Query: 154 PQNPDFVATLNGQGTVFLY-SRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVA 212
           P +   +A+ +  GT+ ++ + S   Q T+  H ++   + +    +G L SGS D TV 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGG--QGLLYSGSHDRTVR 302

Query: 213 LWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITID 272
           +W++ S    I+ +++    H+  VN +           ++S D  L++    A + T  
Sbjct: 303 VWDMNSQGRCINILKS----HAHWVNHL-----------SLSTDYALRVG---AFDHTGQ 344

Query: 273 AVKCPQPFNTLAFSHH---------SSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
               P+     A +++         S  ++  A  D  ++L++     +P+  M+GH+  
Sbjct: 345 KPTSPEDAQKKALANYEKICKKNGNSEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKL 404

Query: 324 VTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 383
           V ++ FS             N + +W            D  DG  + I    GH +SV  
Sbjct: 405 VNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASV-- 447

Query: 384 FDLNAQIPW-----LVASSEEENILQVW-----KCSHNLP 413
                Q+ W     L+ S  ++  L+VW     K S +LP
Sbjct: 448 ----YQVAWSSDCRLLVSCSKDTTLKVWDVRTGKLSVDLP 483

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 60/123 (48%), Gaps = 10/123 (8%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-----HNITIDAVKCPQPFNTLAFSH 287
           HS  + DI +H  N ++  T S D+ +   D+R+     ++ ++ +    Q    + ++ 
Sbjct: 113 HSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRRAFYSASVWSAGAAQ----VKWNF 168

Query: 288 HSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLI 347
            + N++A+A  +  ++++DLR    PLH + GH ++V +I+FS               + 
Sbjct: 169 KNPNVMASAHSND-IFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSSSNDGTVK 227

Query: 348 MWD 350
            WD
Sbjct: 228 FWD 230

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query: 155 QNPDFVATLNGQGTVFLYSRSGGLQ-STLKFHKDNGYALSFNALVEGQLLSGSDDHTVAL 213
           +NP+ +A+ +         R G +    LK H ++  ++ F+   E +++S S+D TV  
Sbjct: 169 KNPNVMASAHSNDIFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSSSNDGTVKF 228

Query: 214 WEVGSNSTSISPVRT 228
           W+   N     P+RT
Sbjct: 229 WDYSVNDK--EPLRT 241

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 25/120 (20%), Positives = 50/120 (41%), Gaps = 14/120 (11%)

Query: 292 LLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
           +LA   +D++V+ +D+R+ R   +  S        ++++             N + +WDL
Sbjct: 129 ILATCSIDAYVHAWDMRSSRRAFYSASVWSAGAAQVKWN-FKNPNVMASAHSNDIFIWDL 187

Query: 352 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHN 411
           ++             +P  I+   GH +SVN  D +      + SS  +  ++ W  S N
Sbjct: 188 RK-----------GCMPLHIL--KGHANSVNSIDFSRFNETEIMSSSNDGTVKFWDYSVN 234

>Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar to
           Ashbya gossypii AAR078W
          Length = 603

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 71/157 (45%), Gaps = 27/157 (17%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSD-IVNDIKWH 243
           H D   +LS N      L S S D T+ LW++   +     VR+   +H+   V+  +WH
Sbjct: 309 HTDAVLSLSHNKQYRVVLASTSADQTIKLWDLNQGTA----VRSIASIHNGTTVSSSQWH 364

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHN----------ITIDAVKCPQPFNTLAFSHHSSNLL 293
             +  +  T + DS + ++DVR  N          +T + V+C    N   F        
Sbjct: 365 PSDGSIILTGAYDSRVALSDVRISNDSEMSKYWSVMTGEEVECVSFVNDNEF-------- 416

Query: 294 AAAGMDS-HVYLYDLRNMRE--PLHHMSGHEDAVTNI 327
             AG DS ++Y +DLRN  +  PL  +  H+  ++++
Sbjct: 417 -LAGTDSGNIYSFDLRNGEKSSPLWTLKAHDSGISSM 452

>TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {ON}
           Anc_2.469 YMR093W
          Length = 509

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 90/185 (48%), Gaps = 12/185 (6%)

Query: 147 ITRARYMPQNP-DFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALVEGQLL-S 204
           +T   + PQ+  DF  T + +  +F  SR+  +  T    KD  Y+ SF    +G+LL +
Sbjct: 42  VTHIAFNPQHTHDFAVTSSTRVQIF-SSRTRQVVKTFSRFKDVVYSASFRN--DGKLLVA 98

Query: 205 GSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDV 264
           G     V++++  +  T +  +    ++ +  V+  K+H+ + K   T S+D + ++ D+
Sbjct: 99  GDATGLVSVFDSYNPRTLLLSI----NVSTHPVHVTKFHSQDSKTLVTASDDRVTRLWDI 154

Query: 265 R-AHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNM-REPLHHMSGHED 322
             A+  +++         TL F   + +L+A    D  V LYD RN   EP+  ++ HE 
Sbjct: 155 SYAYEPSLELTGASDYVRTLTFIPSAPHLVATGSYDGIVRLYDTRNSGSEPVFSLN-HEQ 213

Query: 323 AVTNI 327
            + NI
Sbjct: 214 PLENI 218

>ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 575

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 71/148 (47%), Gaps = 9/148 (6%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +L+ N      L S S DHTV LW++ + + +    R+   +HS   V+  +WH
Sbjct: 287 HTDAILSLALNKHFRAVLASTSADHTVKLWDLNNGTAA----RSLASIHSGKNVSSSEWH 342

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNIT-IDAVKCPQPFNTLAFSHHSSNLLAAAGMDS-H 301
             N  +  T   DS + ++DVR  + + +       P   +  S  +   +  +G DS +
Sbjct: 343 KTNGSVLLTSGYDSRVALSDVRISDESQLSKYWSVLPGEEVESSTFADENIILSGTDSGN 402

Query: 302 VYLYDLRN--MREPLHHMSGHEDAVTNI 327
           VY +D+RN    +P+  ++ H+  ++ +
Sbjct: 403 VYAFDIRNNSGSKPVWTLNAHDAGISCL 430

>ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1147

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 96/244 (39%), Gaps = 34/244 (13%)

Query: 128 LNAPKSNIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLK-FHK 186
           L  P SN      + H   IT   + PQ+PD +AT     ++  Y  +  L+S  + F+ 
Sbjct: 98  LAKPSSNAIEHVLHKHFRAITDINFSPQHPDILATC----SIDTYVHAWDLRSPQRPFYT 153

Query: 187 DNGY-------ALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVND 239
            +G+         SFN   +  +L+ +  + V +W++   ST +  +      H   VN 
Sbjct: 154 TSGWLSGASQVKWSFN---DQNVLASAHGNDVCIWDLRKGSTPLGKLVG----HGSSVNS 206

Query: 240 IKWHNFNEKLFGTVSEDSLLKINDV-RAHNITIDAVKCPQPF---NTLAFSHHSSNLLAA 295
           + ++ F      T S D  +K  D  ++ N  I  ++   P      L F      + + 
Sbjct: 207 VDFNRFKRTELMTGSNDGSVKFWDYSKSCNEPIKTIRTDFPIWRGRYLPFGEGCCLMPSV 266

Query: 296 AGMDSHVYLYDLRNMR----------EPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNR 345
            G +S VY+  L              +P++   GH+D VT+  + +             +
Sbjct: 267 GGFNS-VYVASLAKRDGVEEVNDSKLQPIYAFKGHDDRVTDFVWRSRSSCGSDGCDREFQ 325

Query: 346 LIMW 349
           L+ W
Sbjct: 326 LVTW 329

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 55/133 (41%), Gaps = 24/133 (18%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQ-PFNT--------- 282
           H   + DI +   +  +  T S D+ +   D+R+          PQ PF T         
Sbjct: 113 HFRAITDINFSPQHPDILATCSIDTYVHAWDLRS----------PQRPFYTTSGWLSGAS 162

Query: 283 -LAFSHHSSNLLAAA-GMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXX 340
            + +S +  N+LA+A G D  V ++DLR    PL  + GH  +V +++F+          
Sbjct: 163 QVKWSFNDQNVLASAHGND--VCIWDLRKGSTPLGKLVGHGSSVNSVDFNRFKRTELMTG 220

Query: 341 XXXNRLIMWDLKQ 353
                +  WD  +
Sbjct: 221 SNDGSVKFWDYSK 233

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 65/133 (48%), Gaps = 15/133 (11%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPV------RTWNDLHSDI--VNDIKWHNFNEKLFGTV 253
            L+G+++ TV+LW +  N+ S S +      RT    HS +  +ND+KW++ ++ +F T 
Sbjct: 64  FLAGNNNGTVSLWNL-DNTLSTSHILNNKLARTSTKPHSHLFGINDMKWYSIDDGMFFTC 122

Query: 254 SEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHV-YLYDLRNMRE 312
             D  +K+ D     I +  ++    FN+  F   ++N      +D +   L DLRNM  
Sbjct: 123 GNDKFVKLWDTNKF-INVQDLE----FNSNLFQMDTANQFILVTLDDYYPRLIDLRNMNL 177

Query: 313 PLHHMSGHEDAVT 325
            +     H ++ T
Sbjct: 178 GITIFGKHLNSKT 190

>NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON}
           Anc_7.356 YLR196W
          Length = 581

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 71/156 (45%), Gaps = 25/156 (16%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +LS N      L S S DHTV LW++ +  T+    R+   +HS   V+  +WH
Sbjct: 290 HTDAILSLSHNKQFRAVLASTSADHTVKLWDLNNGQTA----RSLASVHSGKNVSASEWH 345

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHN----------ITIDAVKCPQPFNTLAFSHHSSNLL 293
             N  +  T   DS + ++DVR  N          ++ + ++C     T A    + N++
Sbjct: 346 PTNGSILLTGGYDSRVALSDVRISNEKEMSKYWSVMSGEEIEC----TTFA----NENII 397

Query: 294 AAAGMDSHVYLYDLRNMR--EPLHHMSGHEDAVTNI 327
                  ++Y +D+RN    +P+  +  H+  ++ +
Sbjct: 398 LCGTDSGNIYSFDIRNNENSKPVWTLKAHDAGISTL 433

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 62/124 (50%), Gaps = 8/124 (6%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS+D TV +W++ S    ++        H   V D+     +  LF + SED ++K  D
Sbjct: 133 TGSNDTTVKIWDLASGKLKLTLAG-----HVMTVRDVAISQRHPYLF-SASEDKMVKCWD 186

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +  + I  D        +T+   H + +L+A+AG D  V L+D+R+ R  +  + GH+  
Sbjct: 187 LEKNQIIRDYHGHLSGVHTVDI-HPTLDLIASAGRDGVVKLWDIRS-RTAVMTLIGHKSP 244

Query: 324 VTNI 327
           +T +
Sbjct: 245 ITKV 248

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 110/267 (41%), Gaps = 51/267 (19%)

Query: 181 TLKFHKDNGYALSFNALVEGQLLSG-SDDHT--------VALWEVGSNSTSISPVRTWND 231
           T+ F  DN + L    L    LLS  S+ H          ++ ++  + TSIS ++  + 
Sbjct: 8   TISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLD- 65

Query: 232 LHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNI--TIDAVKCPQPFNTLAFSHHS 289
                 ND+   N     F T SEDS+ KI D+R +    T+   K   PF +L   H  
Sbjct: 66  ------NDVDSGN----TFVTASEDSV-KIFDLRLNQCVATVQNAK-NSPFISLDSRH-- 111

Query: 290 SNLLAA----AGMDSHVYLYDLRNMREPLHHMS-GHEDAVTNIEFSTHXXXXXXXXXXXN 344
             +LA     +G D+ ++LYDL+ +  P+      H D +T+I+F               
Sbjct: 112 -GMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDG 170

Query: 345 RLIMWDLKQIGAEQTPDDAEDGVPELIMVHA------------GHRSSVNDFDLNAQIPW 392
            + ++DLKQ    Q  ++A   V     +H+             H  + +  +LN +   
Sbjct: 171 YVNVYDLKQ----QEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDE 226

Query: 393 LVASSEEE--NILQVWKCSHNLPIVGG 417
           LV     E  +I + W C + + I  G
Sbjct: 227 LVEPKPLEFGDIRKPWNCDYVVDIFPG 253

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 90/207 (43%), Gaps = 27/207 (13%)

Query: 167 GTVFLYSRS---GGLQSTLKF--HKDNGYALSFNALVEGQLLSGSDDHTVALW------E 215
           G++ LYS +     + S  KF  H  +   + FNA  +  L SG ++  + +W      E
Sbjct: 84  GSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTE 143

Query: 216 VGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITI---- 271
             +N T ++P ++ + +  D VN + W+     +F +    +   I D++A    I    
Sbjct: 144 SPANYTPLTPGQSMSSV--DEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLCY 201

Query: 272 ----DAVKCPQPFNTLAFSHHSSNLLAAAGM---DSHVYLYDLRNMREPLHHMS-GHEDA 323
                 +K  Q  + + +   +S  +A A     D  + ++DLRN   PL  ++ GH+  
Sbjct: 202 TSPNSGIK--QQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLNQGHQKG 259

Query: 324 VTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           + ++++              N +++W+
Sbjct: 260 ILSLDWCHQDENLLLSSGRDNTVLLWN 286

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 114/280 (40%), Gaps = 61/280 (21%)

Query: 154 PQNPDFVATLNGQGTVFLY-SRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVA 212
           P +   +A+ +  GT+ ++ + S   Q T+  H ++   + +    +G L SGS D TV 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGG--QGLLYSGSHDRTVR 302

Query: 213 LWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITID 272
           +W++ S    I+ +++    H+  VN +           ++S D  L++    A + T  
Sbjct: 303 VWDINSQGRCINILKS----HAHWVNHL-----------SLSTDYALRVG---AFDHTGK 344

Query: 273 AVKCPQPFNTLAFSHH---------SSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
               P+     A  ++         S  ++  A  D  ++L++     +P+  M+GH+  
Sbjct: 345 RPSTPEDAQKKALENYEKICKKNGNSEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKL 404

Query: 324 VTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 383
           V ++ FS             N + +W            D  DG  + I    GH +SV  
Sbjct: 405 VNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASV-- 447

Query: 384 FDLNAQIPW-----LVASSEEENILQVW-----KCSHNLP 413
                Q+ W     L+ S  ++  L+VW     K S +LP
Sbjct: 448 ----YQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLP 483

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 102/249 (40%), Gaps = 52/249 (20%)

Query: 181 TLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDI 240
           TL  H ++   + +    EG L SGS D TV +W++  NS ++    +    H+  VN +
Sbjct: 275 TLSGHSNSVACVKWGG--EGLLYSGSHDKTVRVWDM--NSATVGKCISILKNHAHWVNHL 330

Query: 241 KWHNFNEKLFGTVSEDSLLKIN-----DVRAHNITIDAVKCPQPFNTLAFSHHSSN-LLA 294
                      ++S D  L+I       V+         +    ++ +A  + S+  L+ 
Sbjct: 331 -----------SLSTDYALRIGPFDHTGVKPSTPAEAKRRAQANYDKVAKRNGSAEELMV 379

Query: 295 AAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQI 354
            A  D  ++L++ + + +PL  M+GH+  V ++ FS             N + +W     
Sbjct: 380 TASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFSPD-GRYIVSASFDNSIKLW----- 433

Query: 355 GAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPW-----LVASSEEENILQVW--- 406
                  D  DG  + +    GH +SV       Q+ W     L+ S  ++  L+VW   
Sbjct: 434 -------DGRDG--KFLSTFRGHVASV------YQVAWSSDCRLLVSCSKDTTLKVWDVR 478

Query: 407 --KCSHNLP 413
             K S +LP
Sbjct: 479 TRKLSVDLP 487

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 99/214 (46%), Gaps = 25/214 (11%)

Query: 172 YSRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWND 231
           YS S     +++F  +N + L    +    LL+   +  V L +  ++  SI  ++T   
Sbjct: 18  YSMSYSKLESIEFGPNN-WCLKLQPIYNSGLLTSLSNGRVELIDWATHK-SILQIQT--- 72

Query: 232 LHSDIVNDIKWHN---FNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQ--PFNTLAFS 286
            H+  VND+   N    N  L  T +ED++ KI D+++ N  +  +K  +  PF +L   
Sbjct: 73  -HATSVNDMVIINNDRMNGSLIATAAEDAV-KIYDLKS-NDCVATLKNGKSAPFLSLDSR 129

Query: 287 HHSSNLLAA----AGMDSHVYLYDLRNMREPLHHM-SGHEDAVTNIEFSTHXXXXXXXXX 341
           H    LL      +G+D+ +++YD+R+ ++PL  +   H D +T+I+F            
Sbjct: 130 H---GLLGCGTELSGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGS 186

Query: 342 XXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHA 375
               + ++DL Q    Q  DDA   V     +H+
Sbjct: 187 TDGYVNIYDLTQ----QEEDDALHQVINFASIHS 216

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 88/212 (41%), Gaps = 37/212 (17%)

Query: 156 NPDFVATLNGQGTVFLYSRSGGLQST--LKFHKDNGYALSFNALVEGQLLSGSDDHTVAL 213
           NP  V    G GT+ L+  +  LQ     K H    ++ ++N L     +SGS D  V +
Sbjct: 72  NPTQVLVAQGDGTLTLFDLTNKLQQIQIYKEHYSEVFSCNWNMLTRRTFISGSWDGKVKI 131

Query: 214 WEVGSNSTSISPVRT-----------------WNDLHSDIVNDIKWHNFNEKLFGTVSED 256
           W+  + S S+  +R                   N  + D +    +   +  +    S +
Sbjct: 132 WDC-ARSESVLTLRNNRSLGHTGEHIETKALQRNSKNKDCIYQALFSPHDPNMAMCCSGN 190

Query: 257 SLLKINDVRAHNITIDAVKCPQPFNTLA--FSHHSSNLLAAAGMDSHVYLYDLRNMREPL 314
           S L   D+R  N   +++       TL+  ++ + S ++A+AG+D  + ++DLR ++   
Sbjct: 191 SYLTFFDLRQPNQQ-NSILAHSGLETLSCDYNKYRSYIVASAGVDKAIRIWDLRMIKNKP 249

Query: 315 HHM--------------SGHEDAVTNIEFSTH 332
           H+M              + HE A+  I +S H
Sbjct: 250 HNMFADISSYNCTNEVVNAHELAIRKILWSPH 281

>Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 99/219 (45%), Gaps = 16/219 (7%)

Query: 138 TAKYVHEE-EITRARYMPQNP-DFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFN 195
           +A+ V E   +T   + PQ+P DF  T + +  +F  SR+  +  T    KD  Y+ SF 
Sbjct: 32  SAQLVKEHNSVTHISFNPQHPHDFAVTSSTRVQIF-SSRTRQVIKTFSRFKDVVYSASFR 90

Query: 196 ALVEGQLLSGSD-DHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVS 254
              +G+LL   D    V++++  +  T +  +    +  +   +  K+H  + K+  T S
Sbjct: 91  N--DGKLLCAGDATGLVSVYDSYNPRTILLSI----NASTHPTHVTKFHTQDNKILATAS 144

Query: 255 EDSLLKINDV-RAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNM-RE 312
           +D + ++ D+  A+   ++         TL+F   + +L+A    D  + LYD R+    
Sbjct: 145 DDRVTRLWDISHAYEPQLELTGATDYVRTLSFIPDAPHLVATGSYDGLIRLYDTRSSGSS 204

Query: 313 PLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
           P++ ++ H+  + +I   T            N   +WDL
Sbjct: 205 PIYSLN-HDQPIEDI---TAVSPTQIVSCGGNNFKVWDL 239

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 113/278 (40%), Gaps = 57/278 (20%)

Query: 154 PQNPDFVATLNGQGTVFLY--SRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTV 211
           P +   +A+ +  GT+ ++  SR   L  TL  H ++   + +    EG L SGS D TV
Sbjct: 247 PGSKPRLASASKDGTIRIWDSSRRVCLM-TLGGHTNSVSCVKWGG--EGILYSGSHDKTV 303

Query: 212 ALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIN-----DVRA 266
             W++  N   I+ +++    H+  VN +           ++S D  L++       V+ 
Sbjct: 304 RAWDMKQNGKCINILKS----HAHWVNHL-----------SLSTDYALRVGAFDYTGVKP 348

Query: 267 HNITIDAVKCPQPFNTLAFSHHS-SNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVT 325
            N      K  Q +  +A  +     L+  A  D  ++L++     +P+  M+GH+  V 
Sbjct: 349 ANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVN 408

Query: 326 NIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFD 385
           ++ FS             N + +WD    G E T           +    GH +SV    
Sbjct: 409 HVAFSP-DGKYIVSASFDNSIKLWD----GKEGT----------FLSTFRGHVASV---- 449

Query: 386 LNAQIPW-----LVASSEEENILQVW-----KCSHNLP 413
              Q+ W     L+ S  ++  L+VW     K S +LP
Sbjct: 450 --YQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLP 485

>Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON}
           (67445..69169) [1725 nt, 575 aa]
          Length = 574

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 69/150 (46%), Gaps = 13/150 (8%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +L+ N      L S S DHTV LW++ S + +    R+   +HS+  V+  +WH
Sbjct: 285 HTDAVLSLAHNKHFRSVLASTSADHTVKLWDLNSGTAA----RSIASIHSNKNVSASEWH 340

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNIT----IDAVKCPQPFNTLAFSHHSSNLLAAAGMD 299
             +  +  T   DS L + DVR  + +      +V   +      F+  S NL+      
Sbjct: 341 MSHGSILLTGGYDSRLALTDVRISDESNMSKYWSVMGGEEIEAATFA--SENLILCGTDS 398

Query: 300 SHVYLYDLRNMR--EPLHHMSGHEDAVTNI 327
            +VY +D+RN    +P+  +  H+  ++ +
Sbjct: 399 GNVYSFDIRNNEGSKPVWTLKAHDAGISTL 428

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 58/130 (44%), Gaps = 14/130 (10%)

Query: 283 LAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXX 342
           + FS    ++LA   +D++V+ +D+R+ + P +  S  + +   ++++ H          
Sbjct: 120 INFSPQHPDILATCSIDTYVHAWDMRSPQRPFYSTSSWKSSAAQVKWN-HSDVNIMASSH 178

Query: 343 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENI 402
            + + +WDL+            +G   L  + + H SSVN  D N      + SS  +  
Sbjct: 179 GDDVFIWDLR------------NGSTPLFKL-SSHESSVNSIDFNRFRSTEIMSSSNDGT 225

Query: 403 LQVWKCSHNL 412
           ++ W  S N+
Sbjct: 226 VKFWDYSRNV 235

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 58/132 (43%), Gaps = 22/132 (16%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQ-PFNT--------- 282
           HS  + DI +   +  +  T S D+ +   D+R+          PQ PF +         
Sbjct: 113 HSRAITDINFSPQHPDILATCSIDTYVHAWDMRS----------PQRPFYSTSSWKSSAA 162

Query: 283 -LAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXX 341
            + ++H   N++A++  D  V+++DLRN   PL  +S HE +V +I+F+           
Sbjct: 163 QVKWNHSDVNIMASSHGDD-VFIWDLRNGSTPLFKLSSHESSVNSIDFNRFRSTEIMSSS 221

Query: 342 XXNRLIMWDLKQ 353
               +  WD  +
Sbjct: 222 NDGTVKFWDYSR 233

>KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 437

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 63/125 (50%), Gaps = 8/125 (6%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS+D T+ +W++ S    ++        H   V  I     +  +F + SED L+K  D
Sbjct: 143 TGSNDTTIKVWDLASGKLKLTLAG-----HVMTVRSIAISQRHPLMF-SASEDKLVKCWD 196

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +  + +  D        +T+   H + +L+A+AG D+ V L+D+R  R P+  ++GH+  
Sbjct: 197 LEKNTVVRDYHGHFSGVHTVDV-HPTLDLIASAGRDAVVRLWDIRT-RVPVMTLAGHKGP 254

Query: 324 VTNIE 328
           +  ++
Sbjct: 255 INQVK 259

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 71/150 (47%), Gaps = 14/150 (9%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDL-HSDIVNDIKWH 243
           H D   +L+ N L    L S S D TV LW++ S + +    R+ N + H   V+  +WH
Sbjct: 292 HTDAVLSLAHNQLFRAILASTSADSTVKLWDLNSGTAA----RSLNQVHHGSRVSSSQWH 347

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNITIDA----VKCPQPFNTLAFSHHSSNLLAAAGMD 299
             +  +  T   DS + + DVR  +    +    V   +   T +F +  + L   AG D
Sbjct: 348 QTDGSILLTAGYDSKIALTDVRISDEKNMSKYWNVMSGEEIETASFINDYTVL---AGTD 404

Query: 300 S-HVYLYDLRNMR-EPLHHMSGHEDAVTNI 327
           + +VY +D+R++  +PL  +  H+  +  +
Sbjct: 405 NGNVYSFDVRSVESKPLWTLKAHDAGIAGL 434

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 120/296 (40%), Gaps = 65/296 (21%)

Query: 143 HEEEITRARYMP-------QNPDFVATLNGQGTVFLYSRSGGLQ-STLKFHKDNGYALSF 194
           H + IT   + P       Q P   A+ +  GT+ ++  +G +   TL  H  +   + +
Sbjct: 227 HSKWITSLAWEPLHLVKVGQKPRL-ASASKDGTIKVWDTTGRVCLYTLSGHTSSVSCVRW 285

Query: 195 NALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVS 254
               +  L +GS D T+ +W++ SN   I+ +++    H+  VN +           ++S
Sbjct: 286 GG--QNMLYTGSHDKTIRVWDMNSNGRCINILKS----HAHWVNHL-----------SLS 328

Query: 255 EDSLLKINDVRAHNITIDAV------KCPQPFNTLAFSH-HSSNLLAAAGMDSHVYLYDL 307
            D  L+I     H+    A+      K  + +  +   + H+  L+  A  D  ++L++ 
Sbjct: 329 TDYALRIGPFD-HSGAKPAIAEEARDKALKNYEKIVKKNGHTEELMVTASDDFTMFLWNP 387

Query: 308 RNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGV 367
               +PL  M+GH+  V ++ FS             N + +W            D  DG 
Sbjct: 388 LKSTKPLARMTGHQKLVNHVAFSP-DGRHIVSASFDNSIKLW------------DGRDG- 433

Query: 368 PELIMVHAGHRSSVNDFDLNAQIPW-----LVASSEEENILQVW-----KCSHNLP 413
            + I    GH +SV       Q+ W     L+ S  ++  L+VW     K S +LP
Sbjct: 434 -KFISTFRGHVASV------YQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLP 482

>KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {ON}
           conserved hypothetical protein
          Length = 309

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 67/152 (44%), Gaps = 13/152 (8%)

Query: 184 FHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWH 243
           +H  N    + +AL +   ++GS D  +AL ++ +       +R     H  +VN ++  
Sbjct: 55  YHHGNAAITALDALGDRCAVTGSSDTRLALCDLETGQL----LRGLAG-HRRVVNQVR-- 107

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVY 303
              E  F +V +D  LK+ D       +       P   +A    + +L+ A+G++  + 
Sbjct: 108 ALGESRFASVGDDGALKVWDASGAKRPVWQAASEFPLFAVAQDPQNEHLVYASGLEPVIR 167

Query: 304 LYDLRNMREPLHHMS----GHEDAVTNIEFST 331
            YDLR  R   H  S     H DAVT+++ S 
Sbjct: 168 AYDLR--RSADHAFSSWPAAHSDAVTSLDVSA 197

>KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa]
           {ON} Anc_4.309 YLR429W
          Length = 620

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 61/127 (48%), Gaps = 15/127 (11%)

Query: 194 FNALVEGQLLSGSDDHTVALWEVGSNST------------SISPVRTWNDLHSDIVNDIK 241
           F+   + ++ S SDD  +A+WE+  + +             + PV+ W   H   V  + 
Sbjct: 89  FDPFNDRRIASCSDDSKIAIWEIPEDYSFHKYVDADNEPKDVKPVK-WLAGHGRKVGHVL 147

Query: 242 WHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH 301
           +H   E +  + S D  +KI +V    + +  +K P    +++FS++ ++ LA  G D  
Sbjct: 148 FHPVAENILASSSLDYTVKIWNVETGEV-VYTLKHPDMVTSMSFSYNGAH-LATVGRDKK 205

Query: 302 VYLYDLR 308
           + ++D+R
Sbjct: 206 LRVWDIR 212

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 54/128 (42%), Gaps = 12/128 (9%)

Query: 189 GYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEK 248
           G+ L F+ + E  L S S D+TV +W V +          +   H D+V  + + ++N  
Sbjct: 144 GHVL-FHPVAENILASSSLDYTVKIWNVETGEV------VYTLKHPDMVTSMSF-SYNGA 195

Query: 249 LFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGM----DSHVYL 304
              TV  D  L++ D+RA  I  +                +S+ LA  G     D  + +
Sbjct: 196 HLATVGRDKKLRVWDIRAEKIVSEGAAHAGAKTQRVIWLGNSDRLATTGFSRLSDRQIGI 255

Query: 305 YDLRNMRE 312
           +D  N+ +
Sbjct: 256 WDAFNLEK 263

>TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {ON}
           Anc_8.672 YPL151C
          Length = 414

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 61/125 (48%), Gaps = 8/125 (6%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS D T+ +W++ S    I+        H   V DI     +  LF + SED L+K  D
Sbjct: 120 TGSSDTTIKIWDLESGKLKITL-----SGHVMPVRDIAISKRSPYLF-SASEDKLIKCWD 173

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +  +    +        NT+   H + +L+A AG DS + L+D+R+ R  +  + GH+  
Sbjct: 174 LEKNMAIREYFGHLSGVNTVDV-HPTLDLIATAGRDSTIRLWDIRS-RTAVMTLIGHKAP 231

Query: 324 VTNIE 328
           VT ++
Sbjct: 232 VTTVK 236

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 248 KLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDL 307
           K F T S D+ +KI D+ +  + I       P   +A S  S  L +A+  D  +  +DL
Sbjct: 116 KWFATGSSDTTIKIWDLESGKLKITLSGHVMPVRDIAISKRSPYLFSAS-EDKLIKCWDL 174

Query: 308 -RNM--REPLHHMSG 319
            +NM  RE   H+SG
Sbjct: 175 EKNMAIREYFGHLSG 189

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 64/129 (49%), Gaps = 8/129 (6%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
            ++GS+D T+ +W++ S    ++        H+  V D+     +  +F + SED L+K 
Sbjct: 102 FVTGSNDTTLKVWDLASGKLKLTL-----SGHTMGVRDVAVSERHPYMF-SASEDKLVKC 155

Query: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321
            D+  +    D        +T+   H + +L+A  G D+ V L+D+R  R+ +  + GH+
Sbjct: 156 WDLEKNTAIRDYYGHLSGVHTVDI-HPTLDLIATGGRDAVVKLWDIRT-RKAVKTLVGHK 213

Query: 322 DAVTNIEFS 330
             +T ++ +
Sbjct: 214 APITKVKCT 222

>AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR429W
           (CRN1); 1-intron
          Length = 633

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 16/130 (12%)

Query: 189 GYALSFNALVEGQLLSGSDDHTVALWEV--GSNSTSISPVRTWNDLHSDIVNDIKWHNFN 246
           G+ L ++   +G L S S DHTV LW V  G+N   ++        H D+V  + + ++ 
Sbjct: 144 GHVL-YHPTAQGVLASSSLDHTVRLWNVEQGTNPIVLT--------HPDMVTSMSF-SYG 193

Query: 247 EKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGM----DSHV 302
                TV  D +L++ D+R   +  + +    P N       +S+ LA  G     D  +
Sbjct: 194 GTYLATVCRDKMLRVWDIRKGEVVSEGMGHSGPKNQRVVWLGNSDRLATTGFSKLSDRQI 253

Query: 303 YLYDLRNMRE 312
            ++D  N+ +
Sbjct: 254 AVWDAFNLEK 263

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 55/128 (42%), Gaps = 15/128 (11%)

Query: 194 FNALVEGQLLSGSDDHTVALWEVGS------------NSTSISPVRTWNDLHSDIVNDIK 241
           F+   E  L+SGSDD  + +WE+ +            N   ++PV+     H   V  + 
Sbjct: 89  FDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPVKFLTG-HQRKVGHVL 147

Query: 242 WHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH 301
           +H   + +  + S D  +++ +V      I  +  P    +++FS +    LA    D  
Sbjct: 148 YHPTAQGVLASSSLDHTVRLWNVEQGTNPI-VLTHPDMVTSMSFS-YGGTYLATVCRDKM 205

Query: 302 VYLYDLRN 309
           + ++D+R 
Sbjct: 206 LRVWDIRK 213

>TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {ON}
           Anc_7.356 YLR196W
          Length = 582

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 69/150 (46%), Gaps = 13/150 (8%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +LS N      L S S DHTV +W++ S   +    R+   +H++  V+  +WH
Sbjct: 289 HTDAILSLSHNKHFRSVLASTSADHTVKIWDLNSGDAA----RSLASIHNNTNVSSSEWH 344

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNITID----AVKCPQPFNTLAFSHHSSNLLAAAGMD 299
             N  +  T   DS + ++DVR  + +      +V   +   T  F+    N++      
Sbjct: 345 WTNGSILLTSGYDSRVALSDVRISDESQMSKYWSVMGGEDIETATFADE--NIILCGTDA 402

Query: 300 SHVYLYDLRN--MREPLHHMSGHEDAVTNI 327
            +VY +D+RN    +P+  +  H+  ++ +
Sbjct: 403 GNVYSFDVRNGDASKPVWTLKAHDAGISTL 432

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 105/266 (39%), Gaps = 45/266 (16%)

Query: 160 VATLNGQGTVFLY--SRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVG 217
           +A+ +  GT+ ++  SR   L  TL  H ++   + +    +G L +GS D T+ +W++ 
Sbjct: 251 LASASKDGTIKIWDASRRTCLY-TLSGHTNSVSCVKWGG--QGLLYTGSHDKTIRVWDIK 307

Query: 218 SNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCP 277
           +    I+ +++    H+  VN +          G    D     +   A +I     +  
Sbjct: 308 AGGKCINILKS----HAHWVNHLSLSTDYAIRVGPFGPDGKASPSPQEARDIAKKNYE-- 361

Query: 278 QPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXX 337
                +  S     L+  A  D  ++L++     +PL  M+GH+  V ++ FS       
Sbjct: 362 ---KVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSPD-GRYI 417

Query: 338 XXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPW----- 392
                 N + +W            D  DG  + I    GH +SV       Q+ W     
Sbjct: 418 VSASFDNSIKLW------------DGRDG--KFIATFRGHVASVY------QVAWSSDCR 457

Query: 393 LVASSEEENILQVW-----KCSHNLP 413
           L+ S  ++  L+VW     K S +LP
Sbjct: 458 LLVSCSKDTTLKVWDVKTRKLSVDLP 483

>Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]
           {ON} YLR196W (PWP1) - similar to beta-transducin
           superfamily [contig 161] FULL
          Length = 561

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 75/157 (47%), Gaps = 27/157 (17%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDIKWH 243
           H D   +LS +      L S S DHTV LW++ +   +    R++  +HS+  V+  +WH
Sbjct: 274 HTDAVLSLSHSKQFRAVLASTSADHTVKLWDLNAGIAA----RSFASIHSNKNVSSSQWH 329

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHN----------ITIDAVKCPQPFNTLAFSHHSSNLL 293
           + +  +  T   DS + + DVR  +          ++ + V+C Q      F+  ++ + 
Sbjct: 330 STSGSVLLTGGYDSRIALTDVRIADDSQMSKYWSVMSGEEVECVQ------FADENTIM- 382

Query: 294 AAAGMDS-HVYLYDLRNMR--EPLHHMSGHEDAVTNI 327
              G DS +VY YD+R     +PL  ++ H+  ++ +
Sbjct: 383 --CGTDSGNVYSYDIRQGEGSKPLWTLNAHDAGISTL 417

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 81/158 (51%), Gaps = 19/158 (12%)

Query: 181 TLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIV--N 238
           ++ F  DN + L    L    LL+   + +V L +   N   IS ++      SD+V  N
Sbjct: 8   SINFGADN-WCLKLQPLYNRGLLASLSNGSVQLIDWVKNK-QISQIQAHGTTISDMVVLN 65

Query: 239 DIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQ--PFNTLAFSHHSSNLLAA- 295
           + + + F   L  T +EDS+ KI D+R+ + T+  +K  +  PF +L   H    +LA  
Sbjct: 66  NDRNNGF---LIATAAEDSV-KIFDLRSSD-TVATLKNEKSAPFLSLDSRH---GMLACG 117

Query: 296 ---AGMDSHVYLYDLRNMREPLHHM-SGHEDAVTNIEF 329
              +G+D+ +++YD++   +PL  +   H D +TNI+F
Sbjct: 118 TELSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKF 155

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 90/200 (45%), Gaps = 26/200 (13%)

Query: 147 ITRARYMPQNPDFVATLNGQGTVFLYSRSG----GLQSTLKFHKDNGYALSFNALVEGQL 202
           +T +   PQ  +F+ +     TV L+S +      ++   + + D G   +F+    G+ 
Sbjct: 118 VTPSYLSPQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFH----GEH 173

Query: 203 LSGSDDH------------TVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLF 250
              S DH             + LW+  + S  IS + +W    +D +N ++++     + 
Sbjct: 174 AFQSLDHHRQKSNFVTGGAQIELWDT-NRSKPISNL-SWG---ADNINHVRFNQNEVDIL 228

Query: 251 GTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNM 310
            +   D+ + + D+R ++ T   V+  +  N++ ++   +     A  D + Y YD+RNM
Sbjct: 229 ASTGSDNSVVLYDLRTNSPTQKIVQTMRT-NSICWNPVEAFNFVIANEDHNAYYYDMRNM 287

Query: 311 REPLHHMSGHEDAVTNIEFS 330
            + LH    H  AV +++FS
Sbjct: 288 SKALHVFKDHVSAVMDVDFS 307

>NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}
           Anc_1.534 YKL213C
          Length = 722

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 65/136 (47%), Gaps = 7/136 (5%)

Query: 174 RSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLH 233
           ++G L+  LK H+ + +       VE + +S S D T+ +WE   N+ +I   +T   +H
Sbjct: 130 QNGSLKYDLKGHEASVWCAKSFPGVENKYVSVSADQTIKIWE---NNVAI---KTLGGIH 183

Query: 234 SDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLL 293
           +D++  ++    N     T S DS +K++++ +  I I      + F       + SN L
Sbjct: 184 TDVIRRVEISKSNPNEIITCSNDSTIKLSNIESGEI-IRNWCGHESFVYSVKQFNLSNDL 242

Query: 294 AAAGMDSHVYLYDLRN 309
            + G D  V ++D  N
Sbjct: 243 VSCGEDRSVIIWDSNN 258

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 59/122 (48%), Gaps = 10/122 (8%)

Query: 211 VALWEVGSNSTSISPVR--TWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHN 268
           + LW+    ST   P+   +W    +D V+ +K++     +F +   D+ + + D+R ++
Sbjct: 196 INLWD----STRSRPITNLSWG---ADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNS 248

Query: 269 ITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIE 328
            T   V+  +  N L ++   +     A  D + Y YD+RN+   LH    H  AV +++
Sbjct: 249 PTQKFVQKMRT-NALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVD 307

Query: 329 FS 330
           FS
Sbjct: 308 FS 309

>Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [contig
           163] FULL
          Length = 369

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 76/148 (51%), Gaps = 14/148 (9%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHN 244
           H+ +    +F+ L + + ++GS D  +AL ++ +       +R +   H+ +VN ++   
Sbjct: 117 HRRSAAITTFDTLDDTRAVTGSSDTRLALVDLHTGR----KLRNFAG-HTRVVNQVR--A 169

Query: 245 FNEKLFGTVSEDSLLKINDVRAHNIT-IDAVKCPQPFNTLAFSHHSS--NLLAAAGMDSH 301
            N   F +VS+D  LKI D  AH  + +  +    P  TL  S  SS  N+L  +G+D  
Sbjct: 170 LNTDRFASVSDDGALKIWD--AHTKSPVWQISSEFPLFTLTSSSSSSDDNILYTSGLDPV 227

Query: 302 VYLYDLR--NMREPLHHMSGHEDAVTNI 327
           +  YDLR  N +E  +  + H D+VT+I
Sbjct: 228 IRAYDLRQNNGQELFNWSTPHTDSVTSI 255

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 1/96 (1%)

Query: 235 DIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLA 294
           D V+ ++++   E +  +   D+ + + D+R ++ T   V+  +  N L ++       A
Sbjct: 217 DNVSFVRFNQNEEDILASTGSDNSIVLYDLRTNSPTQKVVQRMRT-NALCWNPMEPFNFA 275

Query: 295 AAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
            A  D + Y YD+RNM   LH    H  AV +++FS
Sbjct: 276 IANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFS 311

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 78/192 (40%), Gaps = 34/192 (17%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNS-------------------TSISP 225
           H+D  Y L+ N  V  +L SGS D  V  W + +                     T +SP
Sbjct: 66  HRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLSP 125

Query: 226 VRTWNDLHSDIVND--IKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTL 283
            +  +       +D  IK  + N   F ++ +D+ + ++D      T D       +   
Sbjct: 126 TKK-DSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKI-VSD------TGDGALLKTFYGEH 177

Query: 284 AFS---HHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXX 340
           AF    HH  N     G  + + L+D+ N ++PL ++S   D V+ + F+ +        
Sbjct: 178 AFQSIDHHRRNPNFVTG-GAQIQLWDV-NRKKPLSNLSWGVDNVSFVRFNQNEEDILAST 235

Query: 341 XXXNRLIMWDLK 352
              N ++++DL+
Sbjct: 236 GSDNSIVLYDLR 247

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 81/184 (44%), Gaps = 11/184 (5%)

Query: 147 ITRARYMPQNP-DFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALVEGQLLSG 205
           +T   + PQ P DF  T + +  VF  SR+     T    KD  Y+ S+    +G+LL  
Sbjct: 42  VTHVAFNPQKPHDFAVTSSTRVQVF-SSRTRQAIKTFSRFKDVVYSASYRK--DGKLLCA 98

Query: 206 SD-DHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDV 264
            D    V++++  +  T +  V      H   V   K+H+ + K   + S+D + ++ D+
Sbjct: 99  GDATGLVSVYDSYNPRTLLVSVAASQ--HPTHVT--KFHDHDLKTLVSASDDRVTRVWDI 154

Query: 265 -RAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
             A+   ++         TL F   + +L+     D  + LYD R   +P H +  H+  
Sbjct: 155 SHAYEPQLELTGAADYVRTLCFVPAAPHLVVTGSYDGALRLYDTRAGSKPQHTLV-HDQP 213

Query: 324 VTNI 327
           V N+
Sbjct: 214 VENV 217

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 62/120 (51%), Gaps = 6/120 (5%)

Query: 211 VALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNIT 270
           + LW++ + S  +S + +W    +D +N +K++  +  + G+   D+ + + D+R ++ T
Sbjct: 198 INLWDI-NRSKPLSDL-SWG---ADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSAT 252

Query: 271 IDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
              V+  +  N++ ++   +     A  D + Y YD+RNM   L+    H  AV +++ S
Sbjct: 253 QKIVQTMR-VNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDIS 311

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 14/117 (11%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLL-- 259
           +LS SDD TV LW V  N    + V     +++D  N +  H + E  F  +    +   
Sbjct: 135 VLSSSDDKTVKLWSV--NHEDFAHVDNDQVINTD--NGLIKHYYGEHAFQGLDHSRMTSN 190

Query: 260 ------KIN--DVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR 308
                 +IN  D+       D        NT+ F+ + +N+L +AG D+ + LYDLR
Sbjct: 191 FVTGGPRINLWDINRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLR 247

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 59/120 (49%), Gaps = 6/120 (5%)

Query: 211 VALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNIT 270
           + LW+  S S  IS + TW    +D V ++K++     +  +   D+ + + D+R ++ T
Sbjct: 195 IQLWD-SSRSKPISNL-TWG---ADNVTNVKFNQTETDILASTGSDNSIVLYDLRTNSPT 249

Query: 271 IDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
              V+  +  N + ++   +     A  D + Y YD+RNM   L+    H  AV +++FS
Sbjct: 250 QKIVQSMRS-NAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFS 308

>AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YJL112W (MDV1) and YKR036C
           (CAF4)
          Length = 715

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 72/172 (41%), Gaps = 36/172 (20%)

Query: 181 TLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDI 240
           T   H D   ALSF A     L+SGS D T+  W++ +       V+T +      +N  
Sbjct: 500 TFDSHIDEITALSFEA---NNLVSGSQDRTIRQWDLNNGKC----VQTLD------INFA 546

Query: 241 KWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDS 300
              N +  + G+      L  N+   H I I A++C                LA    D 
Sbjct: 547 TGGNLSRSMIGS----GFLNTNN--DHPI-IGAIQCYDA------------ALATGTKDG 587

Query: 301 HVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLK 352
            V L+DLR+ R  +  + GH DAVT+++F +            N + +WDL+
Sbjct: 588 IVRLWDLRSGR-VVRTLEGHSDAVTSLQFDS---LNLVTGSLDNSIRIWDLR 635

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 160 VATLNGQGTVFLYS-RSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEV 216
           +AT    G V L+  RSG +  TL+ H D   +L F++L    L++GS D+++ +W++
Sbjct: 580 LATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSL---NLVTGSLDNSIRIWDL 634

>NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.356
           YLR196W
          Length = 607

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 68/147 (46%), Gaps = 7/147 (4%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHN 244
           H D   +LS N      L S S DHTV LW++ + + + S     N+ +   V+  +WH 
Sbjct: 322 HTDAVLSLSHNKQFRAVLASTSADHTVKLWDLNTATAARSLASIHNNKN---VSSSEWHV 378

Query: 245 FNEKLFGTVSEDSLLKINDVR-AHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDS-HV 302
            N  +  T   DS + ++DVR +    +       P   +  +  +   +   G D+ ++
Sbjct: 379 SNGSILLTGGYDSRIALSDVRISDEKQMSKYWSVMPGEEIECTTFADENIILCGTDAGNI 438

Query: 303 YLYDLRNMR--EPLHHMSGHEDAVTNI 327
           Y +D+RN    +P+  +  H+  ++++
Sbjct: 439 YSFDIRNNENSKPVWTLKAHDAGISSL 465

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 92/228 (40%), Gaps = 34/228 (14%)

Query: 191 ALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLF 250
           +  +N +    ++S S D T  +W++ S+      V+T    H   V D+++   + +LF
Sbjct: 248 SFDWNTVDTNLIISSSIDTTCIVWDLQSSHY----VKTQLIAHDSEVFDVRFLTKSTQLF 303

Query: 251 GTVSEDSLLKINDVR--AHNI-----------------TIDAVKCPQPFNTLAFSHHSSN 291
            +   D  +++ D+R  AH+                  T  ++K       L  S +  N
Sbjct: 304 ASCGGDGSVRVFDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPN 363

Query: 292 LLAAAGMDSH-VYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           +LA    DS+ + + D+RN   P+ ++ GH  +V  I++               + + WD
Sbjct: 364 VLATFAADSNKIIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWD 423

Query: 351 LKQIGAEQTPDDA----------EDGVPELIMVHAGHRSSVNDFDLNA 388
           L     E    D+          ED   + +M   G +++  +  LN+
Sbjct: 424 LNNSFMEINGSDSKSPTASGASLEDSDGDTVMADGGAKANQQEDPLNS 471

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 56/261 (21%), Positives = 99/261 (37%), Gaps = 53/261 (20%)

Query: 45  SNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGEEENYLKFAEI 104
           SN  L ++ V +  + +P   +QW+P+ +   +       L I       EE +L+  ++
Sbjct: 160 SNDLLSWENVVDANVVYPVSKIQWVPSQLHPRKLATCSDSLRI--WNVNPEERHLQ-EQV 216

Query: 105 NIPKEILNNQDPQEEAEEDDKATL-----------NAPKSNIRITAK------------- 140
           N+     N Q P   A  DD   +           N   +N+ I++              
Sbjct: 217 NLSLCKYNRQHPTSPATADDMKVIGTFPPITSFDWNTVDTNLIISSSIDTTCIVWDLQSS 276

Query: 141 -YV------HEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALS 193
            YV      H+ E+   R++ ++    A+  G G+V ++       ST+ +   +  A  
Sbjct: 277 HYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSPASG 336

Query: 194 FNALVEGQLLSGS-----------DDHTVALWEVGSNSTSI-------SPVRTWNDLHSD 235
            NA      L GS           D + +A +   SN   I       SP+    + H+ 
Sbjct: 337 PNAGATTPSLKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNL-EGHTC 395

Query: 236 IVNDIKWHNFNEKLFGTVSED 256
            VN+IKWH     +  + S+D
Sbjct: 396 SVNEIKWHPTKRNVLLSCSDD 416

>KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {ON}
           similar to uniprot|Q06440 Saccharomyces cerevisiae
           YLR429W CRN1 Coronin cortical actin cytoskeletal
           component that associates with the Arp2p/Arp3p complex
           to regulate its activity
          Length = 707

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 54/119 (45%), Gaps = 15/119 (12%)

Query: 202 LLSGSDDHTVALWEVG------------SNSTSISPVRTWNDLHSDIVNDIKWHNFNEKL 249
           + SGSDD  + +WE+              N   + PVR  +  HS  V  + +H   E +
Sbjct: 109 VASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRMLSG-HSRKVGHLLFHPLAENI 167

Query: 250 FGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR 308
             + S D  +KI D+    +    +K P    +++FS+   +L+  +  D  + ++D+R
Sbjct: 168 LASSSLDYTVKIWDISQEEVKF-TLKHPDMVTSMSFSYDGKHLVTVS-RDKKLRVWDVR 224

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 7/78 (8%)

Query: 192 LSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFG 251
           L F+ L E  L S S D+TV +W++       +        H D+V  + + +++ K   
Sbjct: 158 LLFHPLAENILASSSLDYTVKIWDISQEEVKFTL------KHPDMVTSMSF-SYDGKHLV 210

Query: 252 TVSEDSLLKINDVRAHNI 269
           TVS D  L++ DVRA  I
Sbjct: 211 TVSRDKKLRVWDVRAEKI 228

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 55/269 (20%), Positives = 105/269 (39%), Gaps = 36/269 (13%)

Query: 144 EEEITRAR---YMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALVEG 200
           E + TRA+   + P  P  +  L          R G L    + H+     + F+   + 
Sbjct: 8   ESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRYEDHEGPVRGIDFHP-TQP 66

Query: 201 QLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
             +S  DD+T+ +W + +N    +      D H D V  + +H     +  + S+D  ++
Sbjct: 67  LFVSAGDDYTIKVWSLETNKCLYTL-----DGHLDYVRTVFFHKELPWII-SASDDQTIR 120

Query: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGH 320
           I + +     I  +     F   A  H + +L+ +A +D  V ++D+  +RE  H   G 
Sbjct: 121 IWNWQNRK-EIACITGHNHFVMCAQFHPTEDLIVSASLDETVRVWDISKLREK-HSAPGR 178

Query: 321 EDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSS 380
               T+ E                       ++I A+Q   D   G   +  +  GH   
Sbjct: 179 SAMPTSFE-----------------------EKIAAQQNLLDGGFGDCTVKFILEGHTRG 215

Query: 381 VNDFDLNAQIPWLVASSEEENILQVWKCS 409
           VN    +  +P +V+  ++  + ++WK S
Sbjct: 216 VNWASFHPTLPLIVSGGDDRQV-KLWKMS 243

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 8/114 (7%)

Query: 202 LLSGSDDHTVALWEVGSNST-SISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
           ++SG DD  V LW++ +     +   R     H++ V+ + +H   + L  +V ED  L+
Sbjct: 228 IVSGGDDRQVKLWKMSATKAWELDSCRG----HTNNVDSVIFHP-TQNLILSVGEDKTLR 282

Query: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPL 314
           + D+          +    F  +A +H + NL  AA  DS + ++ L   R P 
Sbjct: 283 VWDLDKRTPVKQFKRENDRFWLIA-AHPNINLFGAA-HDSGIMIFKLDRERPPF 334

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 109/295 (36%), Gaps = 74/295 (25%)

Query: 103 EINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAK-------YVHEEEITRARYMPQ 155
           E  +P+ +     P E A E  KA LNA K   R+ AK       Y H + +       +
Sbjct: 21  ESQLPRNLNPELHPFERAREYTKA-LNATKME-RMFAKPFVGQLGYGHRDGVYVIAKNYK 78

Query: 156 NPDFVATLNGQGTVFLYSRSGGLQ-STLKFHKDNGYALSFNALV----------EGQLLS 204
           N + +AT +  G V  ++ S   +  + K H    Y L     V          E  +LS
Sbjct: 79  NLNKLATGSADGVVKYWNMSTREELCSFKAH----YGLITGLCVTPEHLSKQKNENFMLS 134

Query: 205 GSDDHTVALWEVGSNS---------------------------------------TSISP 225
            SDD TV LW V S                                         T  + 
Sbjct: 135 CSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGIDHHRSKSNFVTGGAK 194

Query: 226 VRTWNDLHSDIVNDIKWH-------NFNEK---LFGTVSEDSLLKINDVRAHNITIDAVK 275
           ++ W+   S  + D+ W         FN+    +  +   D+ L + D+R ++ T   V+
Sbjct: 195 IQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQKIVQ 254

Query: 276 CPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
             +  N + ++   +     A  D + Y YD+RNM   L+    H  AV +++FS
Sbjct: 255 TMRT-NAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFS 308

>KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa]
           {ON} Anc_4.309 YLR429W
          Length = 634

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 58/128 (45%), Gaps = 15/128 (11%)

Query: 194 FNALVEGQLLSGSDDHTVALWEV------------GSNSTSISPVRTWNDLHSDIVNDIK 241
           F+   + +L SGSDD  + +W++              +   I PV+     HS  V  + 
Sbjct: 89  FDPFNQRRLASGSDDSKIGIWDIPEDYSFHNYLDSNGDPKDIKPVKMLAG-HSRKVGHVL 147

Query: 242 WHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH 301
           +H   + +  + S D  +KI +V    +    +K P    +++FS++ ++ LA    D  
Sbjct: 148 YHPLAQDILASSSLDYTVKIWNVETGEVLF-TLKHPDMVTSMSFSYNGAH-LATVARDKK 205

Query: 302 VYLYDLRN 309
           + ++D+R 
Sbjct: 206 LRVWDVRK 213

>Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429W
           (REAL)
          Length = 645

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 58/130 (44%), Gaps = 15/130 (11%)

Query: 194 FNALVEGQLLSGSDDHTVALWEVGSN------------STSISPVRTWNDLHSDIVNDIK 241
           F+   + ++ SGSDD  + +W +  N               I PV+     H+  V  I 
Sbjct: 89  FDPFDDHRIASGSDDSKIGIWNIPENYKFHDHADEDGEPIDIKPVKFLTG-HARKVGHIL 147

Query: 242 WHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH 301
           +H   + +  + S D+ +K+ DV      I  +K P    +++FS +  N LA    D  
Sbjct: 148 YHPVAKNVLASSSGDNTVKLWDVETGKDMI-TLKHPNMVTSMSFS-YDGNHLATVARDKK 205

Query: 302 VYLYDLRNMR 311
           + ++++R+ R
Sbjct: 206 LRVWNIRDGR 215

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 10/173 (5%)

Query: 142 VHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTL-KFHKDNGYALSFNALVEG 200
            H+  +   +Y     D++ + +  GT+ ++  +  +   L + H      +SF+   + 
Sbjct: 123 AHDSAVAVMKYS-HAGDWLISGDSDGTIKIWQPNFNMVKVLDEAHTQCIRGISFSG-TDS 180

Query: 201 QLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
           + ++ SDD+ + +W   SN    S   T +  H D V    WH     L  + S+D+L+K
Sbjct: 181 KFVTCSDDNILKIWNF-SNGQQES---TLSGHHWD-VRSCDWHP-TMGLIASGSKDNLVK 234

Query: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR-NMRE 312
           + D RA       + C     +  F     N+LA    D    ++D+R NM+E
Sbjct: 235 LWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKE 287

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 73/171 (42%), Gaps = 25/171 (14%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
           L+S S D T  +W++ S++     V+T    H   V D+++   + +LF +   D  +++
Sbjct: 251 LISSSIDTTCIVWDLQSSNY----VKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRV 306

Query: 262 NDVR--AHNITIDAVKCPQPFN------------------TLAFSHHSSNLLAAAGMDSH 301
            D+R  AH+  I      +P                     L  S H  N+LA   + S+
Sbjct: 307 FDLRCLAHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFAIASN 366

Query: 302 -VYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
            + + D+RN   PL  ++GH  ++  I++               +++ WD+
Sbjct: 367 EILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDI 417

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 77/199 (38%), Gaps = 39/199 (19%)

Query: 133 SNIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYAL 192
           SN   T    H+ E+   R++ Q+    A+  G G+V ++       ST+ +        
Sbjct: 268 SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPPASEPG 327

Query: 193 SFN-------------ALVEGQLLSGSDDHTVALWEVGSNSTSI-------SPVRTWNDL 232
           + N             AL+  +  S  D + +A + + SN   I       SP+   N  
Sbjct: 328 TGNNSSRSDSTDENSHALLRLE-PSPHDPNVLATFAIASNEILILDMRNPDSPLVVLNG- 385

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNL 292
           HS  +N IKWH   +    + S+D  +   D+ ++            F+  A SH ++  
Sbjct: 386 HSASINQIKWHPTKKNTLISCSDDCQVLFWDISSY------------FDQGAVSHTTTPR 433

Query: 293 LAAAGMDSHV-----YLYD 306
            AA+G    V     Y YD
Sbjct: 434 PAASGASMEVDSEGDYSYD 452

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 77/176 (43%), Gaps = 21/176 (11%)

Query: 191 ALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLF 250
           +  +N +    L+S S D T  +W++ S++     V+T    H   V D+++   + +LF
Sbjct: 253 SFHWNPIDTNLLISSSIDTTCIIWDLESSNY----VKTQLIAHDSEVFDVRFLTQSTQLF 308

Query: 251 GTVSEDSLLKINDVR--AHNITIDAVKCPQPFN------------TLAFSHHSSNLLAAA 296
            +   D  +++ D+R  AH+  I   + P   +             L  S H  N++A  
Sbjct: 309 ASCGGDGSVRVFDLRSLAHSTII--YEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATF 366

Query: 297 GMDSH-VYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
             DS+ + + D+RN   P+  + GH  ++  I++               +++ WDL
Sbjct: 367 AADSNKIIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 94/259 (36%), Gaps = 51/259 (19%)

Query: 49  LMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGT-----HTSGEEEN-----Y 98
           L +D ++E  +T+    +QWLP+  +  +     + L I T     +T  E  N     Y
Sbjct: 158 LTWDKITECNVTYSISKMQWLPSHPKPRKLATSSESLRIWTLNDENNTLNETINLSLCKY 217

Query: 99  LKFAEINIPKEILNNQDPQEEAEEDDKATLNAP--------------------------- 131
            K   +NI     N+ +P  +A  +D      P                           
Sbjct: 218 KKQHHMNIKAVATNSGNPLSDAVPNDILGEFPPITSFHWNPIDTNLLISSSIDTTCIIWD 277

Query: 132 --KSNIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNG 189
              SN   T    H+ E+   R++ Q+    A+  G G+V ++       ST+ +     
Sbjct: 278 LESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPAQ 337

Query: 190 YALSFNALVEGQLL----SGSDDHTVALWEVGSNSTSI-------SPVRTWNDLHSDIVN 238
              S +A     LL    S  D + VA +   SN   I       +PV T    HS  +N
Sbjct: 338 MDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKIIILDMRNPETPVLTLQG-HSSSLN 396

Query: 239 DIKWHNFNEKLFGTVSEDS 257
            IKWH     +  + ++D 
Sbjct: 397 QIKWHPTERNILLSCADDC 415

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 76/181 (41%), Gaps = 24/181 (13%)

Query: 191 ALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLF 250
           +  +N +    ++S S D T  +W++ S+      V+T    H   V D+++   + +LF
Sbjct: 248 SFDWNTVDTNLIISSSIDTTCIVWDLQSSHY----VKTQLIAHDSEVFDVRFLTKSTQLF 303

Query: 251 GTVSEDSLLKINDVR--AHNITI-----------------DAVKCPQPFNTLAFSHHSSN 291
            +   D  +++ D+R  AH+  I                  + K       L  S +  N
Sbjct: 304 ASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPN 363

Query: 292 LLAAAGMDSH-VYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           +LA    DS+ + + D+RN   P+ ++ GH  +V  I++               +++ WD
Sbjct: 364 VLATFAADSNKIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWD 423

Query: 351 L 351
           L
Sbjct: 424 L 424

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 57/287 (19%), Positives = 104/287 (36%), Gaps = 59/287 (20%)

Query: 45  SNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGEEENYLKFAEI 104
           SN  L ++ V +  + +P   +QW+P+ +   +       L I +  S EE  + +  +I
Sbjct: 160 SNDLLSWESVVDADVVYPVSKIQWVPSQLYPRKLATCSDSLRIWS-VSPEERQFQE--QI 216

Query: 105 NIPKEILNNQDPQEEAEEDDKATL-----------NAPKSNIRITAK------------- 140
           N+     N Q P   A  DD   +           N   +N+ I++              
Sbjct: 217 NLSLCKYNRQHPANPAAADDMKVIGTFPPITSFDWNTVDTNLIISSSIDTTCIVWDLQSS 276

Query: 141 -YV------HEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALS 193
            YV      H+ E+   R++ ++    A+  G G+V ++       ST+ +   +    S
Sbjct: 277 HYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSS---S 333

Query: 194 FNALVEGQLLSGS--------------DDHTVALWEVGSNSTSI-------SPVRTWNDL 232
            +    G +   S              D + +A +   SN   I       SP+      
Sbjct: 334 VSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLQG- 392

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQP 279
           H   VN IKWH     +  +  +D  +   D+ +  + I+A     P
Sbjct: 393 HGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLNSSFMEINAAGSKSP 439

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 64/139 (46%), Gaps = 15/139 (10%)

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQ--PFNTLAFSHHSSNLLAA----AG 297
           NFNE     V+ +  + I DVR+ +  + ++K  +  PF +L   H    +LA     +G
Sbjct: 68  NFNEGSSYAVASNDSVNILDVRSRD-KLASLKNDKNAPFLSLDSRH---GMLACGTELSG 123

Query: 298 MDSHVYLYDLRNMREPLH-HMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGA 356
           +D+ +++YD+RN   P+   +  H D VT+I F                  ++DLKQ   
Sbjct: 124 VDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQ--- 180

Query: 357 EQTPDDAEDGVPELIMVHA 375
            Q  DDA   V     +H+
Sbjct: 181 -QEEDDALHQVINYASIHS 198

>Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 54/124 (43%), Gaps = 14/124 (11%)

Query: 283 LAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXX 342
           + F+    ++LA   +D++V+ +D+R+   P +  S    A + ++++ +          
Sbjct: 119 INFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWN-YKDPNVLASSH 177

Query: 343 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENI 402
            N + +WDL++     TP          +    GH SSVN  D N      + SS  +  
Sbjct: 178 GNDIFVWDLRK---GSTP----------LCSLKGHVSSVNSIDFNRFKSTEIMSSSNDGT 224

Query: 403 LQVW 406
           ++ W
Sbjct: 225 VKFW 228

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 4/127 (3%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSN 291
           HS  + DI ++  +  +  T S D+ +   D+R+ H             + + +++   N
Sbjct: 112 HSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPN 171

Query: 292 LLAAA-GMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           +LA++ G D  ++++DLR    PL  + GH  +V +I+F+               +  WD
Sbjct: 172 VLASSHGND--IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIMSSSNDGTVKFWD 229

Query: 351 LKQIGAE 357
             +   E
Sbjct: 230 YSKSTTE 236

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 148 TRARYMPQNPDFVATLNGQGTVFLYSRSGGLQ-STLKFHKDNGYALSFNALVEGQLLSGS 206
           ++ ++  ++P+ +A+ +G        R G     +LK H  +  ++ FN     +++S S
Sbjct: 161 SQVKWNYKDPNVLASSHGNDIFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIMSSS 220

Query: 207 DDHTVALWEVGSNST 221
           +D TV  W+   ++T
Sbjct: 221 NDGTVKFWDYSKSTT 235

>Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W
           (REAL)
          Length = 1152

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 54/124 (43%), Gaps = 14/124 (11%)

Query: 283 LAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXX 342
           + F+    ++LA   +D++V+ +D+R+   P +  S    A + ++++ +          
Sbjct: 120 INFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWN-YKDPNVLASSH 178

Query: 343 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENI 402
            N + +WDL++     TP          +    GH SSVN  D N      + SS  +  
Sbjct: 179 GNDIFVWDLRK---GSTP----------LCSLKGHVSSVNSIDFNRFKSTEIMSSSNDGT 225

Query: 403 LQVW 406
           ++ W
Sbjct: 226 VKFW 229

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 54/120 (45%), Gaps = 4/120 (3%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSN 291
           HS  + DI ++  +  +  T S D+ +   D+R+ H             + + +++   N
Sbjct: 113 HSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPN 172

Query: 292 LLAAA-GMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           +LA++ G D  ++++DLR    PL  + GH  +V +I+F+               +  WD
Sbjct: 173 VLASSHGND--IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIMSSSNDGTVKFWD 230

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 148 TRARYMPQNPDFVATLNGQGTVFLYSRSGGLQ-STLKFHKDNGYALSFNALVEGQLLSGS 206
           ++ ++  ++P+ +A+ +G        R G     +LK H  +  ++ FN     +++S S
Sbjct: 162 SQVKWNYKDPNVLASSHGNDIFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIMSSS 221

Query: 207 DDHTVALWEVGSNST 221
           +D TV  W+  +++T
Sbjct: 222 NDGTVKFWDYSTSTT 236

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 59/280 (21%), Positives = 109/280 (38%), Gaps = 61/280 (21%)

Query: 154 PQNPDFVATLNGQGTVFLYSRSGGLQ-STLKFHKDNGYALSFNALVEGQLLSGSDDHTVA 212
           P +   +A+ +  GT+ ++  +  +   TL  H ++   + +     G L SGS D T+ 
Sbjct: 244 PGDKPRLASASKDGTIKIWDTARRVCLFTLSGHTNSVSCVKWGG--RGVLYSGSHDKTIR 301

Query: 213 LWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITID 272
            W++ +    I+ +++    H+  +N +           ++S D  L++    A + T  
Sbjct: 302 AWDMNAGGKCINILKS----HAHWINHL-----------SLSTDYALRVG---AFDHTGK 343

Query: 273 AVKCPQPFNTLAFSHHSS---------NLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
               P+     A  ++            L+  A  D  +YL+D     +P+  M+GH+  
Sbjct: 344 KPSSPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKL 403

Query: 324 VTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 383
           V ++ FS             N + +W            D  DG    I    GH +SV  
Sbjct: 404 VNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDGT--FIATFRGHVASV-- 446

Query: 384 FDLNAQIPW-----LVASSEEENILQVW-----KCSHNLP 413
                Q+ W     L+ S  ++  L+VW     K S +LP
Sbjct: 447 ----YQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLP 482

>Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C
           (PRP46) - pre-mRNA splicing factor [contig 67] FULL
          Length = 433

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 62/125 (49%), Gaps = 8/125 (6%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS+D T+ +W++ S    ++        H   V  +     +  +F + SED ++K  D
Sbjct: 139 TGSNDTTIKVWDMASGKLKLTLTG-----HVMTVRSVAVSQRHPLMF-SASEDKMVKCWD 192

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +  +    D        NT+   H + +L+A+AG D+ V L+D+R  R P+  ++GH+  
Sbjct: 193 LERNAAIRDYHGHFSGVNTVDV-HPTLDLIASAGRDAVVRLWDIRT-RLPVMTLAGHKSP 250

Query: 324 VTNIE 328
           +  ++
Sbjct: 251 INQVK 255

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 114/278 (41%), Gaps = 57/278 (20%)

Query: 154 PQNPDFVATLNGQGTVFLY-SRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVA 212
           P +   +A+ +  GT+ ++ S +   Q TL  H ++   + +    +G L SGS D TV 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDSVNRVCQYTLSGHTNSVSCVKWGG--QGLLYSGSHDRTVR 302

Query: 213 LWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITID 272
           +W++ S    I+ +++    H+  VN +           ++S D  L++     H     
Sbjct: 303 VWDMNSQGRCINILKS----HAHWVNHL-----------SLSTDYALRVGAFD-HTGKKP 346

Query: 273 AV------KCPQPFNTLAFSHHSS-NLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVT 325
           A       K  + +  +   + SS  ++  A  D  ++L++     +P+  M+GH+  V 
Sbjct: 347 ATSEEAQKKALENYEKICKKNGSSEEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKLVN 406

Query: 326 NIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFD 385
           ++ FS             N + +W            D  DG  + I    GH +SV    
Sbjct: 407 HVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASV---- 447

Query: 386 LNAQIPW-----LVASSEEENILQVW-----KCSHNLP 413
              Q+ W     L+ S  ++  L+VW     K S +LP
Sbjct: 448 --YQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLP 483

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 89/207 (42%), Gaps = 27/207 (13%)

Query: 167 GTVFLYSRS---GGLQSTLKF--HKDNGYALSFNALVEGQLLSGSDDHTVALW------E 215
           G++ LYS +     + S  +F  H  +   + FNA  +  L SG ++  + +W      E
Sbjct: 84  GSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTE 143

Query: 216 VGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITI---- 271
             SN T ++P ++ + +  D V  + W+     +F +    +   I D++A    I    
Sbjct: 144 SPSNYTPLTPGQSMSSV--DEVISLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSY 201

Query: 272 ----DAVKCPQPFNTLAFSHHSSNLLAAAGM---DSHVYLYDLRNMREPLHHMS-GHEDA 323
                 +K  Q  + + +   +S  +A A     D  + ++DLRN   PL  ++ GH+  
Sbjct: 202 TSPNSGIK--QQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTLNQGHQKG 259

Query: 324 VTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           + ++++              N +++W+
Sbjct: 260 ILSLDWCHQDEHLLLSSGRDNTVLLWN 286

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 76/181 (41%), Gaps = 24/181 (13%)

Query: 191 ALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLF 250
           +  +N +    ++S S D T  +W++ S+      V+T    H   V D+++   + +LF
Sbjct: 248 SFDWNMVDTNLIISSSIDTTCIVWDLQSSHY----VKTQLIAHDSEVFDVRFLTKSTQLF 303

Query: 251 GTVSEDSLLKINDVR--AH-----------------NITIDAVKCPQPFNTLAFSHHSSN 291
            +   D  +++ D+R  AH                 + T  A K       L  S +  N
Sbjct: 304 ASCGGDGSVRVFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPN 363

Query: 292 LLAAAGMDSH-VYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           +LA    +S+ + + D+RN   P+ ++ GH  +V  I++               +++ WD
Sbjct: 364 VLATFAAESNKIIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWD 423

Query: 351 L 351
           L
Sbjct: 424 L 424

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 55/261 (21%), Positives = 97/261 (37%), Gaps = 53/261 (20%)

Query: 45  SNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGEEENYLKFAEI 104
           SN  L ++ V +  + +P   +QW+P+ +   +       L I  + + EE  + +  +I
Sbjct: 160 SNDLLSWENVVDADVVYPVSKIQWVPSQLHPRKLATCSDSLRIW-NVNHEERQFQE--QI 216

Query: 105 NIPKEILNNQDPQEEAEEDDKATL-----------NAPKSNIRITAK------------- 140
           N+     N Q P   A  DD   +           N   +N+ I++              
Sbjct: 217 NLSLCKYNRQHPANPAATDDMKVIGTFPPITSFDWNMVDTNLIISSSIDTTCIVWDLQSS 276

Query: 141 -YV------HEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALS 193
            YV      H+ E+   R++ ++    A+  G G+V ++       ST+ +      A  
Sbjct: 277 HYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPASSAPG 336

Query: 194 FNALVEGQLLSGS-----------DDHTVALWEVGSNSTSI-------SPVRTWNDLHSD 235
            NA        GS           D + +A +   SN   I       SP+    + HS 
Sbjct: 337 LNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNKIIILDMRNPESPILNL-EGHSS 395

Query: 236 IVNDIKWHNFNEKLFGTVSED 256
            VN+IKWH     +  +  +D
Sbjct: 396 SVNEIKWHPTKRNVLLSCGDD 416

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 60/125 (48%), Gaps = 8/125 (6%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS+D T+ +W + S    ++        H   V D+   N +  +F +VSED  +K  D
Sbjct: 133 TGSNDKTIKIWNLASGKLKVTL-----KAHDMTVRDLAISNRHPYMF-SVSEDKTVKCWD 186

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +  +    +        +T+   H + +++  AG DS V ++D+R  R P+  + GH+  
Sbjct: 187 LEKNTAIRNYHGHLSGVHTVDI-HPTVDVVVTAGRDSVVKVWDIRT-RLPVMTLPGHKGP 244

Query: 324 VTNIE 328
           +T + 
Sbjct: 245 ITKVR 249

>TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.309
           YLR429W
          Length = 640

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 189 GYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEK 248
           G+ L F+ L +  L S S D+TV +W+V S    I+        H D+V  + + +++ +
Sbjct: 149 GHVL-FHPLAQNVLASSSLDYTVKIWDVESGEAKITL------KHPDMVTSMSF-SYDGQ 200

Query: 249 LFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGM----DSHVYL 304
              TV+ D  L++ D+R   I  + V      N       +S+ LA  G     D  + +
Sbjct: 201 YLATVARDKKLRVWDIREEKIVSEGVAHSGAKNQRVVWLGNSDRLATTGFSRLSDRQIGI 260

Query: 305 YDLRNM 310
           +D  N+
Sbjct: 261 WDAFNL 266

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 59/132 (44%), Gaps = 20/132 (15%)

Query: 194 FNALVEGQLLSGSDDHTVALWEVGSNST-----------------SISPVRTWNDLHSDI 236
           F+   + +++S SDD  + +WE+  + +                  ISP++  +  H+  
Sbjct: 89  FDPFNDHRIVSASDDSKIGVWEIPQDYSFRDYNEETMEDDDPKPKDISPLKFLSG-HTRK 147

Query: 237 VNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAA 296
           V  + +H   + +  + S D  +KI DV +    I  +K P    +++FS +    LA  
Sbjct: 148 VGHVLFHPLAQNVLASSSLDYTVKIWDVESGEAKI-TLKHPDMVTSMSFS-YDGQYLATV 205

Query: 297 GMDSHVYLYDLR 308
             D  + ++D+R
Sbjct: 206 ARDKKLRVWDIR 217

>KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]
           {ON} similar to uniprot|Q12417 Saccharomyces cerevisiae
           YPL151C PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 434

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 62/125 (49%), Gaps = 8/125 (6%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS+D T+ +W++ +    I+ +      H   V DI     +  +F + SED L+K  D
Sbjct: 140 TGSNDTTIKIWDLAAGKLKITLIG-----HVMSVRDIAISKRHPYMF-SASEDKLVKCWD 193

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +  +    D        +T+   H S +++A AG D+ V L+D+R+ R  +  + GH+  
Sbjct: 194 LERNTAIRDFHGHLSGVHTVDV-HPSLDIIATAGRDAVVRLWDIRS-RSEIMVLPGHKSP 251

Query: 324 VTNIE 328
           +  ++
Sbjct: 252 INKVK 256

>TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {ON}
           Anc_4.309 YLR429W
          Length = 588

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 58/130 (44%), Gaps = 15/130 (11%)

Query: 194 FNALVEGQLLSGSDDHTVALWEVGSNST------------SISPVRTWNDLHSDIVNDIK 241
           F+   + +L S +DD  +A+WE+  + T             I PV+  +  H   V  I 
Sbjct: 89  FDPFDDKKLASSADDSKIAIWEIPEDYTLKSYVDEDGEPKVIKPVKILSG-HKRKVGHIL 147

Query: 242 WHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH 301
           +H   + +  + S D  +KI D+      +  +  P    +++FS++  N LA    D  
Sbjct: 148 YHPVAQNVLASSSLDYTVKIWDIENEKDML-TLTHPDMVTSMSFSYN-GNFLATVARDKK 205

Query: 302 VYLYDLRNMR 311
           + ++D+R  +
Sbjct: 206 LRVWDVREGK 215

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 58/135 (42%), Gaps = 11/135 (8%)

Query: 182 LKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIK 241
           L  HK     + ++ + +  L S S D+TV +W++ +    ++        H D+V  + 
Sbjct: 136 LSGHKRKVGHILYHPVAQNVLASSSLDYTVKIWDIENEKDMLTLT------HPDMVTSMS 189

Query: 242 WHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGM--- 298
           + ++N     TV+ D  L++ DVR   I  +        N       +S+ LA  G    
Sbjct: 190 F-SYNGNFLATVARDKKLRVWDVREGKIVSEGPAHTGAKNQRVVWLGNSDRLATTGFSRL 248

Query: 299 -DSHVYLYDLRNMRE 312
            D  + ++D  N+ +
Sbjct: 249 SDRQLGVWDAFNLEK 263

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 81/183 (44%), Gaps = 22/183 (12%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
           L+S S D T  +W++ S++     V+T    H   V D+++   + +LF +   D  +++
Sbjct: 296 LISSSIDTTCIVWDLQSSNY----VKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRV 351

Query: 262 NDVR--AHNITI-----------DAVKCPQPFNTLAFSHHSSNLLAAAGMDSH-VYLYDL 307
            D+R  AH+  I           D  +       L  S   +N++A    +S+ + + D+
Sbjct: 352 FDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKILILDM 411

Query: 308 RNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQT----PDDA 363
           RN   P+  + GH+ A+  I++               +++ WDL    +  T     ++A
Sbjct: 412 RNSESPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDLNSTFSGNTVASPSNNA 471

Query: 364 EDG 366
           E+G
Sbjct: 472 ENG 474

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 58/126 (46%), Gaps = 2/126 (1%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSN 291
           H   + DI +H  + +L  T S D+ +   D+R+               + + ++  ++N
Sbjct: 113 HFRAITDINFHPSHPELLATCSIDTYVHAWDMRSPQRPYYSTSDWSAGASQVKWNLQNAN 172

Query: 292 LLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
           +LA++  +S V+++D+R    PL+ +SG+  +V NI+F+               +  WD 
Sbjct: 173 VLASSHANS-VFIWDIRKGCTPLYKLSGNNSSVNNIDFNKVKENEIMSSSNDGTVKFWDY 231

Query: 352 KQIGAE 357
            +   E
Sbjct: 232 SKSSTE 237

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 52/118 (44%), Gaps = 14/118 (11%)

Query: 292 LLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
           LLA   +D++V+ +D+R+ + P +  S      + ++++             N + +WD+
Sbjct: 129 LLATCSIDTYVHAWDMRSPQRPYYSTSDWSAGASQVKWNLQNANVLASSHA-NSVFIWDI 187

Query: 352 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCS 409
           ++            G   L  + +G+ SSVN+ D N      + SS  +  ++ W  S
Sbjct: 188 RK------------GCTPLYKL-SGNNSSVNNIDFNKVKENEIMSSSNDGTVKFWDYS 232

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 148 TRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYA--LSFNALVEGQLLSG 205
           ++ ++  QN + +A+ +   +VF++    G     K   +N     + FN + E +++S 
Sbjct: 162 SQVKWNLQNANVLASSHAN-SVFIWDIRKGCTPLYKLSGNNSSVNNIDFNKVKENEIMSS 220

Query: 206 SDDHTVALWEVGSNST 221
           S+D TV  W+   +ST
Sbjct: 221 SNDGTVKFWDYSKSST 236

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 71/141 (50%), Gaps = 15/141 (10%)

Query: 270 TIDAVKCPQPFNTLAFSHHS-SNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIE 328
           +IDA K  +P  T    HH  +NLLA    D  + ++DL + +  L +++GH  A+T ++
Sbjct: 71  SIDA-KSTKPAETTYLQHHKDTNLLAVGYNDGVIKVWDLYS-KTVLCNLNGHSSAITVLK 128

Query: 329 FSTHXXXXXXXXXXXNRLIMWDL-KQIGAEQ--TPDDAEDGVPELIMVHAGHRSSVNDFD 385
           F +            N +I+WDL  ++G  +  +  DA  G+    M + G        D
Sbjct: 129 FDSTGTRLISGSRDSN-IIVWDLVSEVGLYKLRSHKDAITGIWCNEMQNNGE-------D 180

Query: 386 LNAQIPWLVASSEEENILQVW 406
              ++ WL+++S ++ ++++W
Sbjct: 181 DENELDWLISTS-KDGLIKIW 200

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 234 SDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLL 293
           +D V+ +K++     +F +   D+ + + D+R ++ T    +  +  N L ++   +   
Sbjct: 213 ADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFTQRMRT-NALCWNPMEAYNF 271

Query: 294 AAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
             A  D + Y YD+RN+   LH    H  AV +++FS
Sbjct: 272 VVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFS 308

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 108/269 (40%), Gaps = 51/269 (18%)

Query: 160 VATLNGQGTVFLYSRSGGLQ-STLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGS 218
           +A+ +  GT+ ++  S  +   TL  H ++   + +    +G L SGS D TV  W++ S
Sbjct: 251 LASASKDGTIKIWDTSRRVCLYTLSGHTNSVSCIKWGG--QGILYSGSHDKTVRAWDMNS 308

Query: 219 NSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQ 278
               I+ +++    H+  VN +           ++S D  L++       +   +   P+
Sbjct: 309 EGRCINVLKS----HAHWVNHL-----------SLSTDYALRVGPFDHTGVEPTS---PE 350

Query: 279 PFNTLAFSHHSS---------NLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEF 329
                A  ++            L+  A  D  ++L++     +PL  M+GH+  V ++ F
Sbjct: 351 DARDKALKNYEKVVKKNGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAF 410

Query: 330 STHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQ 389
           S             N + +W            D  DG  + I    GH +SV     +A 
Sbjct: 411 SPD-GRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSAD 455

Query: 390 IPWLVASSEEENILQVW-----KCSHNLP 413
              LV+ S ++  L+VW     K S +LP
Sbjct: 456 CRLLVSCS-KDTTLKVWDVRTRKLSVDLP 483

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 4/83 (4%)

Query: 270 TIDAVKCPQPFNTLAFSHHS-SNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIE 328
           ++DA K  +P  T    HH  +NLLA    D  V ++DL + +  L +++GH  A+T ++
Sbjct: 98  SVDA-KSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYS-KTVLCNLNGHSSAITALK 155

Query: 329 FSTHXXXXXXXXXXXNRLIMWDL 351
           F T            N +I+WDL
Sbjct: 156 FDTSGTRLISGSRDSN-IIVWDL 177

>KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly
           similar to uniprot|Q12021 Saccharomyces cerevisiae
           YDR030C RAD28 Protein involved in transcription- coupled
           repair nucleotide excision repair of UV-induced DNA
           lesions homolog of human CSA protein
          Length = 425

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 82/214 (38%), Gaps = 29/214 (13%)

Query: 164 NGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALV-----EGQLLSGSDDHTVALWEVGS 218
            G+   FL S       +L+  ++  +A S  ++       G   +GS+DH V +W+  +
Sbjct: 115 GGKAPRFLTSVESRPPDSLQGPREASHAFSVTSVKWYGPDNGLFFTGSNDHKVKIWDTNT 174

Query: 219 NSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITID-AVK-- 275
              + S          DI + +   +    L    SEDS  ++ D+R+ +  I   VK  
Sbjct: 175 FQVASS---------IDIAHRVAQLDTLGDLLAVASEDSHPRLIDLRSMSAAISLGVKRS 225

Query: 276 -CPQPFNTLAFSHHSSN----LLAAAGMDSHVYLYDLR-------NMREPLHHMSGHEDA 323
                 N   FSH SS     LLA    D +V ++DLR       ++ E       H   
Sbjct: 226 DMRHGINAAKFSHTSSGAKPLLLATGDDDGNVRVWDLRMGNRWLCDLTEADTLSKSHARC 285

Query: 324 VTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAE 357
             ++ +               +  MWDL + GA+
Sbjct: 286 CNDLCWDPSGSLKLVTTGNDGKCKMWDLHEGGAK 319

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 54/129 (41%), Gaps = 26/129 (20%)

Query: 248 KLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAA----GMDSHVY 303
           K+F   S D + KIN+           +   PF +L   H    LLA      G+D+ ++
Sbjct: 84  KVFDIRSNDCVAKINN-----------ETNSPFLSLDSRH---GLLACGTELQGIDAAIH 129

Query: 304 LYDLRNMREPLHHM-SGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDD 362
           +YD+R    PL  +   H D VT I+F                  ++DLKQ       DD
Sbjct: 130 IYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ-------DD 182

Query: 363 AEDGVPELI 371
            ED + ++I
Sbjct: 183 EEDALHQVI 191

>YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coronin,
           cortical actin cytoskeletal component that associates
           with the Arp2p/Arp3p complex to regulate its activity;
           plays a role in regulation of actin patch assembly
          Length = 651

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 57/130 (43%), Gaps = 15/130 (11%)

Query: 194 FNALVEGQLLSGSDDHTVALWEVGSN------------STSISPVRTWNDLHSDIVNDIK 241
           F+   + ++ SGSDD  + +W++  N               I PV+     H+  V  + 
Sbjct: 89  FDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFLTG-HARKVGHVL 147

Query: 242 WHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH 301
           +H   E +  + S D  +K+ +V      I  +K P    +++FS +  N LA    D  
Sbjct: 148 YHPVAENVLASSSGDYTVKLWNVETGKDMI-TLKHPDMVTSMSFS-YDGNYLATVARDKK 205

Query: 302 VYLYDLRNMR 311
           + ++++R  +
Sbjct: 206 LRVWNIREEK 215

>KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]
           {ON} weakly similar to uniprot|Q12523 Saccharomyces
           cerevisiae YPL247C Hypothetical ORF
          Length = 493

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 67/141 (47%), Gaps = 26/141 (18%)

Query: 147 ITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQ-----STLKFHKDNGYALSFNALVEGQ 201
           I+R ++MPQN   +AT +   ++ ++S  G LQ     S  K+ K    A   + +  GQ
Sbjct: 133 ISRIQWMPQNNTRLATCSD--SLRIWSLDGSLQEQINLSLYKYGKHPSSASQKDTVTLGQ 190

Query: 202 L----------------LSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNF 245
           L                LS S D T  +W++ SNST+   V+T    H   V D+K+   
Sbjct: 191 LPPVTSFHWSPISPNLLLSCSIDTTCTVWDL-SNSTNY--VKTQLIAHDSEVFDVKFLAQ 247

Query: 246 NEKLFGTVSEDSLLKINDVRA 266
           + +LF +   D  +++ D+R+
Sbjct: 248 STQLFASCGGDGSVRVFDLRS 268

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 54/124 (43%), Gaps = 14/124 (11%)

Query: 283 LAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXX 342
           + F+    ++LA   +D++V+ +D+R+   P +  S    A + ++++ +          
Sbjct: 119 INFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWN-YKDPNVLASSH 177

Query: 343 XNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENI 402
            N + +WDL++     TP          +    GH SSVN  D N      + SS  +  
Sbjct: 178 GNDVFVWDLRK---GSTP----------LCSLKGHVSSVNSIDFNRFKSTELMSSSNDGT 224

Query: 403 LQVW 406
           ++ W
Sbjct: 225 VKFW 228

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 56/127 (44%), Gaps = 4/127 (3%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSN 291
           HS  + DI ++  +  +  T S D+ +   D+R+ H             + + +++   N
Sbjct: 112 HSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPN 171

Query: 292 LLAAA-GMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           +LA++ G D  V+++DLR    PL  + GH  +V +I+F+               +  WD
Sbjct: 172 VLASSHGND--VFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTELMSSSNDGTVKFWD 229

Query: 351 LKQIGAE 357
             +   E
Sbjct: 230 YSKSTTE 236

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 148 TRARYMPQNPDFVATLNGQGTVFLYSRSGGLQ-STLKFHKDNGYALSFNALVEGQLLSGS 206
           ++ ++  ++P+ +A+ +G        R G     +LK H  +  ++ FN     +L+S S
Sbjct: 161 SQVKWNYKDPNVLASSHGNDVFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTELMSSS 220

Query: 207 DDHTVALWEVGSNST 221
           +D TV  W+   ++T
Sbjct: 221 NDGTVKFWDYSKSTT 235

>AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR128W
          Length = 1125

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 58/129 (44%), Gaps = 22/129 (17%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQ-PF----------N 281
           H+  + DI +H  + +L  T S D+ +   D+R          C Q PF          +
Sbjct: 113 HTRAITDINFHPIHPELLATCSIDTYVHAWDMR----------CSQRPFYGTSDWSSGAS 162

Query: 282 TLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXX 341
            + ++   +N++A++   S V+++D+R    PL+ ++G   +V NI+F+ +         
Sbjct: 163 QVKWNFKDANIIASSHA-STVFIWDIRKGSVPLYRLNGSGSSVNNIDFNRNNECEIMSSY 221

Query: 342 XXNRLIMWD 350
               +  WD
Sbjct: 222 NDGTIKFWD 230

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/119 (20%), Positives = 50/119 (42%), Gaps = 14/119 (11%)

Query: 292 LLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
           LLA   +D++V+ +D+R  + P +  S      + ++++             + + +WD+
Sbjct: 129 LLATCSIDTYVHAWDMRCSQRPFYGTSDWSSGASQVKWN-FKDANIIASSHASTVFIWDI 187

Query: 352 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSH 410
           ++             VP   +  +G  SSVN+ D N      + SS  +  ++ W   H
Sbjct: 188 RK-----------GSVPLYRLNGSG--SSVNNIDFNRNNECEIMSSYNDGTIKFWDYGH 233

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 106/236 (44%), Gaps = 17/236 (7%)

Query: 125 KATLNAPKSNIRITAKYVHEEE-ITRARYMPQNPDFV-ATLNGQGTVFLYSRSGGLQSTL 182
           +  LN+  S +++ A  V     ++  R  P    F  A+ +G  +VF       L S L
Sbjct: 158 RRALNSSVSKLQLEASQVASTRPVSLVRISPNQSRFASASWDGGISVFDCESLESLAS-L 216

Query: 183 KFHKDNGYALSFNALVEGQLL-SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIK 241
             H      L +N+  EG LL +G+DD+ V L      S  +  V T     + +VN + 
Sbjct: 217 PAHAGKVGGLDWNS--EGSLLVTGADDNYVRLTRYNGESNGLVNVATLGGHENRVVNTV- 273

Query: 242 WHNFNEKLFGTVSEDSLLKINDVR-AHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDS 300
             + ++K   + S D+  ++ DV  A  + +      + + +L+F    + L+ + G+DS
Sbjct: 274 -FHPSDKYVASASFDTTWRLWDVETAQELQLQEGHSKEVY-SLSFQPDGA-LICSGGLDS 330

Query: 301 HVYLYDLRNMREPLHHMSGHEDAVTNIEFS--THXXXXXXXXXXXNRLIMWDLKQI 354
              ++DLR+ +  +  + GH   V  +++S  +H           N   +WDL+++
Sbjct: 331 LAMVWDLRSGKN-IVTLQGHAKPVYCVDWSSNSHQLATGGGDGVVN---VWDLRKL 382

>Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}
           similar to Ashbya gossypii ACR137W
          Length = 426

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 64/126 (50%), Gaps = 18/126 (14%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS+D T+ +W++ S    ++        H   V DI     +  +F + SED L+K  D
Sbjct: 132 TGSNDSTIKVWDLASGKLKVTL-----QGHIMTVKDIAISTRHPYMF-SASEDKLVKCWD 185

Query: 264 VRAHNITIDAVKCPQPFNTLA--FS---HHSSNLLAAAGMDSHVYLYDLRNMREPLHHMS 318
           +  + +  D       + TL+  +S   H + +L+ +AG DS V ++D+R+ R  +  ++
Sbjct: 186 LEKNMVIRDF------YGTLSGVYSVDVHPTLDLIVSAGRDSVVRIWDIRS-RTCVMTLA 238

Query: 319 GHEDAV 324
           GH+  +
Sbjct: 239 GHKGPI 244

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 78/192 (40%), Gaps = 27/192 (14%)

Query: 190 YALSFNALVEGQLLSGSDDHTVAL--WEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNE 247
           + L      +  LL+G  +  + L  W  G +   I    T        +ND+K    + 
Sbjct: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASET-------AINDMKVIGSDF 69

Query: 248 KLFGTVSEDSL--LKINDVRAHN-ITIDAVKCPQPFNTLAFSHHSSNLLAAA----GMDS 300
                VS  S+  +K+ D+R ++ I     +   PF +L   H    LLA      G+D+
Sbjct: 70  SAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRH---GLLACGTELQGIDA 126

Query: 301 HVYLYDLRNMREPLHHM-SGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQT 359
            VY+YD+R    PL  +   H D VT I+F                  ++DLKQ      
Sbjct: 127 AVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ------ 180

Query: 360 PDDAEDGVPELI 371
            D+ ED + ++I
Sbjct: 181 -DEEEDALHQVI 191

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 20/128 (15%)

Query: 210 TVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNI 269
           T+ LW+  + S  +S + +W    +D +  +K++     +  +   D+ + + DVR ++ 
Sbjct: 194 TIQLWDT-ARSKPLSNL-SWG---ADNITSVKFNQTETDILASTGSDNSIVLYDVRTNSP 248

Query: 270 TIDAVK-------CPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHED 322
           T   V+       C  P     F          A  D + Y YD+RNM   L+    H  
Sbjct: 249 TQKIVQRLRTNAICWNPMEAFNF--------VTANEDHNAYYYDMRNMSRALNVFKDHVS 300

Query: 323 AVTNIEFS 330
           AV +++F+
Sbjct: 301 AVMDVDFA 308

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 58/120 (48%), Gaps = 6/120 (5%)

Query: 211 VALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNIT 270
           + LW+ G  S  +S + +W    +D V  +K++     +  +   D+ + + D+R ++ T
Sbjct: 195 IELWDTG-RSKPVSNL-SWG---ADNVTSVKFNQNETDILASTGSDNSVVLYDLRTNSPT 249

Query: 271 IDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
              V+  +  N + ++   +     A  D + Y YD+RNM   L+    H  AV +++FS
Sbjct: 250 QKIVQTMRT-NAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFS 308

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 70/157 (44%), Gaps = 9/157 (5%)

Query: 158 DFVATLNGQGTVFLYSRSGGLQSTL-KFHKDNGYALSFNALVEGQLLSGSDDHTVALWEV 216
           D++ + +  GT+ ++  +  +   L + H      +SF+   + + ++ SDD+ + +W  
Sbjct: 138 DWLISGDSDGTIKIWQPNFNMVKVLDEAHTQCIRGISFSG-TDSKFVTCSDDNILKIWNF 196

Query: 217 GSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKC 276
            SN    S   T    H D V    WH     L  + S+D+L+K+ D R+       + C
Sbjct: 197 -SNGQQES---TLTGHHWD-VRSCDWHP-TMGLIASGSKDNLIKLWDPRSGQCISTILGC 250

Query: 277 PQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR-NMRE 312
                +  F     N+LA    D    ++D+R NM+E
Sbjct: 251 KHTIISTKFQPTKGNMLAVISKDKSCRVFDIRQNMKE 287

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 72/334 (21%), Positives = 126/334 (37%), Gaps = 62/334 (18%)

Query: 45  SNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTHTSGEEENYLKFAEI 104
           SN  L ++ V+E  +T+P  ++QWLP+     +     + L I +      +N       
Sbjct: 190 SNDLLTWEKVAECNVTYPVSNIQWLPSVPNPRKLATSSECLRIWSLDDNSMDN------- 242

Query: 105 NIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRARYMPQNPDFVATLN 164
                + NN           K +L   + N+ +  KY  + +I        N    +  N
Sbjct: 243 ---SSVFNNNISNNSRHNTYKKSL-TEQVNLSL-CKYNEQHQII-------NNSTNSVSN 290

Query: 165 GQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSIS 224
                 L    G L     FH        +N++    L+S S D T  +W++ S++    
Sbjct: 291 KSNARLL----GQLPPVTSFH--------WNSIDTNLLISSSIDTTCIVWDLQSSNY--- 335

Query: 225 PVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA---HNITIDAVKCPQPFN 281
            V+T    H   V D+K+   + +LF +   D  +++ D+RA     I  +     Q  N
Sbjct: 336 -VKTQLIAHDSEVFDVKFLIQSTQLFASCGGDGSIRVFDLRALQHSTIIYETANDLQGNN 394

Query: 282 TL--------------AFSHH---------SSNLLAAAGMDSH-VYLYDLRNMREPLHHM 317
           T               + SH            NL+A  G+D   + + D+RN   P+  +
Sbjct: 395 TFNNDVTTKIDNSSANSLSHALLRLEPSPTDPNLIATFGLDKKAILILDMRNPGVPVLVL 454

Query: 318 SGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
           SGH  +V  I++               +++ WDL
Sbjct: 455 SGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDL 488

>CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa]
           {ON} similar to uniprot|P18851 Saccharomyces cerevisiae
           YOR212w STE4
          Length = 419

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 62/152 (40%), Gaps = 9/152 (5%)

Query: 161 ATLNGQGTVFLYSRSGGLQSTLK--FHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGS 218
           A LN   T++   R   +Q  +   F    GY      + E ++++ S D T ALW++  
Sbjct: 145 AGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSESRVVTSSGDMTCALWDI-- 202

Query: 219 NSTSISPVRTWNDLHSDIVN-DIKWHNFNE-KLFGTVSEDSLLKINDVRAHNITIDAVKC 276
                  VR ++D   D++   I   N ++  +F +   D    I DVR+ +        
Sbjct: 203 --PKAKRVREYSDHLGDVLAISIPVTNLSKNNMFASCGSDGYTFIWDVRSPSAVQQFSIG 260

Query: 277 PQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR 308
               N L F     N +A    D  + L+DLR
Sbjct: 261 SCDSNCLKF-FPDGNSVAVGNDDGTISLFDLR 291

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 63/122 (51%), Gaps = 23/122 (18%)

Query: 215 EVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNI--TID 272
           E  ++S SIS ++  N+  +           N  LF + S+DS+ KI DVR  +   T+ 
Sbjct: 50  EFAAHSASISNLKVLNNEFT-----------NSDLFASASKDSV-KIFDVRTSSCVATLH 97

Query: 273 AVKCPQPFNTLAFSHHSSNLLAA----AGMDSHVYLYDLRNMREPLH-HMSGHEDAVTNI 327
             K   PF +L   H   ++LA     +G+D+ +++YD++ + +PL   +  H D +T+ 
Sbjct: 98  NDK-SAPFLSLDSRH---DMLACGTELSGVDAELHIYDIKKLSKPLRSFVDSHHDDITDT 153

Query: 328 EF 329
           +F
Sbjct: 154 KF 155

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 57/120 (47%), Gaps = 6/120 (5%)

Query: 211 VALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNIT 270
           + LW+  + S  IS + TW    +D V  +K++     +  +   D+ + + D+R ++ T
Sbjct: 195 IQLWD-ANRSKPISNL-TWG---ADNVTSVKFNQTETDILASTGSDNSIVLYDLRTNSPT 249

Query: 271 IDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
              ++     N + ++   +     A  D + Y YD+RNM   L+    H  AV +++FS
Sbjct: 250 -QKIRQSMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFS 308

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 37/182 (20%), Positives = 80/182 (43%), Gaps = 18/182 (9%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHT-VALWEVGS-NSTSISPVRTWNDLHSDIVNDIKW 242
           HK +   L FN      L+SGSD +  + +W++ + + T ++P       +   +  + W
Sbjct: 110 HKGSVKTLKFNTKQSNLLVSGSDKNGEILIWDLNNLDKTPLTPGMPMTPTNE--ITSLAW 167

Query: 243 HNFNEKLFGTVSEDSLLKINDVRAH------NITIDAVKCPQPFNTLAFSHHSSNLLAAA 296
           +     +F   S  S + I D++A       N T         F+ + +   +S  +A A
Sbjct: 168 NKSLSHVFSCSSNTSNVSIFDLKAKKEVIHLNYTNPVNNVKSLFSVVEWHPKNSTRIATA 227

Query: 297 GMDS------HVYLYDLRNMREPLHHMS--GHEDAVTNIEFSTHXXXXXXXXXXXNRLIM 348
            +++       ++++DLRN   PL  +S  GH + + ++++ +            N +++
Sbjct: 228 TLNNDSTESDSIFIWDLRNSHTPLQILSKDGHSNGILSLDWCSTDENLLLSSGRDNSVML 287

Query: 349 WD 350
           W+
Sbjct: 288 WN 289

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 75/173 (43%), Gaps = 10/173 (5%)

Query: 142 VHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLK-FHKDNGYALSFNALVEG 200
            H+  +T  +Y     D++ + +  G + ++  +  +   L+  H +    +SFN   + 
Sbjct: 121 AHDSAVTTMKYSNAG-DWMVSGDTDGNIKIWQPNFNMVKELENAHTECIRDISFNN-ADS 178

Query: 201 QLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
           + ++ SDD+ + +W   +        R  +  H D V    WH     L  + S+D+L+K
Sbjct: 179 KFVTCSDDNILKIWNFSNGQQE----RVLSGHHWD-VKSCDWHP-TMGLIASASKDNLIK 232

Query: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR-NMRE 312
           + D R+ N     +K         F     NLL A   D    ++D+R +M+E
Sbjct: 233 LWDPRSGNCVSTILKFKHTVLKTRFQPTKGNLLVAISKDKSCRVFDIRHSMKE 285

>Kpol_1002.94 s1002 (240130..241269) [1140 bp, 379 aa] {ON}
           (240130..241269) [1140 nt, 380 aa]
          Length = 379

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 61/124 (49%), Gaps = 14/124 (11%)

Query: 188 NGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNE 247
           +GY   F+  ++G  L   D    + W  G      S VR W       V+D+KW++  E
Sbjct: 172 DGYMRVFSGFIKG--LDSKDAVVNSPW--GDKFPFGSLVREW--YQGSYVHDVKWNSSQE 225

Query: 248 KLFGTVSEDSLLKINDVRAHNITIDAVKCPQ--PFNTLAFSHHSSNLLAAAGMDSHVYLY 305
           ++ G V+ D  L + D + ++ T+DA   P+  P+ +LA+ +++S L   AG   H  L+
Sbjct: 226 RI-GFVAHDGSLNVVDSQGNHQTVDA---PEGLPYRSLAWINNNSIL--CAGYSCHPVLF 279

Query: 306 DLRN 309
              N
Sbjct: 280 SEAN 283

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 58/274 (21%), Positives = 111/274 (40%), Gaps = 61/274 (22%)

Query: 160 VATLNGQGTVFLYSRSGGLQS-TLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGS 218
           +AT +  GT+ ++  +  + + TL  H  +   + +    +  L SGS D TV +W++ +
Sbjct: 248 LATSSKDGTIKIWDTTRRVCTMTLSGHTSSVSCVKWGG--QNFLYSGSHDKTVRVWDMKN 305

Query: 219 NSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQ 278
           +   I+ ++     H+  VN +           ++S D  L++      + T +    P+
Sbjct: 306 SGRCINILKN----HAHWVNHL-----------SLSTDYALRVG---PFDYTGEQPATPE 347

Query: 279 PFNTLAFSHHS---------SNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEF 329
                A  ++          + L+  A  D  ++L+D     +P+  M+GH+  V ++ F
Sbjct: 348 IAKAKALKNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHVAF 407

Query: 330 STHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQ 389
           S             N + +W            D+ DG  + I    GH +SV       Q
Sbjct: 408 SP-DGRHIVSASFDNSIKLW------------DSRDG--KFITTFRGHVASV------YQ 446

Query: 390 IPW-----LVASSEEENILQVW-----KCSHNLP 413
           + W     L+ S  ++  L+VW     K S +LP
Sbjct: 447 VAWSSDCRLLVSCSKDTTLKVWDIRTRKLSVDLP 480

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 40/197 (20%), Positives = 76/197 (38%), Gaps = 16/197 (8%)

Query: 143 HEEEITRARYMPQNPDFVATLNGQGTVFLY-SRSGGLQSTLKFHKDNGYALSFNALVEGQ 201
           H   I  + + P     + T  G  T  ++   +    +TL  H +  + L  +   +G+
Sbjct: 139 HGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMATLTGHHN--WVLCVSWSPDGE 196

Query: 202 LL-SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFN------EKLFGTVS 254
           L+ +GS D+TV LWE  +       +R     H   +  + W   +           T S
Sbjct: 197 LIATGSMDNTVRLWESKTGKPFGDALRG----HGKWITSLSWEPIHLVTPGERPRLATSS 252

Query: 255 EDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPL 314
           +D  +KI D      T+         + + +     N L +   D  V ++D++N    +
Sbjct: 253 KDGTIKIWDTTRRVCTMTLSGHTSSVSCVKWG--GQNFLYSGSHDKTVRVWDMKNSGRCI 310

Query: 315 HHMSGHEDAVTNIEFST 331
           + +  H   V ++  ST
Sbjct: 311 NILKNHAHWVNHLSLST 327

>KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 aa]
           {ON} highly similar to uniprot|P41811 Saccharomyces
           cerevisiae YGL137W SEC27 Involved in beta'-subunit of
           yeast coatomer
          Length = 890

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 61/133 (45%), Gaps = 8/133 (6%)

Query: 136 RITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYS--RSGGLQSTLKFHKDNGYALS 193
           ++T    H + I      P  P FV T +   T+ L++  ++ G Q T   H+    +++
Sbjct: 89  KVTEFEAHPDYIRSIAVHPTKP-FVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVA 147

Query: 194 FNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFG-T 252
           FN     Q  SG  DHT+ +W +G +     P  T     +  VN + ++   +K +  T
Sbjct: 148 FNPKDPNQFASGCLDHTIKVWSIGQD----VPNFTLKAHETKGVNYVDYYPLQDKPYLIT 203

Query: 253 VSEDSLLKINDVR 265
            S+D  +K+ D +
Sbjct: 204 TSDDGTIKVWDYQ 216

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 234 SDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLL 293
           +D +  +K++     +  +   D+ + + D+R ++ T   ++  +  N + ++   +   
Sbjct: 212 ADNITSVKFNQNEVDILASTGSDNAIVLYDLRTNSPTQKIIQTMRT-NAICWNPMEAFNF 270

Query: 294 AAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
             A  D + Y YD+RNM   LH    H  AV +++FS
Sbjct: 271 VIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFS 307

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 73/181 (40%), Gaps = 16/181 (8%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVN-DIKWH 243
           H+D  Y ++ N     +L SGS D  +  W + +    +S    +  +    V  +    
Sbjct: 66  HRDGVYTIAKNYNNLNKLASGSADGIIKYWNMSTREEFVSFKAHYGLVTGLCVTPEHTSK 125

Query: 244 NFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH-- 301
           N NE    +  +D  +K+  V  +N     VK     NT           A  G+D H  
Sbjct: 126 NKNENFMLSCGDDKTVKLWSV--NNDDFSNVKSDAELNTEGLLKTFYGEHAFQGIDHHRE 183

Query: 302 ----------VYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
                     ++L+D  N  +P+ ++S   D +T+++F+ +           N ++++DL
Sbjct: 184 ASTFVTGGAQIHLWD-SNRSKPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDL 242

Query: 352 K 352
           +
Sbjct: 243 R 243

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 53/120 (44%), Gaps = 18/120 (15%)

Query: 259 LKINDVRAHNITIDAV--KCPQPFNTLAFSHHSSNLLAAA----GMDSHVYLYDLRNMRE 312
           +K+ D+R  N  +  +  +   PF +L   H    LLA      G+D+ VY+YD+R    
Sbjct: 83  VKVFDIRT-NACVAKIHNEANSPFISLDSRH---GLLACGTELQGIDAAVYIYDIRRWDA 138

Query: 313 PLHH-MSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELI 371
           PL   +  H D VT I+F                  ++DLKQ       D+ ED + ++I
Sbjct: 139 PLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ-------DEEEDALHQVI 191

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 53/252 (21%), Positives = 97/252 (38%), Gaps = 60/252 (23%)

Query: 181 TLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDI 240
           TL  H ++   + +     G L SGS D T+  W++ +    I+ +++    H+  +N +
Sbjct: 272 TLSGHTNSVSCVKWGG--RGILYSGSHDKTIRAWDMAAGGKCINILKS----HAHWINHL 325

Query: 241 KWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSS---------N 291
                      +++ D  L++    A + T +    P+     A  ++            
Sbjct: 326 -----------SLNTDYALRVG---AFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEE 371

Query: 292 LLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
           L+  A  D  +YL+D     +P+  M+GH+  V ++ FS             N + +W  
Sbjct: 372 LMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW-- 428

Query: 352 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPW-----LVASSEEENILQVW 406
                     D  +G    I    GH +SV       Q+ W     L+ S  ++  L+VW
Sbjct: 429 ----------DGRNGT--FIATFRGHVASV------YQVAWSSDCRLLVSCSKDTTLKVW 470

Query: 407 -----KCSHNLP 413
                K S +LP
Sbjct: 471 DVRTKKLSVDLP 482

>TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON}
           Anc_8.672 YPL151C
          Length = 434

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 80/184 (43%), Gaps = 23/184 (12%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS+D ++ +W++ S    ++        H   V D+     +  +F + SED  +K  D
Sbjct: 140 TGSNDTSIKVWDLASGKLKLTL-----SGHIMTVRDLAISERHPYMF-SASEDKTIKCWD 193

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +  + +  +        +T++  H + +L+ +AG DS V L+D+R  R P+ ++ GH+  
Sbjct: 194 LEKNMVIRNYHGHLSGVHTVSL-HPTLDLVVSAGRDSVVKLWDMRT-RVPVMNLIGHKSP 251

Query: 324 VTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 383
           +  +                N + +WD+              G    I+ H  H+ SV D
Sbjct: 252 INKVRCLPVDPQIISCSTDAN-IRLWDITA------------GKSAKILTH--HKRSVRD 296

Query: 384 FDLN 387
           F L+
Sbjct: 297 FALH 300

>KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} similar
           to uniprot|P21304 Saccharomyces cerevisiae YLR196W PWP1
          Length = 579

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 71/160 (44%), Gaps = 27/160 (16%)

Query: 182 LKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDI-VNDI 240
           L  H D   +L+ +      L S S DHTV LW++     +    R+   +HS+  V+  
Sbjct: 289 LTHHTDAVLSLAHSKQFRAVLASTSADHTVKLWDLNEGIAA----RSVASIHSNKNVSSS 344

Query: 241 KWHNFNEKLFGTVSEDSLLKINDVRAHN----------ITIDAVKCPQPFNTLAFSHHSS 290
           +WH+ +  +  T   DS + ++DVR             +T + V+C Q  +   F     
Sbjct: 345 QWHSTSGSVLLTGGYDSRVALSDVRIAEDSQMSKYWSVMTGEDVECVQFADENTF----- 399

Query: 291 NLLAAAGMDS-HVYLYDLRNMR--EPLHHMSGHEDAVTNI 327
                 G DS +VY +D+R     +PL  ++ H+  ++ +
Sbjct: 400 ----MCGTDSGNVYSFDIRQGEGSKPLWTLNAHDAGISAL 435

>TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa]
           {ON} Anc_1.247 YKR036C
          Length = 589

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 76/185 (41%), Gaps = 27/185 (14%)

Query: 180 STLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGS-----NSTSISPVRTWNDLHS 234
           +TLK HK +  AL  +   +  ++SGS D TV LW+  S     NS   SP+      H 
Sbjct: 291 TTLKSHKSSLTALQLD---DHLIVSGSKDATVKLWDTKSLADTTNSNINSPLLHTFSSHK 347

Query: 235 DIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQP--------FNTLAFS 286
           D +  I    F   L  T S D  ++  D+   N  I  +  P P         NTL   
Sbjct: 348 DEITAISL--FQSSLI-TTSLDKTIRHWDLNT-NKNIQTIPLPSPVSVYTSPIINTLQCF 403

Query: 287 HHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRL 346
             +   LA    D  V L+DLR + + +     H D +T ++F+             N +
Sbjct: 404 DAA---LATGSRDGIVRLWDLR-IGKIVRSFEKHNDEITGLKFNNK---QLVSTSLDNSI 456

Query: 347 IMWDL 351
            +WDL
Sbjct: 457 KIWDL 461

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 95/202 (47%), Gaps = 23/202 (11%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
           L+SG +D  V L+   SNS  ++     +D     V ++K+H  ++K  G+ S D+  ++
Sbjct: 239 LVSGGEDGIVKLYNFDSNSIQVATSFIGHDAR---VTNVKFHP-SQKYIGSASFDTTWRL 294

Query: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321
            D+  ++  +      +   +L+F    S L+A AG D    ++DLR+ +  L  + GH 
Sbjct: 295 WDIVTNSELLLQEGHSKEIYSLSFQTDGS-LIATAGADKVGIIWDLRSGKNIL-SLVGHA 352

Query: 322 DAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSV 381
             +   ++S +             + +WDL+++      DD E            H++ V
Sbjct: 353 KPIYCSDWSQN--GYQXXXSGDGTIKIWDLRKV------DDVE--------TILAHKNVV 396

Query: 382 NDFDLNAQ-IPWLVASSEEENI 402
            D     +   +L++SS +++I
Sbjct: 397 TDLKFEKENSKFLISSSYDKDI 418

>Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C
           (AIP1) - actin cortical patch component [contig 55] FULL
          Length = 611

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 25/37 (67%)

Query: 291 NLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNI 327
           +L+A A +D+H+Y+Y L+   + + H++ H+D  T +
Sbjct: 550 DLIATASLDTHLYVYSLKKPMKSIKHLNAHKDGATCV 586

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 81/181 (44%), Gaps = 23/181 (12%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS+D T+ +W+  S    ++        H   V D+     +  +F + SED L+K  D
Sbjct: 126 TGSNDSTIKVWDFASGKLKLTLSG-----HVMGVRDLVVSKRHPYMF-SASEDKLVKCWD 179

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +  +    D        +T+   H + +L+A+AG DS V L+D+R+ ++ +  + GH+  
Sbjct: 180 LEKNAPIRDYFGHLSGVHTVDI-HPTLSLIASAGRDSVVKLWDIRS-KKAVITLVGHKSP 237

Query: 324 VTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 383
           + +++  T              +I WDL  + A+          P  ++ H  HR +V D
Sbjct: 238 INSVK-CTPADPQIISCSNDTTVITWDL--VAAK----------PMKVITH--HRKAVRD 282

Query: 384 F 384
            
Sbjct: 283 I 283

>CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa]
           {ON} similar to uniprot|Q12021 Saccharomyces cerevisiae
           YDR030c RAD28
          Length = 522

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 57/132 (43%), Gaps = 25/132 (18%)

Query: 200 GQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLL 259
           G  L+GS+DH V LW+    + S   V+ +N      VND+   +  + L    ++D   
Sbjct: 206 GIFLTGSNDHAVKLWD----TASFEAVKCYN--FDTRVNDLHSTSAAQSLIAVATDDYYP 259

Query: 260 KINDVR-------------AHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYD 306
           ++ D+R             A ++  D + C +      F   +  LLA      +  L+D
Sbjct: 260 RVIDLRQSAADEAGAMQLGAKSLMRDPMLCAR------FHPTNGQLLATGDAGGNCKLWD 313

Query: 307 LRNMREPLHHMS 318
           LR + +P  +M+
Sbjct: 314 LRMVGKPWGNMA 325

>KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} similar
           to uniprot|P46680 Saccharomyces cerevisiae YMR092C AIP1
           Actin cortical patch component probable binding site on
           actin lies on front surface of subdomains 3 and 4
          Length = 610

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 26/39 (66%)

Query: 291 NLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEF 329
           +L+A A +D+HV++Y L+   + + H++ H+D  T + +
Sbjct: 550 DLIATASLDTHVFVYSLKRPMKSIKHLNAHKDGATCVAW 588

>TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {ON}
           Anc_4.309 YLR429W
          Length = 642

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 69/172 (40%), Gaps = 18/172 (10%)

Query: 194 FNALVEGQLLSGSDDHTVALWEV------------GSNSTSISPVRTWNDLHSDIVNDIK 241
           F+   + ++ SGSDD  + +W++              +   I P +     HS  V  + 
Sbjct: 89  FDPFNDHRVASGSDDCKIGIWDIPEGYSFRNHIDENGDVIDIQPTKMLTG-HSRKVGHVL 147

Query: 242 WHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH 301
           +H  ++ +  + S D  ++I +V      I  +K P    +++FS +  N LA    D  
Sbjct: 148 FHPVSQNVLASSSLDYTVRIWNVETGENLI-TLKHPDMVTSMSFS-YDGNHLATVARDKK 205

Query: 302 VYLYDLRNMR---EPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           + ++D+RN +   E L H       V  +  S              ++ +WD
Sbjct: 206 LRVWDIRNNKIVSEGLAHAGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWD 257

>KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {ON}
           similar to uniprot|P38262 Saccharomyces cerevisiae
           YBR103W SIF2 Sir4p-Interacting Factor 535 amino acid
           protein containing 4 WD-40 repeats and a nuclear
           localization signal
          Length = 512

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 63/147 (42%), Gaps = 23/147 (15%)

Query: 180 STLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDL--HSDIV 237
           +TL+F+K N             LLS SDD+T+ +W  G++S +       ND   H+  +
Sbjct: 344 TTLEFNKSNK-----------SLLSASDDNTIKVWRGGNSSAA-------NDFTDHTKTI 385

Query: 238 NDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAG 297
           +   W   N+ L  + + D  +K+  +  ++I  +A    +P    + S    N L    
Sbjct: 386 SSAHW--INDDLIISTAYDGTVKVWSISKNSIVAEASLDSEPIFEASLS-PDRNWLTVGT 442

Query: 298 MDSHVYLYDLRNMREPLHHMSGHEDAV 324
           +     ++D++   E     S  + +V
Sbjct: 443 LQGSAIVFDVKTFLESYDQNSVQQQSV 469

>Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON}
           similar to Ashbya gossypii AER114W
          Length = 625

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 64/139 (46%), Gaps = 16/139 (11%)

Query: 194 FNALVEGQLLSGSDDHTVALWEVGS------------NSTSISPVRTWNDLHSDIVNDIK 241
           F+   +  + S SDD  +A+WE+ S            N+  ++PV+     H+  V  + 
Sbjct: 89  FDPFNDQIIASSSDDTKIAIWEIPSDYSFHNAQDEDGNTKDVTPVKFLMG-HTRKVGHVL 147

Query: 242 WHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH 301
           +H     +  + S D  ++I +V     T+  +K P    +++FS++  + LA    D  
Sbjct: 148 YHPTASNILASSSLDHTVRIWNVETGE-TVIILKHPDMVTSMSFSYN-GDYLATCCRDKK 205

Query: 302 VYLYDLRNMREPLHHMSGH 320
           + ++D+R  +E +    GH
Sbjct: 206 LRVWDIRK-QEVVSEGQGH 223

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 11/113 (9%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
           L S S DHTV +W V +  T I         H D+V  + + ++N     T   D  L++
Sbjct: 156 LASSSLDHTVRIWNVETGETVIIL------KHPDMVTSMSF-SYNGDYLATCCRDKKLRV 208

Query: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGM----DSHVYLYDLRNM 310
            D+R   +  +      P N       +S+ LA  G     D  + ++D  N+
Sbjct: 209 WDIRKQEVVSEGQGHSSPKNQRVVWLGNSDRLATTGFSKLSDRQIGVWDAFNI 261

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query: 199 EGQLLSGSDDHTVALWEVGSNS-TSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDS 257
           E  L +G +D  V ++    N  TSI  ++     H   V+D+K H    K  G+ S D+
Sbjct: 243 EAYLFTGGEDCLVKVFGYEKNDLTSIDTLKG----HQGRVSDVKLHPLG-KYLGSSSFDN 297

Query: 258 LLKINDV-RAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHH 316
             ++ D+ +   I +      + F +LAF H   +L A AG DS   ++DLR+ +  + +
Sbjct: 298 TWRLWDIEKKKEILLQEGHSKEIF-SLAF-HTDGSLTATAGFDSIGMIWDLRSGKNIM-N 354

Query: 317 MSGHEDAVTNIEFS 330
           + GH   + +++++
Sbjct: 355 LIGHAKPIYSLDWA 368

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 53/110 (48%), Gaps = 5/110 (4%)

Query: 201 QLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
           QL +GS D T+ +W++ +  ++ + +      H ++V  +++   N     +   D L+K
Sbjct: 373 QLATGSGDGTIKIWDLRNKESNCASIFA----HKNLVTSVQYEKNNGGFVFSAGYDKLIK 428

Query: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNM 310
           I+D + +          +   TL  S   SNL+ ++G D  V ++D  N+
Sbjct: 429 IHDSKTYESVATLEGHTEKILTLDTS-PISNLIVSSGWDRTVKIWDNDNI 477

>Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON}
           complement(19407..20762) [1356 nt, 452 aa]
          Length = 451

 Score = 37.0 bits (84), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 53/126 (42%), Gaps = 6/126 (4%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNL 292
           H   +  +KW+  +  +F T S D+ +KI +     + +  +K     N +  S+  +N+
Sbjct: 172 HKYSIRTLKWYKDDNGMFFTGSYDNSVKIWNTNEF-VPVQDIKLEHKVNQIDCSYQGTNM 230

Query: 293 LAAAGMDSHVYLYDLRNMREPLHHMSGHEDA-----VTNIEFSTHXXXXXXXXXXXNRLI 347
           L  A  D H  L DL NM   L  +    ++     +   +F+              ++ 
Sbjct: 231 LVVATDDYHPRLIDLNNMNLGLTSLGNANNSEMKSPILCCKFNPQRTNIVATGDENGQVK 290

Query: 348 MWDLKQ 353
           +WDL++
Sbjct: 291 LWDLRK 296

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 57/140 (40%), Gaps = 22/140 (15%)

Query: 181 TLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDI 240
           TLK++KD+           G   +GS D++V +W    N+    PV+     H   VN I
Sbjct: 178 TLKWYKDDN----------GMFFTGSYDNSVKIW----NTNEFVPVQDIKLEHK--VNQI 221

Query: 241 KWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAV------KCPQPFNTLAFSHHSSNLLA 294
                   +    ++D   ++ D+   N+ + ++      +   P     F+   +N++A
Sbjct: 222 DCSYQGTNMLVVATDDYHPRLIDLNNMNLGLTSLGNANNSEMKSPILCCKFNPQRTNIVA 281

Query: 295 AAGMDSHVYLYDLRNMREPL 314
               +  V L+DLR     L
Sbjct: 282 TGDENGQVKLWDLRKSNRQL 301

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 59/120 (49%), Gaps = 6/120 (5%)

Query: 211 VALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNIT 270
           + LW+  + ST +S + +W    +D +  +K++     +F +   D+ + + D+R ++ T
Sbjct: 195 IQLWD-SNRSTPLSNL-SWG---ADNITTVKFNQNETDIFASAGSDNSIVLYDLRTNSPT 249

Query: 271 IDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
              V+  +  N + ++   +        D + Y YD+RNM   ++    H  AV +++FS
Sbjct: 250 QKIVQTMRT-NAICWNPMEAFNFVIGNEDHNAYYYDMRNMSRAINVFKDHVSAVMDVDFS 308

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 37.0 bits (84), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 77/173 (44%), Gaps = 10/173 (5%)

Query: 142 VHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTL-KFHKDNGYALSFNALVEG 200
            H+  +T  +Y   + D++ + +  G + ++  +  +   +   H ++   ++F++  + 
Sbjct: 133 AHDSAVTTMKY-SHDGDWMISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSS-NDS 190

Query: 201 QLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
           + ++ SDD+ + +W   +        R  +  H D V    WH     L  + S+D+L+K
Sbjct: 191 KFVTCSDDNILKIWNFSNGKQE----RILSGHHWD-VKSCDWHP-EMGLIASASKDNLVK 244

Query: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR-NMRE 312
           + D R+ N     +K         F     NLL A   D    ++D+R +MRE
Sbjct: 245 LWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMRE 297

>Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar to
           Ashbya gossypii ADR077C
          Length = 1201

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 8/113 (7%)

Query: 202 LLSGSDDHTVALWEVGSNST-SISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
           ++SGSDD  V LW + +     +   R     HS+ V+ + +H + + L  +V EDS ++
Sbjct: 223 IVSGSDDRQVKLWRMSATKAWEVDTCRG----HSNNVDSVIFHPY-QNLIISVGEDSTIR 277

Query: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREP 313
           + D+      +   K  Q    L  +H + NL  AA  DS + ++ L   R P
Sbjct: 278 VWDLD-RRTPVKQFKREQDRFWLVRAHPNINLFGAA-HDSGIMIFKLDRERPP 328

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 105/263 (39%), Gaps = 50/263 (19%)

Query: 103 EINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAK-------YVHEEEITRARYMPQ 155
           E  +P+ +     P E A E  KA LNA K   R+ A+       Y H + +        
Sbjct: 21  ESQLPRNLDPELHPFERAREYTKA-LNATKIE-RMFAQPFVGQLGYGHRDGVYAVAKHYH 78

Query: 156 NPDFVATLNGQGTVFLYSRSGGLQ-STLKFHKDNGYALSFNALVEGQ------LLSGSDD 208
           + + +AT +G G V  ++ S   +  + K H      L  + ++  +      +LS  DD
Sbjct: 79  DLNKMATGSGDGVVKFWNMSSSEELCSFKAHYGIVTGLCVSPVLASKNKNLQYMLSCGDD 138

Query: 209 HTVALWEVGS----------NSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSL 258
            TV LW V +          N  +   ++T+   HS     I  H  N      V+  + 
Sbjct: 139 KTVKLWSVDTDDYADVKDDQNLNTRGLLKTFYGDHS--FQGIDHHRSNSAF---VTGGAQ 193

Query: 259 LKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR---------- 308
           +++ D      T +         ++ F+ + SN+LA+ G D+ + LYDLR          
Sbjct: 194 IQLWDTSRSKSTSNLSWGADNITSVKFNQNDSNILASTGSDNSIVLYDLRTNSPTQKIVQ 253

Query: 309 ---------NMREPLHHMSGHED 322
                    N  EP + ++G+ED
Sbjct: 254 QMRTNSLCWNPMEPFNFVTGNED 276

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 57/120 (47%), Gaps = 6/120 (5%)

Query: 211 VALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNIT 270
           + LW+  S S S S + +W    +D +  +K++  +  +  +   D+ + + D+R ++ T
Sbjct: 194 IQLWDT-SRSKSTSNL-SWG---ADNITSVKFNQNDSNILASTGSDNSIVLYDLRTNSPT 248

Query: 271 IDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
              V+  +  N+L ++            D + Y YD+R M   L+    H  AV +++F+
Sbjct: 249 QKIVQQMRT-NSLCWNPMEPFNFVTGNEDHNAYYYDMRKMNRALNVFKDHVSAVMDVDFA 307

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 86/222 (38%), Gaps = 53/222 (23%)

Query: 199 EGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSL 258
           +G L SGS D T+  W++      I+ +++    H+  VN +           ++S D  
Sbjct: 289 QGVLYSGSHDKTIRAWDMNLGGKCINILKS----HAHWVNHL-----------SLSTDYA 333

Query: 259 LKINDVRAHNITIDAVKCPQPFNTLAFSHHSS---------NLLAAAGMDSHVYLYDLRN 309
           L+I    A + T +    P+     A  ++            L+  A  D  +YL++   
Sbjct: 334 LRIG---AFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLK 390

Query: 310 MREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPE 369
             +P+  M+GH+  V ++ FS             N + +W            +  DG  +
Sbjct: 391 STKPITRMTGHQKLVNHVAFSP-DGRHIVSASFDNSIKLW------------NGRDG--K 435

Query: 370 LIMVHAGHRSSVNDFDLNAQIPW-----LVASSEEENILQVW 406
            I    GH +SV       Q+ W     L+ S  ++  L+VW
Sbjct: 436 FISTFRGHVASV------YQVAWSSDCRLLVSCSKDTTLKVW 471

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 64/134 (47%), Gaps = 19/134 (14%)

Query: 274 VKCPQPFNTLAFSHHS-SNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTH 332
           VK  +P       +H  +NLLAA  MD  + ++DL + +  L   +GH+ A+T ++F   
Sbjct: 72  VKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLS-KSVLLTFNGHKSAITVMKFDVT 130

Query: 333 XXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPW 392
                      N +I+WDL           +E G+ +L      H+ +++      +  W
Sbjct: 131 GTRLISGSRDSN-IIVWDLV----------SEVGLYKL----RSHKDAISGIWCEGE-DW 174

Query: 393 LVASSEEENILQVW 406
           LV++S ++ ++++W
Sbjct: 175 LVSTS-KDGLIKIW 187

>ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL151C (PRP46)
          Length = 425

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 61/125 (48%), Gaps = 8/125 (6%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS+D T+ +W++ +    ++        H   V DI     +  +F + S+D L+K  D
Sbjct: 131 TGSNDSTIRVWDLATGKLKVTL-----QGHIMTVRDICISARHPYMF-SASQDKLVKCWD 184

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +  + +  D        +++   H S +L+ +AG DS V ++D+R+ R  +  ++GH   
Sbjct: 185 LERNTVVRDFHGTLSGVHSVDL-HPSLDLIVSAGRDSVVRVWDIRS-RSCVLTLAGHRGP 242

Query: 324 VTNIE 328
           +  + 
Sbjct: 243 INKVR 247

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 79/185 (42%), Gaps = 9/185 (4%)

Query: 142 VHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTL-KFHKDNGYALSFNALVEG 200
            H+  +T  +Y   + D++ + +  G + ++  +  +   +   H ++   ++F++  + 
Sbjct: 133 AHDSAVTTMKYS-HDSDWMISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSS-NDS 190

Query: 201 QLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
           + ++ SDD+ + +W   +        R  +  H D V    WH     L  + S+D+L+K
Sbjct: 191 KFVTCSDDNILKIWNFSNGKQE----RVLSGHHWD-VKSCDWHP-EMGLIASASKDNLVK 244

Query: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGH 320
           + D R+ N     +K         F     NLL A   D    ++D+R   + L  +   
Sbjct: 245 LWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDE 304

Query: 321 EDAVT 325
            D +T
Sbjct: 305 TDYMT 309

>TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7.322
           YDL145C
          Length = 1208

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 53/269 (19%), Positives = 104/269 (38%), Gaps = 36/269 (13%)

Query: 144 EEEITRAR---YMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALVEG 200
           E + TRA+   + P  P  +  L          R G L    + H      + F+   + 
Sbjct: 8   ESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHDGPVRGIDFHP-TQP 66

Query: 201 QLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
             +S  DD+T+ +W + +N    +      + H D V  + +H     +  + S+D  ++
Sbjct: 67  LFVSAGDDYTIKVWSLETNKCLYTL-----EGHLDYVRTVFFHRELPWII-SASDDQTIR 120

Query: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGH 320
           I + +     I  +     F   A  H + +L+ +A +D  V ++D+  +RE  H   G 
Sbjct: 121 IWNWQNRK-EIACITGHNHFVMCAQFHPTEDLIVSASLDETVRVWDISKLREK-HSAPGG 178

Query: 321 EDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSS 380
            +  +  E                       ++I A+Q   D   G   +  +  GH   
Sbjct: 179 ANIPSTFE-----------------------EKIAAQQNLLDGGFGDCTVKFILEGHTRG 215

Query: 381 VNDFDLNAQIPWLVASSEEENILQVWKCS 409
           VN    +  +P +V+  ++  + ++WK S
Sbjct: 216 VNWASFHPTLPLIVSGGDDRQV-KLWKMS 243

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 74/170 (43%), Gaps = 30/170 (17%)

Query: 175 SGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVAL-----------WEVGSNSTSI 223
           S  L + + F  DN + L    L    LL  S + +V L           +EVG   T+I
Sbjct: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGE--TNI 58

Query: 224 SPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTL 283
           + +R  N       ND +    N  +F   S  S+ KI DVR  +  +  +K  +    L
Sbjct: 59  NSLRVIN-------NDFE----NGCIFAATSLASV-KIYDVRNGDSPVATIKNDKNSVFL 106

Query: 284 AFSHHSSNLLAAA---GMDSHVYLYDLRNMREPLH-HMSGHEDAVTNIEF 329
           +       L+      G+D+ +++YD+R   +P+   +  H D +T+I+F
Sbjct: 107 SLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKF 156

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 54/127 (42%), Gaps = 6/127 (4%)

Query: 199 EGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSL 258
           + + ++ SDD+ + +W   +        RT +  H DI     WH     L  + S+D+L
Sbjct: 186 DSKFVTCSDDNVLKIWNFSNGQVE----RTLSGHHWDI-KSCDWHP-EMGLIVSASKDNL 239

Query: 259 LKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMS 318
           +K+ D R+       +K         F     NLLAA   D    ++D+R+  + L  + 
Sbjct: 240 VKLWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAISKDKSCRVFDIRHSMKELMCVR 299

Query: 319 GHEDAVT 325
              D +T
Sbjct: 300 DEVDYMT 306

>NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672
          Length = 434

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 60/126 (47%), Gaps = 8/126 (6%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
            ++GS+D T+ +W++      ++        H+  V DI     +  +F + SED L+K 
Sbjct: 138 FVTGSNDATIKIWDLAKGHLKLTLAG-----HAMTVRDIAISERHPYMF-SASEDKLVKC 191

Query: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321
            D+  +    D        +++   H + +L+A AG DS V L+D+R  R  +  + GH+
Sbjct: 192 WDLEKNTAIRDYHGHLSGVHSVDI-HPTLDLIATAGRDSVVRLWDIR-ARVSVMTLIGHK 249

Query: 322 DAVTNI 327
             +  +
Sbjct: 250 SPINKV 255

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 59/120 (49%), Gaps = 6/120 (5%)

Query: 211 VALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNIT 270
           + LW+  + S  IS + +W    +D V ++K++     +  +   D+ + + D+R ++ T
Sbjct: 194 IELWD-SNRSNPISNL-SWG---ADNVTNVKFNQNEHDILASTGSDNSIVLYDLRTNSPT 248

Query: 271 IDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
              V+  +  N+L ++   +     A  D + Y YD+R M   L+    H  AV +++FS
Sbjct: 249 QKIVQTMRT-NSLCWNPMEAFNFVTANEDQNSYYYDMRYMSRALNVFKDHVSAVMDVDFS 307

>Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {ON}
           complement(63130..64962) [1833 nt, 611 aa]
          Length = 610

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 57/128 (44%), Gaps = 15/128 (11%)

Query: 194 FNALVEGQLLSGSDDHTVALWEVGSNST------------SISPVRTWNDLHSDIVNDIK 241
           F+   E +++S +DD  +A+W++  N +             ISPV+     H   V  + 
Sbjct: 89  FDPFNERRIVSCADDSKIAVWDIPENYSFHHYLDEDNQPKDISPVKILTG-HKKKVGHVL 147

Query: 242 WHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH 301
           +    + +  + S D  +KI +V      I  +K P    +++FS +  N LA    D  
Sbjct: 148 YSPVAQNILASSSLDYTVKIWNVETGKDEI-TLKHPDMVTSMSFS-YDGNHLATVSRDKK 205

Query: 302 VYLYDLRN 309
           + ++D+R 
Sbjct: 206 LRVWDVRK 213

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 56/270 (20%), Positives = 103/270 (38%), Gaps = 60/270 (22%)

Query: 154 PQNPDFVATLNGQGTVFLY---SRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHT 210
           P N   +A+ +  GT+ ++    R   L  TL  H  +   + +    +G + +GS D T
Sbjct: 272 PGNKPRIASASKDGTIKVWDTVRRQCIL--TLSGHTSSVSCIKWGG--QGVIYTGSHDRT 327

Query: 211 VALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNIT 270
           +  W++ +    I+ +++    H+  VN +           ++S D  LK+    A + T
Sbjct: 328 IRCWDMNAGGKCINILKS----HAHWVNHL-----------SLSTDYALKVG---AFDHT 369

Query: 271 IDAVKCPQPFNTLAFSHHSS---------NLLAAAGMDSHVYLYDLRNMREPLHHMSGHE 321
                  +     A  ++            L+A A  D  +YL++     +PL  M+GH+
Sbjct: 370 YSRPATAEEAQKRALKNYEKVAKRNGVLEELIATASDDFTMYLWNPLKGTKPLTRMTGHQ 429

Query: 322 DAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSV 381
             V ++ FS             N + +W              E    + I    GH +SV
Sbjct: 430 KLVNHVAFSP-DGRYIVSASFDNSIKLW--------------EGSSGKFISTFRGHVASV 474

Query: 382 NDFDLNAQIPW-----LVASSEEENILQVW 406
                  Q+ W     L+ S  ++  L+VW
Sbjct: 475 ------YQVAWSSDCRLLVSCSKDTTLKVW 498

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 61/119 (51%), Gaps = 13/119 (10%)

Query: 158 DFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALV---EGQ-LLSGSDDHTVAL 213
           + +AT +   T++L++    L+ T    +  G+    N +    +G+ ++S S D+++ L
Sbjct: 399 ELIATASDDFTMYLWN---PLKGTKPLTRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKL 455

Query: 214 WEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITID 272
           WE GS+   IS  R     H   V  + W + + +L  + S+D+ LK+ DVR   + +D
Sbjct: 456 WE-GSSGKFISTFRG----HVASVYQVAWSS-DCRLLVSCSKDTTLKVWDVRTRKLAVD 508

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 81/189 (42%), Gaps = 19/189 (10%)

Query: 182 LKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSD---IVN 238
            K HK    + ++N + +   LS S D  V +W     ++ I    T + +H+D   IVN
Sbjct: 100 FKEHKKEVLSCNWNLINKNLFLSSSWDGDVKVWSTARQASLI----TLSPIHTDPTAIVN 155

Query: 239 DIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTL---AFSHHSSNLLAA 295
                N N  L   VS+  L   +      +T  +++     N +    FS H  N++A 
Sbjct: 156 TKS--NINPSL-NNVSQPILHPRSTAIRQPVTSASMQGNDNKNCIYQAQFSPHDPNIVAC 212

Query: 296 AGMDSHVYLYDLR----NMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
               S++ L+DLR    N++  +   SG+E     ++F+ +             + MWD+
Sbjct: 213 CSGTSYLTLFDLRQPTPNVQRGILTQSGYE--TLTLDFNKYRSHIIATSGVDKAIKMWDM 270

Query: 352 KQIGAEQTP 360
           + I +  +P
Sbjct: 271 RFIPSTFSP 279

>YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subunit
           of the SEA (Seh1-associated) complex, a coatomer-related
           complex that associates dynamically with the vacuole;
           has N-terminal WD-40 repeats and a C-terminal RING
           motif; mtc5 is synthetically sick with cdc13-1
          Length = 1148

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 4/127 (3%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSN 291
           HS  + DI ++  +  +  T S D+ +   D+R+ H             + + +++   N
Sbjct: 113 HSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPN 172

Query: 292 LLAAA-GMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWD 350
           +LA++ G D  ++++DLR    PL  + GH  +V +I+F+               +  WD
Sbjct: 173 VLASSHGND--IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKYSEIMSSSNDGTVKFWD 230

Query: 351 LKQIGAE 357
             +   E
Sbjct: 231 YSKSTTE 237

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 148 TRARYMPQNPDFVATLNGQGTVFLYSRSGGLQ-STLKFHKDNGYALSFNALVEGQLLSGS 206
           ++ ++  ++P+ +A+ +G        R G     +LK H  +  ++ FN     +++S S
Sbjct: 162 SQVKWNYKDPNVLASSHGNDIFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKYSEIMSSS 221

Query: 207 DDHTVALWEVGSNST 221
           +D TV  W+   ++T
Sbjct: 222 NDGTVKFWDYSKSTT 236

>Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429W
           (REAL)
          Length = 652

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 56/130 (43%), Gaps = 15/130 (11%)

Query: 194 FNALVEGQLLSGSDDHTVALWEV------------GSNSTSISPVRTWNDLHSDIVNDIK 241
           F+   + ++ SGSDD  + +W +                  I PV+     H+  V  + 
Sbjct: 89  FDPFNDHRIASGSDDSKIGIWNIPESYKFHDHVNEDGEPIDIEPVKFLTG-HARKVGHVL 147

Query: 242 WHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH 301
           +H   + +  + S D  +K+ DV      I  +K P    +++FS +  N LA    D  
Sbjct: 148 YHPVAKNVLASSSGDYTVKLWDVETGKDMI-TLKHPDMVTSMSFS-YDGNYLATVARDKK 205

Query: 302 VYLYDLRNMR 311
           + ++++R+ +
Sbjct: 206 LRVWNIRDEK 215

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 57/128 (44%), Gaps = 12/128 (9%)

Query: 189 GYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEK 248
           G+ L ++ + +  L S S D+TV LW+V +    I+        H D+V  + + +++  
Sbjct: 144 GHVL-YHPVAKNVLASSSGDYTVKLWDVETGKDMITL------KHPDMVTSMSF-SYDGN 195

Query: 249 LFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGM----DSHVYL 304
              TV+ D  L++ ++R   I  +        N       +S+ LA  G     D  + +
Sbjct: 196 YLATVARDKKLRVWNIRDEKIVSEGFAHTGAKNQRVVWLGNSDRLATTGFSKLSDRQIGI 255

Query: 305 YDLRNMRE 312
           +D  N+ +
Sbjct: 256 WDAFNLEK 263

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 57/122 (46%), Gaps = 10/122 (8%)

Query: 211 VALWEVGSNSTSISPVR--TWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHN 268
           + LW+V      + PV   +W    +D +  +K++     +  +   D+ + + D+R ++
Sbjct: 201 IQLWDVNR----VKPVSNLSWG---ADNITSVKFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 269 ITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIE 328
            T   V+  +  N + ++   +     A  D + Y YD+RN+   L+    H  AV +++
Sbjct: 254 PTQKIVQTMRT-NAICWNPMEAFNFVIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVD 312

Query: 329 FS 330
           FS
Sbjct: 313 FS 314

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 36/188 (19%), Positives = 81/188 (43%), Gaps = 23/188 (12%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHN 244
           H+D  YA++ N     +L +GS D  +  W + +    +S    +  +    V    +H+
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPHFHD 125

Query: 245 -----FNEKLFGTVSEDSLLKINDVRAHNIT----------IDAVKCPQPFN-TLAF--- 285
                 N+    + S+D  +K+  +   + +          I+     + F+   AF   
Sbjct: 126 KKPDLKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVINEEGLVRTFDGESAFQGI 185

Query: 286 -SHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXN 344
            SH  ++  A  G  + + L+D+ N  +P+ ++S   D +T+++F+ +           N
Sbjct: 186 DSHRVNSTFATGG--AKIQLWDV-NRVKPVSNLSWGADNITSVKFNQNETDILASTGSDN 242

Query: 345 RLIMWDLK 352
            ++++DL+
Sbjct: 243 SIVLYDLR 250

>Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429W
           (REAL)
          Length = 642

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 57/130 (43%), Gaps = 15/130 (11%)

Query: 194 FNALVEGQLLSGSDDHTVALWEVGSN------------STSISPVRTWNDLHSDIVNDIK 241
           F+   + ++ S SDD  + +W+V  N               I PV+     H+  V  + 
Sbjct: 89  FDPFNDRRIASSSDDSKIGIWDVPENYKFHDHVDENGDPIDIKPVKFLTG-HARKVGHVL 147

Query: 242 WHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSH 301
           +H   + +  + S D  +K+ DV      I  +K P    +++FS +  N LA    D  
Sbjct: 148 YHPVAKNVLASSSGDYTVKLWDVETGKDVI-TLKHPDMVTSMSFS-YDGNHLATVARDKK 205

Query: 302 VYLYDLRNMR 311
           + ++++R+ +
Sbjct: 206 LRVWNIRDEK 215

>Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W
           (WTM2) - Transcriptional modulator [contig 67] FULL
          Length = 381

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 46/110 (41%), Gaps = 2/110 (1%)

Query: 251 GTVSEDSLLKIND-VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRN 309
           GT  E SLLKI D  ++    I ++  P    T     H +++ +    D+ +  YD R 
Sbjct: 137 GTGEEHSLLKIVDNSQSPGRLIRSICIPGTTVTHTIKFHDNHMFSTCSDDNKIRFYDTRG 196

Query: 310 MREPLHHMSG-HEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQ 358
             +PL  +   H+  +T  + S               L +WDL+ + A Q
Sbjct: 197 DGKPLWEVCDPHDGRLTCFDVSPALETLFVTGSDTGVLKLWDLRSVIAAQ 246

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 53/126 (42%), Gaps = 2/126 (1%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA-HNITIDAVKCPQPFNTLAFSHHSSN 291
           H   + DI +H    ++  T S D+     D+R+                 + ++H +SN
Sbjct: 113 HFRAITDINFHPLQPEILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVKWNHKNSN 172

Query: 292 LLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
           +LA +  +  VY++D+R    PL  + GH  +V +I+F+               +  WD 
Sbjct: 173 VLATSHSNI-VYVWDVRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDY 231

Query: 352 KQIGAE 357
            ++  E
Sbjct: 232 NKVEDE 237

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/115 (20%), Positives = 48/115 (41%), Gaps = 14/115 (12%)

Query: 292 LLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDL 351
           +LA + +D++   +D+R+ ++P    S        ++++ H           N + +WD+
Sbjct: 129 ILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVKWN-HKNSNVLATSHSNIVYVWDV 187

Query: 352 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVW 406
           ++            G   L ++  GH  SVN  D N      + SS  +  ++ W
Sbjct: 188 RK------------GTSPLSVLE-GHSGSVNSIDFNPFNETEIMSSGNDGTVKFW 229

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 57/122 (46%), Gaps = 10/122 (8%)

Query: 211 VALWEVGSNSTSISPVR--TWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHN 268
           + LW+V      + PV   +W    +D +  +K++     +  +   D+ + + D+R ++
Sbjct: 201 IHLWDVNR----LKPVSNLSWG---ADNITSVKFNQSETDILASTGSDNSIVLYDLRTNS 253

Query: 269 ITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIE 328
            T   V+  +  N + ++   +     A  D + Y YD+RN+   L+    H  AV +++
Sbjct: 254 PTQKIVQTMRT-NAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVD 312

Query: 329 FS 330
           FS
Sbjct: 313 FS 314

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/192 (18%), Positives = 78/192 (40%), Gaps = 31/192 (16%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHN 244
           H+D  YA++ N     +L +GS D  +  W + +    +S    +  +    V   ++H+
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPRFHD 125

Query: 245 -----FNEKLFGTVSEDSLLKINDVRAHNI-------------------TIDAVKCPQPF 280
                 N+    + S+D  +K+  +   +                    T D     Q  
Sbjct: 126 KKPDLKNQNFMLSCSDDKTVKLWSINVDDFSNKSSSDNDSVTNEEGLVRTFDGESAFQGI 185

Query: 281 NTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXX 340
           +    SH  ++  A  G  + ++L+D+ N  +P+ ++S   D +T+++F+          
Sbjct: 186 D----SHRENSTFATGG--AKIHLWDV-NRLKPVSNLSWGADNITSVKFNQSETDILAST 238

Query: 341 XXXNRLIMWDLK 352
              N ++++DL+
Sbjct: 239 GSDNSIVLYDLR 250

>NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON}
           Anc_4.309 YLR429W
          Length = 661

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 7/68 (10%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
           L S S D++V +W +G+    I+ +R     HSD+V  + + +++     T+S D +L+I
Sbjct: 160 LASSSLDYSVKIWNIGTKKDEIT-LR-----HSDMVTSMSF-SYDGAYLATISRDKMLRI 212

Query: 262 NDVRAHNI 269
            D+R + I
Sbjct: 213 WDIRENKI 220

>Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178W
           (REAL)
          Length = 470

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 3/98 (3%)

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNL 292
           H   V+D+K+H  + K  G+ S D   ++ D   H   +      +   +L+F    S L
Sbjct: 269 HERRVSDVKYHP-SGKFIGSASHDMTWRLWDASTHQELLLQEGHSKGVFSLSFQCDGS-L 326

Query: 293 LAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
           + + GMDS   L+D+R+  + +  ++GH   V  + +S
Sbjct: 327 VCSGGMDSLTMLWDIRSGSKVM-TLAGHSKPVYTVAWS 363

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 66/152 (43%), Gaps = 20/152 (13%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHN 244
           H    Y+ SF+A  E  LLS S+D TV LW V  +     P+ ++   H   V D+++  
Sbjct: 573 HSGTVYSTSFSAGDE-YLLSASEDKTVRLWSVQDD----KPLVSYKG-HEKPVWDVEFSP 626

Query: 245 FNEKLFGTVSED------SLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGM 298
               LF T S D      S  ++  +R     ++ V C      ++F H +   +     
Sbjct: 627 SCNNLFATASNDQTARLWSCDRVYPLRVMAGHLNDVDC------VSF-HSNGRYIFTGSS 679

Query: 299 DSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
           D  V ++D+ N  + +    GH   VT++  S
Sbjct: 680 DKTVRMWDI-NTGDSVRLFMGHNSTVTSLSVS 710

>NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672
          Length = 431

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 59/124 (47%), Gaps = 8/124 (6%)

Query: 204 SGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKIND 263
           +GS+D T+ +W++      ++        H   V DI     +  LF + SED L+K  D
Sbjct: 137 TGSNDTTIKIWDLAKGKLKVTLAG-----HIMTVRDIAISKRHPYLF-SASEDKLVKCWD 190

Query: 264 VRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDA 323
           +  +    D        +++   H + +L+A AG DS V L+D+R  R  +  + GH++ 
Sbjct: 191 LEKNMAIRDYHGHLSGVHSVDI-HPTLDLIATAGRDSVVRLWDIR-ARVAVMTLIGHKNP 248

Query: 324 VTNI 327
           +  +
Sbjct: 249 INKV 252

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 73/152 (48%), Gaps = 20/152 (13%)

Query: 188 NGYALSFNALVEGQLLSGSDDHTVAL--WEVGSNSTSISPVRT-WNDLHSDIVNDIKWHN 244
           N + L F  L    LL+   +  +++  W+       I    T  ND   +IVN    +N
Sbjct: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDF--EIVN----NN 67

Query: 245 FNEKLFGTVSEDSLLKINDVRAHNI--TIDAVKCPQPFNTLAFSHHSSNLLAA----AGM 298
           +N       + +  +KI D+++++   TI   K   PF +L   H   N++A     +G+
Sbjct: 68  YNGGSLMVTATNESVKIYDLKSNDCIKTITNEK-NSPFLSLDSLH---NMMACGTELSGV 123

Query: 299 DSHVYLYDLRNMREPLH-HMSGHEDAVTNIEF 329
           D+ +Y+YD+R+   P+   +  H D +T+I+F
Sbjct: 124 DAELYIYDIRSWDTPIRSFVDSHHDDITDIKF 155

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 61/140 (43%), Gaps = 11/140 (7%)

Query: 129 NAPKSNIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDN 188
           N  K  I+I    +++ EI    Y       + T   +       +S     T+   K++
Sbjct: 45  NQIKDKIKIGETSINDFEIVNNNY--NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNS 102

Query: 189 GYALSF----NALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHN 244
            + LS     N +  G  LSG D   + ++++ S  T   P+R++ D H D + DIK+H 
Sbjct: 103 PF-LSLDSLHNMMACGTELSGVDAE-LYIYDIRSWDT---PIRSFVDSHHDDITDIKFHP 157

Query: 245 FNEKLFGTVSEDSLLKINDV 264
            + K+  + S D    I D+
Sbjct: 158 NDSKVLMSGSTDGYTNIYDL 177

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 55/119 (46%), Gaps = 12/119 (10%)

Query: 246 NEKLFGTVSEDSLLKINDVRAHNI--TIDAVKCPQPFNTLAFSHHSSNLLAA----AGMD 299
           NE  + T +  ++ KI D+R++N   TI   K   PF +L   H   N+LA     +G D
Sbjct: 70  NESTYATATMGAV-KIWDIRSNNCLATISNDK-NAPFLSLDSRH---NMLACGTELSGSD 124

Query: 300 SHVYLYDLRNMREPLHHM-SGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAE 357
           + +++YD+R    PL  +   H D +T+I F                  ++DL+Q   E
Sbjct: 125 AELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 12/75 (16%)

Query: 195 NALVEGQLLSGSDD----HTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLF 250
           N L  G  LSGSD     + V  W+        SP+R+  D H D + DI +H  +  + 
Sbjct: 112 NMLACGTELSGSDAELHIYDVRKWD--------SPLRSLVDSHHDDITDIAFHPSDPNVL 163

Query: 251 GTVSEDSLLKINDVR 265
            + S D    I D+R
Sbjct: 164 MSGSTDGYTNIYDLR 178

>NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.534
           YKL213C
          Length = 725

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 65/134 (48%), Gaps = 9/134 (6%)

Query: 176 GGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSD 235
           G LQ +L+ H+ + +     ++ E   ++ S D TV LW+          ++T++ +HSD
Sbjct: 131 GALQWSLEGHQASVWDAKIISVEENTFITASADRTVKLWKEN------KLLKTFSGIHSD 184

Query: 236 IVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAA 295
           ++ +I+  +  +++  T S D  +KI+D+   NI    +   + F          + L +
Sbjct: 185 VIRNIEVLSSGKEI-ATCSNDGTIKISDLDG-NIK-QVLSGHESFVYNVKLSKQGDKLVS 241

Query: 296 AGMDSHVYLYDLRN 309
            G D  + ++D+ N
Sbjct: 242 CGEDRSLRIWDINN 255

>SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [1326
           bp, 441 aa] {ON} weakly similar to uniprot|Q12206
           YOR229W Saccharomyces cerevisiae WTM2 WD repeat
           containing transcriptional modulator 2
          Length = 441

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 85/214 (39%), Gaps = 41/214 (19%)

Query: 226 VRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA----------HNITIDAVK 275
           +RT N   + + + +K+HN    LF T S+D+ L+  DVR+           N ++    
Sbjct: 216 LRTINIPGTTVSHTVKFHN--NHLFSTCSDDNRLRFWDVRSDKPVWSLSDPKNGSLTCFD 273

Query: 276 CPQPFNTLAFSHHSSNLL---------AAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326
                +TL  +  S+ +L         A++G D      D       L+H  G  D+V +
Sbjct: 274 VSPVIDTLFVTGTSTGVLKLWDLRAVAASSGHDD-----DCTTEIVSLYHSGG--DSVAD 326

Query: 327 IEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPE------LIMVH-AGHRS 379
           ++F                +  WDL+ + A  + +D E    E      L  +H  G R 
Sbjct: 327 VQFGFTSPTQFLSVGGSGNVYHWDLEYLFASGSGEDDEVLDSEELQQQCLKFMHTGGGRR 386

Query: 380 SVNDFDLNAQIPW------LVASSEEENILQVWK 407
           S+ + +    + W      +V   + + +L V+K
Sbjct: 387 SIGNLNKRGTVSWHEIIDDVVGCVDADGLLTVYK 420

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 79/185 (42%), Gaps = 9/185 (4%)

Query: 142 VHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTL-KFHKDNGYALSFNALVEG 200
            H+  +T  +Y   + D++ + +  G + ++  +  +   +   H ++   ++F++  + 
Sbjct: 135 AHDSAVTTMKY-SHDGDWMISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSS-NDS 192

Query: 201 QLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
           + ++ SDD+ + +W   +        R  +  H D V    WH     L  + S+D+L+K
Sbjct: 193 KFVTCSDDNILKIWNFSNGKQE----RVLSGHHWD-VKSCDWHP-EMGLIASASKDNLVK 246

Query: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGH 320
           + D R+ N     +K         F     NLL A   D    ++D+R   + L  +   
Sbjct: 247 LWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDE 306

Query: 321 EDAVT 325
            D +T
Sbjct: 307 TDYMT 311

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 75/183 (40%), Gaps = 17/183 (9%)

Query: 185 HKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHN 244
           H+D  Y ++ N  V  +L S S D  V  W + +     S    +  +    V+     N
Sbjct: 66  HRDGCYVIAKNYNVLNRLASASADGVVKYWNISTREELCSFKAHYGLVTGLCVSPQHIGN 125

Query: 245 FNEKLFGTVSEDSLLKINDVRA--HNITIDAVKCPQP----------FNTLAFS---HHS 289
            ++    +  +D ++K+  V +   N   D  K   P          +   AF    HH 
Sbjct: 126 QSDSYMLSCGDDKMVKMWSVDSGDFNNVKDDTKVLHPSDGNGLIKTFYGEHAFQGIDHHK 185

Query: 290 SNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMW 349
            N     G  + + L+D+ N R+PL ++S   D +T ++F+ +           N ++++
Sbjct: 186 ENTSFVTG-GAQIELWDI-NRRKPLSNLSWGIDNITAVKFNQNEADLLLSSGSDNSVVLY 243

Query: 350 DLK 352
           DL+
Sbjct: 244 DLR 246

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 54/151 (35%), Gaps = 49/151 (32%)

Query: 180 STLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVND 239
           S L +  DN  A+ FN      LLS   D++V L+++ +NS +   V+T         N 
Sbjct: 209 SNLSWGIDNITAVKFNQNEADLLLSSGSDNSVVLYDLRTNSPTQKIVQTMK------TNS 262

Query: 240 IKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMD 299
           + W+                                  +PFN              A  D
Sbjct: 263 MCWNPM--------------------------------EPFN-----------FVTANED 279

Query: 300 SHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
            + Y YD+RNM   LH    H  A+ +++ S
Sbjct: 280 QNAYYYDMRNMSRALHVFKDHVSAIMDVDIS 310

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 64/138 (46%), Gaps = 14/138 (10%)

Query: 200 GQLLSGSDDHTVALWE--VGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDS 257
           G ++SGS D+ + LW+   G N ++I  ++     H+ I    K+      L   VS+D 
Sbjct: 218 GLIVSGSKDNLIKLWDPRTGRNVSTILGLK-----HTVI--KTKFQPTQGNLLAVVSKDK 270

Query: 258 LLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDL----RNMREP 313
            +KI D+R H   +  ++    + +L++   +  + +    +  +  +DL     N    
Sbjct: 271 SIKIYDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPA 330

Query: 314 LHHMS-GHEDAVTNIEFS 330
            H +   HE +VT++ +S
Sbjct: 331 CHTIPYAHEKSVTSLAYS 348

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 72/144 (50%), Gaps = 10/144 (6%)

Query: 119 EAEEDDKATLNAPKSNIRITAKYVHEEEITRARYMPQNPDFV-ATLNGQGTVFLYSRSGG 177
           +A  D +  LN P     +++  V +  I    + P+    V AT +G+ +++  S S  
Sbjct: 55  DAYRDHRRVLNIPTKFTHLSSNKV-KHVIPAITWTPEGRRLVVATYSGEFSLWNGS-SFN 112

Query: 178 LQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIV 237
            +S ++ H D+   +   +     L+SG  D T+ +W+   N      V+  +  H++ +
Sbjct: 113 FESIMQAH-DSAVTVMQYSHAGDWLISGDADGTIKIWQPNFNM-----VKVLDRAHTECM 166

Query: 238 NDIKWHNFNEKLFGTVSEDSLLKI 261
            DI + +++++ F T S+D++LKI
Sbjct: 167 RDISF-SYSDQKFVTCSDDNVLKI 189

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 87/223 (39%), Gaps = 42/223 (18%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
           L SGS D TV +W++      I+ +++    H+  VN +          G      ++  
Sbjct: 292 LYSGSHDKTVRVWDMNLGGKCINILKS----HAHWVNHLSLSTDYALRVGPFDHTGIMPA 347

Query: 262 NDVRAHNITIDAVKCPQPFNTLAFSHHSS-NLLAAAGMDSHVYLYDLRNMREPLHHMSGH 320
               A        K  + +  +A  + S   L+  A  D  ++L++     +P+  M+GH
Sbjct: 348 TPEEAR------AKALKNYEKVAKRNGSDEELMVTASDDFTMFLWNPSKSTKPISRMTGH 401

Query: 321 EDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSS 380
           +  V ++ FS             N + +W            D+ DG  + I    GH +S
Sbjct: 402 QKLVNHVAFSP-DGRYIVSASFDNSIKLW------------DSRDG--KFITTFRGHVAS 446

Query: 381 VNDFDLNAQIPW-----LVASSEEENILQVW-----KCSHNLP 413
           V       Q+ W     L+AS  ++  L+VW     K S +LP
Sbjct: 447 V------YQVAWSSDCRLLASCSKDTSLKVWDIRTKKLSVDLP 483

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 71/158 (44%), Gaps = 14/158 (8%)

Query: 173 SRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDL 232
           +R+  L++  K  K NG         E  +++ SDD T+ LW    ++  IS +      
Sbjct: 352 ARAKALKNYEKVAKRNGSD-------EELMVTASDDFTMFLWNPSKSTKPISRMTG---- 400

Query: 233 HSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNL 292
           H  +VN + + + + +   + S D+ +K+ D R                 +A+S     L
Sbjct: 401 HQKLVNHVAF-SPDGRYIVSASFDNSIKLWDSRDGKFITTFRGHVASVYQVAWS-SDCRL 458

Query: 293 LAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS 330
           LA+   D+ + ++D+R  +  +  + GH D V  +++S
Sbjct: 459 LASCSKDTSLKVWDIRTKKLSV-DLPGHLDEVYTVDWS 495

>CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly
           similar to uniprot|P20484 Saccharomyces cerevisiae
           YKL021c MAK11 involved in cell growth and replication of
           M1 dsRNA virus
          Length = 388

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 57/126 (45%), Gaps = 24/126 (19%)

Query: 289 SSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFS--------THXXXXXXXX 340
           S   L +   D H+ +YDL+  R+ L  +  H+ ++TN++FS        +         
Sbjct: 50  SKRYLVSGSNDEHIRIYDLQK-RKELGTLLAHQGSITNLKFSKVSDQEPKSTSGKWLLSA 108

Query: 341 XXXNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEE 400
              N++I+W +K         D E+          GH + +ND D++     +VAS  E+
Sbjct: 109 SEDNKIIVWRVK---------DWEN-----FGTLKGHTARINDMDIHPS-NRVVASVSED 153

Query: 401 NILQVW 406
           + +++W
Sbjct: 154 HSIRLW 159

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 48/115 (41%), Gaps = 7/115 (6%)

Query: 199 EGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSL 258
           + + +S SDD+ + +W    N T+    R     H D V    WH     L  + S+D+L
Sbjct: 178 DSKFVSCSDDNILKIW----NFTNGQQERVLTGHHWD-VKSCDWHP-TMGLIASASKDNL 231

Query: 259 LKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR-NMRE 312
           +K+ D R  N     +K         F     NLL     D    ++D+R NM E
Sbjct: 232 VKLWDPRTGNCVSTILKFKHTVLKTRFQPGGGNLLLGISKDKSCRVFDIRQNMTE 286

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 55/120 (45%), Gaps = 12/120 (10%)

Query: 246 NEKLFGTVSEDSLLKINDVRAHNITIDAV---KCPQPFNTLAFSHHSSNLLAA----AGM 298
           N  +F     D++ K+ D+R    +I A    +   PF +L   H    +LA     +G+
Sbjct: 71  NGSVFSVAMNDAV-KVLDLRVQGNSIVAELNNEKKTPFLSLDSRH---GMLACGTELSGV 126

Query: 299 DSHVYLYDLRNMREPLHHM-SGHEDAVTNIEFSTHXXXXXXXXXXXNRLIMWDLKQIGAE 357
           D+ +++YD+RN  +P+  +   H D VT+I+F                  ++DL Q+  E
Sbjct: 127 DAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186

>ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {ON}
           highly similar to uniprot|Q75AV4 Ashbya gossypii ADL184W
           PSF2 Polyadenylation factor subunit 2 and similar to
           YNL317W uniprot|P42841 Saccharomyces cerevisiae YNL317W
           PFS2 Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 445

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 50/115 (43%), Gaps = 7/115 (6%)

Query: 199 EGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSL 258
           + + ++ SDD+ + +W   +        R  +  H D V    WH     L  + S+D+L
Sbjct: 177 DSKFVTCSDDNILKIWNFSNGQQE----RVLSGHHWD-VKSCDWHP-QMGLIASASKDNL 230

Query: 259 LKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR-NMRE 312
           +K+ D R+       +K         F     NL+AA   D    ++DLR +M+E
Sbjct: 231 VKLWDPRSGQCVSTLLKFKHTVLKTKFQPTQGNLMAAISKDKSCRVFDLRQSMKE 285

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 53/117 (45%), Gaps = 7/117 (5%)

Query: 199 EGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSL 258
           + + +S SDD+ + +W   +        R  +  H D V    WH     L  + S+D+L
Sbjct: 175 DSKFVSCSDDNILKIWNFSNGKLE----RVLSGHHWD-VKSCDWHP-EMGLIISASKDNL 228

Query: 259 LKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR-NMREPL 314
           +K+ D R+ N     +K       + F     N++AA   D    ++D+R +M+E L
Sbjct: 229 IKLWDPRSGNCVSTILKFKHTVLKVKFQPTGGNMIAAISKDKSCRVFDIRHSMKELL 285

>Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {ON}
           complement(40550..41851) [1302 nt, 434 aa]
          Length = 433

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 61/131 (46%), Gaps = 20/131 (15%)

Query: 204 SGSDDHTVALWEVGSN------STSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDS 257
           +GS D TV +W++ S       S  + PVR           DI   + +  LF + SED 
Sbjct: 139 TGSTDTTVKVWDLVSGHLKLTLSGHVMPVR-----------DITVSDRHPYLF-SASEDK 186

Query: 258 LLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHM 317
           L+K  D+  +    D         ++A  H + +L+A AG DS V L+D+R+  E +  +
Sbjct: 187 LVKCWDLEKNMAIRDYHGHLSGVYSVAI-HPTLDLIATAGRDSVVRLWDIRSRMEVM-TL 244

Query: 318 SGHEDAVTNIE 328
            GH+  +  + 
Sbjct: 245 IGHKGPINKVR 255

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 73/172 (42%), Gaps = 9/172 (5%)

Query: 138 TAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTL-KFHKDNGYALSFNA 196
           T    H+  +T  +Y     D++ + +  GT+ ++  +  +   L + H +    ++F+ 
Sbjct: 118 TIMQAHDTSVTTMKYS-HAGDWMISGDADGTIKIWQPNFNMVKELDRIHTEGIRDVAFSN 176

Query: 197 LVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSED 256
             + + ++ SDD+ + +W   +        R  +  H D V    WH     L  + S+D
Sbjct: 177 -NDSKFVTCSDDNILKIWNFSNGQQE----RVLSGHHWD-VRSCDWHP-ELGLIVSGSKD 229

Query: 257 SLLKINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLR 308
           +L+K+ D R+       +K         F     NLLAA   D    ++DLR
Sbjct: 230 NLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLR 281

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 58/132 (43%), Gaps = 7/132 (5%)

Query: 200 GQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLL 259
           G ++SGS D+ V LW+  S     + ++         V   ++      L   +S+D   
Sbjct: 221 GLIVSGSKDNLVKLWDPRSGQCVSTLLK-----FKHTVLKTRFQPTKGNLLAAISKDKSC 275

Query: 260 KINDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDL-RNMREPLHHMS 318
           ++ D+RA    +  V+    F  L +S  + ++      D  +  +DL ++  +P+H + 
Sbjct: 276 RVFDLRASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDLGQDTEKPIHIIP 335

Query: 319 -GHEDAVTNIEF 329
             HE  ++ I +
Sbjct: 336 FAHEKCISAIAY 347

>ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL145C
           (COP1)
          Length = 1204

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 202 LLSGSDDHTVALWEVGSNST-SISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
           ++SGSDD  V LW + S     +   R     H++ V+ + +H F + L  +V EDS ++
Sbjct: 224 IVSGSDDRQVKLWRMSSTKAWEVDTCRG----HTNNVDSVIFHPF-QNLIISVGEDSTIR 278

Query: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPL 314
           + D+          +    F ++  +H + NL  AA  DS + ++ L   R P+
Sbjct: 279 VWDLDKRTPVKQFKREQDRFWSIR-AHPNVNLFGAA-HDSGIMVFKLDRERPPV 330

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 73/186 (39%), Gaps = 40/186 (21%)

Query: 202 LLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKI 261
           L+S S D T  +W++ SN+     V+T    H   V D+++   + +LF +   D  +++
Sbjct: 259 LISSSIDTTCIVWDLQSNNY----VKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRV 314

Query: 262 NDVR--AHNITI---------------DAVKCPQPFNT------------------LAFS 286
            D+R  AH+  I                 V  P   NT                  L  S
Sbjct: 315 FDLRSLAHSTIIYESAANTSMSNLSSGGMVDHPGSLNTSSRVGSVDLSSKSNALLRLEPS 374

Query: 287 HHSSNLLAAAGMDSH-VYLYDLRNMREPLHHMSGHEDAVTNIEFSTHXXXXXXXXXXXNR 345
               N++A  G DS+ V + D+RN   P+  + GH   +  I++               +
Sbjct: 375 PTDPNVIATFGADSNSVLILDMRNPGTPVLTLDGHSAPINQIKWHPTKKNTILSSSDDCQ 434

Query: 346 LIMWDL 351
           ++ W+L
Sbjct: 435 VLYWNL 440

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 79/185 (42%), Gaps = 9/185 (4%)

Query: 142 VHEEEITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTL-KFHKDNGYALSFNALVEG 200
            H+  +T  +Y   + D++ + +  G + ++  +  +   +   H ++   ++F++  + 
Sbjct: 133 AHDSAVTTMKY-SHDSDWMISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSS-NDS 190

Query: 201 QLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLK 260
           + ++ SDD+ + +W   +        R  +  H D V    WH     L  + S+D+L+K
Sbjct: 191 KFVTCSDDNILKIWNFSNGKEE----RVLSGHHWD-VKSCDWHP-EMGLIASASKDNLVK 244

Query: 261 INDVRAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGH 320
           + D R+ N     +K         F     NLL A   D    ++D+R   + L  +   
Sbjct: 245 LWDPRSGNCISSILKFKHTVLKTRFQPVKGNLLMAISKDKSCRVFDIRYSMKELMCVRDE 304

Query: 321 EDAVT 325
            D +T
Sbjct: 305 TDYMT 309

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,433,309
Number of extensions: 2153231
Number of successful extensions: 8787
Number of sequences better than 10.0: 590
Number of HSP's gapped: 8384
Number of HSP's successfully gapped: 783
Length of query: 427
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 315
Effective length of database: 40,638,807
Effective search space: 12801224205
Effective search space used: 12801224205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)