Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_5.30na 1ON23423411551e-162
YEL057Cna 1ON2332348701e-119
Skud_5.32na 1ON2332348201e-111
Suva_5.11na 1ON2332348021e-108
Ecym_81361.141ON135748702.0
Kpol_2000.701.77ON68398666.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_5.30
         (234 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_5.30 Chr5 complement(47313..48017) [705 bp, 234 aa] {ON} YE...   449   e-162
YEL057C Chr5 complement(45020..45721) [702 bp, 233 aa] {ON} Prot...   339   e-119
Skud_5.32 Chr5 complement(44026..44727) [702 bp, 233 aa] {ON} YE...   320   e-111
Suva_5.11 Chr5 complement(21032..21733) [702 bp, 233 aa] {ON} YE...   313   e-108
Ecym_8136 Chr8 (287415..291488) [4074 bp, 1357 aa] {ON} similar ...    32   2.0  
Kpol_2000.70 s2000 complement(152953..155004) [2052 bp, 683 aa] ...    30   6.2  

>Smik_5.30 Chr5 complement(47313..48017) [705 bp, 234 aa] {ON}
           YEL057C (REAL)
          Length = 234

 Score =  449 bits (1155), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 222/234 (94%), Positives = 222/234 (94%)

Query: 1   MVNDGIQRNDFNEKELKTVRFSAYSKEIDVIMRKISFLEKNITQQLYTLPHFPKTLPPNH 60
           MVNDGIQRNDFNEKELKTVRFSAYSKEIDVIMRKISFLEKNITQQLYTLPHFPKTLPPNH
Sbjct: 1   MVNDGIQRNDFNEKELKTVRFSAYSKEIDVIMRKISFLEKNITQQLYTLPHFPKTLPPNH 60

Query: 61  KTGVRRTNRTKENWSNQLNNLLGIYSKDEIFTLDSLAATLHDQVLRLQSTLFPIAILEQV 120
           KTGVRRTNRTKENWSNQLNNLLGIYSKDEIFTLDSLAATLHDQVLRLQSTLFPIAILEQV
Sbjct: 61  KTGVRRTNRTKENWSNQLNNLLGIYSKDEIFTLDSLAATLHDQVLRLQSTLFPIAILEQV 120

Query: 121 HLNNDNVENKKLLKEITYEYLSKENCGGANKFGTFIIKRIFFGDLSLGISILVNRTTFEX 180
           HLNNDNVENKKLLKEITYEYLSKENCGGANKFGTFIIKRIFFGDLSLGISILVNRTTFE 
Sbjct: 121 HLNNDNVENKKLLKEITYEYLSKENCGGANKFGTFIIKRIFFGDLSLGISILVNRTTFET 180

Query: 181 XXXXXXXXXXXFIENDFLYEDYLIFDCNVKRREKFKRKILFISTTINFNYQTKV 234
                      FIENDFLYEDYLIFDCNVKRREKFKRKILFISTTINFNYQTKV
Sbjct: 181 VTSSIIVVRSSFIENDFLYEDYLIFDCNVKRREKFKRKILFISTTINFNYQTKV 234

>YEL057C Chr5 complement(45020..45721) [702 bp, 233 aa] {ON} Protein
           of unknown function involved in telomere maintenance;
           target of UME6 regulation
          Length = 233

 Score =  339 bits (870), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 173/234 (73%), Positives = 196/234 (83%), Gaps = 1/234 (0%)

Query: 1   MVNDGIQRNDFNEKELKTVRFSAYSKEIDVIMRKISFLEKNITQQLYTLPHFPKTLPPNH 60
           M NDGIQRND N K  KTV+FSAYSKEIDVIM+KISFLE+NITQQL TLPHFPKTLPPNH
Sbjct: 1   MANDGIQRND-NRKGFKTVQFSAYSKEIDVIMKKISFLERNITQQLDTLPHFPKTLPPNH 59

Query: 61  KTGVRRTNRTKENWSNQLNNLLGIYSKDEIFTLDSLAATLHDQVLRLQSTLFPIAILEQV 120
           K  V R +R +  WS+QL NLLGIYSK+EIFTLD+LAATLHDQVL+LQ+TLFP AIL+QV
Sbjct: 60  KDCVSRKHRARRGWSSQLKNLLGIYSKEEIFTLDNLAATLHDQVLKLQATLFPNAILKQV 119

Query: 121 HLNNDNVENKKLLKEITYEYLSKENCGGANKFGTFIIKRIFFGDLSLGISILVNRTTFEX 180
           HL+N N+ENK++LKEITY+YLS ENC   NKFGTFI+KRIFFGDLSLG+S+L+NR  FE 
Sbjct: 120 HLDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVSVLINRIAFES 179

Query: 181 XXXXXXXXXXXFIENDFLYEDYLIFDCNVKRREKFKRKILFISTTINFNYQTKV 234
                      FIE+DF YEDYLIFDC  KRR+K KRKILFISTT+NFNYQTKV
Sbjct: 180 ATSSIMVVRSSFIESDFFYEDYLIFDCRAKRRKKLKRKILFISTTMNFNYQTKV 233

>Skud_5.32 Chr5 complement(44026..44727) [702 bp, 233 aa] {ON}
           YEL057C (REAL)
          Length = 233

 Score =  320 bits (820), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 167/234 (71%), Positives = 193/234 (82%), Gaps = 1/234 (0%)

Query: 1   MVNDGIQRNDFNEKELKTVRFSAYSKEIDVIMRKISFLEKNITQQLYTLPHFPKTLPPNH 60
           M N GIQ+ND N    K  +FS YSKEI++IM+KI+FLE+NITQQL TLPHFPKTLPP+H
Sbjct: 1   MANGGIQKND-NTTNFKVAQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPSH 59

Query: 61  KTGVRRTNRTKENWSNQLNNLLGIYSKDEIFTLDSLAATLHDQVLRLQSTLFPIAILEQV 120
           KT   RT++ +E+WSNQL NLLGIYSK+EI TLD+LAATLHDQVL+LQ+ LFPIAIL+QV
Sbjct: 60  KTCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPIAILKQV 119

Query: 121 HLNNDNVENKKLLKEITYEYLSKENCGGANKFGTFIIKRIFFGDLSLGISILVNRTTFEX 180
           HL+N+NVEN+K+LKE+TYEYLSKENC    KFG FI+KRIFFGDLSLG+SILVNR TFE 
Sbjct: 120 HLDNNNVENRKILKEVTYEYLSKENCQRERKFGAFIVKRIFFGDLSLGVSILVNRVTFET 179

Query: 181 XXXXXXXXXXXFIENDFLYEDYLIFDCNVKRREKFKRKILFISTTINFNYQTKV 234
                      FIENDF YEDYLI  C V+RR+KFKRKILFIS TINFNYQTKV
Sbjct: 180 VTSSIVIVSSSFIENDFFYEDYLILGCKVRRRKKFKRKILFISNTINFNYQTKV 233

>Suva_5.11 Chr5 complement(21032..21733) [702 bp, 233 aa] {ON}
           YEL057C (REAL)
          Length = 233

 Score =  313 bits (802), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 166/234 (70%), Positives = 189/234 (80%), Gaps = 1/234 (0%)

Query: 1   MVNDGIQRNDFNEKELKTVRFSAYSKEIDVIMRKISFLEKNITQQLYTLPHFPKTLPPNH 60
           M N GIQ+ND      KTV F   SKEID+IM+KISFLE+NIT+QL TLP FPKTLPPNH
Sbjct: 1   MANGGIQKNDGTTGS-KTVLFWTCSKEIDIIMKKISFLERNITKQLDTLPLFPKTLPPNH 59

Query: 61  KTGVRRTNRTKENWSNQLNNLLGIYSKDEIFTLDSLAATLHDQVLRLQSTLFPIAILEQV 120
           +T + RT RTK +W  QL NLLGIYS+DEI TLD+LAATLHDQVL+LQ+ LFPIAIL+QV
Sbjct: 60  ETRINRTRRTKGSWGTQLKNLLGIYSRDEISTLDNLAATLHDQVLKLQAKLFPIAILKQV 119

Query: 121 HLNNDNVENKKLLKEITYEYLSKENCGGANKFGTFIIKRIFFGDLSLGISILVNRTTFEX 180
           HLN DNVENKK+LKEITYEYLSK+NC   +KFG FI++RIFFGDLSLG+SILVNR  FE 
Sbjct: 120 HLNKDNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFGDLSLGVSILVNRIAFET 179

Query: 181 XXXXXXXXXXXFIENDFLYEDYLIFDCNVKRREKFKRKILFISTTINFNYQTKV 234
                      FIENDFLYEDYLI+   +KRR+KFKRKI+FISTTINFNYQTKV
Sbjct: 180 VGSSIVVVRSSFIENDFLYEDYLIWGGGMKRRKKFKRKIVFISTTINFNYQTKV 233

>Ecym_8136 Chr8 (287415..291488) [4074 bp, 1357 aa] {ON} similar to
           Ashbya gossypii AFR623W
          Length = 1357

 Score = 31.6 bits (70), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 10  DFNEKELKTVRFSAYSKEIDVIMRKISFLEKNITQQLYTLPHFPKTLP 57
           D ++   ++ RF    +E+   M+K S L  + T  L   PH PK+LP
Sbjct: 404 DTDDINHRSTRFPTTVEELAFEMQKDSMLYSDYTDPLAQRPHVPKSLP 451

>Kpol_2000.70 s2000 complement(152953..155004) [2052 bp, 683 aa]
           {ON} complement(152953..155004) [2052 nt, 684 aa]
          Length = 683

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 19/98 (19%)

Query: 31  IMRKISFLEKNITQQLYTLPHFPKTLPPNHKTGVRRTNRTKENWSNQLNNLLGIYSKDEI 90
           IM+++S LE N T  +  +    K L        +   + ++N + + ++L+GI++   +
Sbjct: 442 IMKRLSILENNATLTVLYIEEQSKLL-------YKSFEKLEKNHATKFSDLIGIFNATVV 494

Query: 91  FTLDSL---AATLHDQVLRLQSTLFPIAILEQVHLNND 125
             LD+L   A  L +Q L+         ILE+  LNND
Sbjct: 495 SNLDALGDFANQLKEQSLK---------ILEEQKLNND 523

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,660,864
Number of extensions: 1106996
Number of successful extensions: 3502
Number of sequences better than 10.0: 22
Number of HSP's gapped: 3581
Number of HSP's successfully gapped: 22
Length of query: 234
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 128
Effective length of database: 41,326,803
Effective search space: 5289830784
Effective search space used: 5289830784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)