Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_5.296.11ON55555528610.0
YEL058W (PCM1)6.11ON55755725600.0
Skud_5.316.11ON55755625150.0
Suva_5.106.11ON55355424850.0
TPHA0M002106.11ON54555015440.0
Kpol_1032.26.11ON53954714850.0
KAFR0L003406.11ON54055414830.0
SAKL0E00902g6.11ON54455614740.0
TDEL0G046006.11ON52854714600.0
TBLA0G009806.11ON55856914590.0
NCAS0F002006.11ON54955514540.0
NDAI0K028906.11ON56156314530.0
ZYRO0F00506g6.11ON55055814330.0
CAGL0B03597g6.11ON54054814060.0
Ecym_30146.11ON55155013720.0
KLTH0C11506g6.11ON54455513590.0
Kwal_56.223556.11ON54155413411e-180
KLLA0D00858g6.11ON54154913401e-180
ACR015W6.11ON55255313231e-177
KNAG0E009406.11ON53855412671e-169
KLLA0D01573g8.840ON60762910.022
KNAG0J002708.840ON62574910.022
TDEL0B005708.840ON63060910.022
TPHA0I002508.840ON629139890.038
Kpol_1068.88.840ON63231890.038
CAGL0M02981g8.840ON61728860.086
Suva_13.4668.840ON62228860.086
Skud_13.4508.840ON62228860.086
YMR278W (PGM3)8.840ON62228860.086
ZYRO0G14190g8.840ON61049850.11
Kwal_27.102588.840ON62031850.11
Smik_13.4918.840ON62228850.11
NDAI0K004108.840ON62628850.11
TBLA0B032508.840ON64328850.11
KAFR0B039208.840ON62460840.15
KLTH0C03872g8.840ON62150820.26
ABL126W8.840ON62427820.26
SAKL0D01474g8.840ON62427810.34
Ecym_46118.840ON63030810.34
NCAS0C004108.840ON62519800.45
KAFR0K02610singletonON1546109771.2
CAGL0G02915g3.420ON31147714.2
KLTH0F12914g7.138ON34959714.5
CAGL0J10472g5.559ON1345119724.5
CAGL0E04620g3.302ON429143714.8
Smik_14.841.109ON574194715.2
AER246W5.419ON47832706.6
TBLA0F005603.202ON49894706.7
CAGL0K07480g2.445ON56764537.6
ZYRO0G10670g4.129ON127048707.7
KAFR0L02140singletonON3196148708.1
Kwal_27.126671.247ON721123699.5
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Smik_5.29
         (1668 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)  1106   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   990   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   973   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   961   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   599   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   576   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   575   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   572   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   566   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   566   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   564   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   564   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   556   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   546   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   533   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   528   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   521   e-180
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   520   e-180
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   514   e-177
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   492   e-169
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    40   0.022
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    40   0.022
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    40   0.022
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    39   0.038
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    39   0.038
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    38   0.086
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    38   0.086
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    38   0.086
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    38   0.086
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    37   0.11 
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    37   0.11 
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    37   0.11 
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    37   0.11 
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    37   0.11 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    37   0.15 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    36   0.26 
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    36   0.26 
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    36   0.34 
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    36   0.34 
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    35   0.45 
KAFR0K02610 Chr11 (542998..547638) [4641 bp, 1546 aa] {ON}             34   1.2  
CAGL0G02915g Chr7 complement(267032..267967) [936 bp, 311 aa] {O...    32   4.2  
KLTH0F12914g Chr6 (1069830..1070879) [1050 bp, 349 aa] {ON} simi...    32   4.5  
CAGL0J10472g Chr10 (1023529..1027566) [4038 bp, 1345 aa] {ON} hi...    32   4.5  
CAGL0E04620g Chr5 (446284..447573) [1290 bp, 429 aa] {ON} simila...    32   4.8  
Smik_14.84 Chr14 complement(151714..153438) [1725 bp, 574 aa] {O...    32   5.2  
AER246W Chr5 (1092359..1093795) [1437 bp, 478 aa] {ON} Syntenic ...    32   6.6  
TBLA0F00560 Chr6 (140436..141932) [1497 bp, 498 aa] {ON} Anc_3.2...    32   6.7  
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    25   7.6  
ZYRO0G10670g Chr7 complement(857355..861167) [3813 bp, 1270 aa] ...    32   7.7  
KAFR0L02140 Chr12 (411877..421464) [9588 bp, 3196 aa] {ON}             32   8.1  
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    31   9.5  

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 1106 bits (2861), Expect = 0.0
 Identities = 555/555 (100%), Positives = 555/555 (100%)
 Frame = +1

Query: 1    MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 180
            MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV
Sbjct: 1    MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60

Query: 181  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 360
            GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH
Sbjct: 61   GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120

Query: 361  EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 540
            EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS
Sbjct: 121  EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 180

Query: 541  NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 720
            NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL
Sbjct: 181  NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 240

Query: 721  LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 900
            LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD
Sbjct: 241  LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 300

Query: 901  ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 1080
            ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN
Sbjct: 301  ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360

Query: 1081 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 1260
            YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR
Sbjct: 361  YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 420

Query: 1261 GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIV 1440
            GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIV
Sbjct: 421  GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIV 480

Query: 1441 PDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQL 1620
            PDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQL
Sbjct: 481  PDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQL 540

Query: 1621 DQFCNEIVELVKASA 1665
            DQFCNEIVELVKASA
Sbjct: 541  DQFCNEIVELVKASA 555

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
            N-acetylglucosamine-phosphate mutase; converts GlcNAc-6-P
            to GlcNAc-1-P, which is a precursor for the biosynthesis
            of chitin and for the formation of N-glycosylated
            mannoproteins and glycosylphosphatidylinositol anchors
          Length = 557

 Score =  990 bits (2560), Expect = 0.0
 Identities = 487/557 (87%), Positives = 529/557 (94%), Gaps = 2/557 (0%)
 Frame = +1

Query: 1    MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 180
            MK+DYEQL +LYD TCRTKNVQ+SYGTAGFRTLAKNLDTVMF+TGILA+LRSLKLQGQYV
Sbjct: 1    MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60

Query: 181  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 360
            GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLAN ASFA+NFEEFR EL +LIEH
Sbjct: 61   GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH 120

Query: 361  EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 540
            EKI L+T++VPHIVVGRDSRESSPYLLRCLTS+M SVFHAQVLDLGCVTTPQLHYITDLS
Sbjct: 121  EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS 180

Query: 541  NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 720
            N+R+ EG +A VATEQDYYSFFIGAFNELF+TY++EKRLSVP+LFID ANGIGGPQLKKL
Sbjct: 181  NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL 240

Query: 721  LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 900
            L S+DW VP +Q+EVIND+SDVPELLNFECGADYVKTNQRLPKGLSPSS DSLYCSFDGD
Sbjct: 241  LASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGD 300

Query: 901  ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 1080
            ADRVVFYYVDS S+FHLLDGDKISTLFAKFLSKQLELAHLE+SL+IGVVQTAYANGSST 
Sbjct: 301  ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360

Query: 1081 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 1260
            YI+NTL CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFH+ IKSELS+++
Sbjct: 361  YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420

Query: 1261 --GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 1434
              GD LAL+TL CFS+LINQTVGDA+SDMLAVLATLAI+KM+PMDWD+EYTDLPNKLVKC
Sbjct: 421  LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC 480

Query: 1435 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSS 1614
            IVPDRSIFQT DQERKL NPVGLQ KIDLV+AKYPMGRSFVRASGTEDAVR+YAEC+DSS
Sbjct: 481  IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS 540

Query: 1615 QLDQFCNEIVELVKASA 1665
            +L QFC+E+VE VKASA
Sbjct: 541  KLGQFCDEVVEHVKASA 557

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  973 bits (2515), Expect = 0.0
 Identities = 486/556 (87%), Positives = 520/556 (93%), Gaps = 2/556 (0%)
 Frame = +1

Query: 1    MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 180
            MKIDYEQL +LYD+TCRTKNVQYSYGTAGFRTLAK+LDTVMFTTGILA+LRSLKLQGQYV
Sbjct: 1    MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 181  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 360
            GVMITASHNPYQDNGVKIVEPDGSMLLA+WEPYAMQLAN ASFA++FEEF AEL +LIE 
Sbjct: 61   GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120

Query: 361  EKIGLDTS-IVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDL 537
            EKI L  S + PHIVVGRDSRESSPYLLRCLTSTM SVFHA+VLDLGCVTTPQLHYITDL
Sbjct: 121  EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180

Query: 538  SNKREREGGSA-EVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLK 714
            SN+REREG SA   ATEQDYYSFFIGAFNELF+TY++EKRLSVP+LFID ANGIGGPQLK
Sbjct: 181  SNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLK 240

Query: 715  KLLTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFD 894
            KLL SKDWVVP DQIE+INDKSDVP+LLN ECGADYVKTNQRLPKGLSPSS +SLYCSFD
Sbjct: 241  KLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFD 300

Query: 895  GDADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSS 1074
            GDADRVVFYYVDSE +FHLLDGDKISTLFAKFLSKQLE+A+LE SL+IGVVQTAYANGSS
Sbjct: 301  GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360

Query: 1075 TNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSR 1254
            T YI++TL CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQ I+SELS+
Sbjct: 361  TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420

Query: 1255 ARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 1434
              G  LALKTL CF+KLINQTVGDA+SDMLAVLATLAI+KMAPM+WD+EY DLPNKLVKC
Sbjct: 421  PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKC 480

Query: 1435 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSS 1614
            IVPDRSIFQT DQERKLQNPVGLQ+KID VIAKYPMGRSFVRASGTEDAVR+YAECQD S
Sbjct: 481  IVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMS 540

Query: 1615 QLDQFCNEIVELVKAS 1662
            +LDQFCNEIV  VKAS
Sbjct: 541  KLDQFCNEIVGYVKAS 556

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  961 bits (2485), Expect = 0.0
 Identities = 470/554 (84%), Positives = 516/554 (93%)
 Frame = +1

Query: 1    MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 180
            MKIDY+QL +LY++TC TKN+QYSYGTAGFRTLAK+LDTVMFTTGILA+LRSLKLQGQYV
Sbjct: 1    MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 181  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 360
            GVMITASHNPYQDNGVKIVEPDGSMLLA WEPYAMQLAN ASFA+ F+EF AEL +LIEH
Sbjct: 61   GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120

Query: 361  EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 540
            EKI LD +  PH+VVGRDSRESSP+LLRCLTSTM SVFHA V+DLGCVTTPQLHY+T+LS
Sbjct: 121  EKIDLDAA--PHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLS 178

Query: 541  NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 720
            NKR+REGGSA+VATEQDYYSFFI AFNELF+T +IEKRLSVP+LF+D ANGIGGPQLKKL
Sbjct: 179  NKRQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKL 238

Query: 721  LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 900
            L SKDW VP D+IE++NDKSDVP+LLNFECGADYVKTNQRLPKGLSPSS DSLYCSFDGD
Sbjct: 239  LASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGD 298

Query: 901  ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 1080
            ADRVVFYYVD ES+FHLLDGDKISTLFAKFLSKQLELA+L +SL+IGVVQTAYANGSST+
Sbjct: 299  ADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTS 358

Query: 1081 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 1260
            YI++TL CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFS+KFHQ I+SELSRA+
Sbjct: 359  YIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQ 418

Query: 1261 GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIV 1440
            G +LAL TL CF+ LINQTVGDA+SDMLAVLATL+I+ MAP DWDKEYTDLPNKLVKCIV
Sbjct: 419  GSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIV 478

Query: 1441 PDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQL 1620
            PDRSIFQT DQERKLQNP GLQ KID VI KY MGRSFVRASGTEDAVR+YAECQD ++L
Sbjct: 479  PDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKL 538

Query: 1621 DQFCNEIVELVKAS 1662
            DQFCNE+VE VK+S
Sbjct: 539  DQFCNEVVEYVKSS 552

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
            Anc_6.11 YEL058W
          Length = 545

 Score =  599 bits (1544), Expect = 0.0
 Identities = 316/550 (57%), Positives = 389/550 (70%), Gaps = 3/550 (0%)
 Frame = +1

Query: 22   LSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITAS 201
            L  +++  C T+N +Y YGTAGFR  A  LDTVM TTG+LA LRS+ L G+ VGVMITAS
Sbjct: 6    LESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITAS 65

Query: 202  HNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGLDT 381
            HN   DNGVKIVEPDGSML  +WEP+A +LAN ASF  + +EF+  L       K+  D+
Sbjct: 66   HNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKV--DS 123

Query: 382  SIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKREREG 561
             I P +VVGRDSR+S P LL+CL S  V +   +++D G +TTPQLH++T+  N  +   
Sbjct: 124  GITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTK--- 180

Query: 562  GSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKDWV 741
             S    TE DYYSFF+ A+  + + + I K L  PRL+IDAANGIGGP++ KL   + W 
Sbjct: 181  -SRAPVTEDDYYSFFMDAWVSITALHGI-KVLQSPRLYIDAANGIGGPKVSKLF--EVWP 236

Query: 742  VPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHD---SLYCSFDGDADRV 912
                Q  ++N+    P LLN +CGADYVKTNQRLPK + P++     +LYCSFDGDADR+
Sbjct: 237  -QAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRI 295

Query: 913  VFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIEN 1092
            VFYY D+++ FHLLDGDKISTLFA F+SKQL+ A L   + +GVVQTAYANG+STNY+EN
Sbjct: 296  VFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLEN 355

Query: 1093 TLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARGDML 1272
             L  PVSC KTGVKHLHHEA T YD+GIYFEANGHGTI+FS KF +  +S L +   + L
Sbjct: 356  VLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCES-LLKENNESL 414

Query: 1273 ALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVPDRS 1452
             +KTL  F+ LINQTVGDA+SDML VLA L+IMK+ P  WDKEYTDLPN L K +VPDRS
Sbjct: 415  EVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRS 474

Query: 1453 IFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLDQFC 1632
            +F T DQERKL  P G Q KID ++AKY  GRSFVRASGTEDAVR+YAE           
Sbjct: 475  LFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALN 534

Query: 1633 NEIVELVKAS 1662
             E+ + V AS
Sbjct: 535  EEVSKAVLAS 544

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
            complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  576 bits (1485), Expect = 0.0
 Identities = 298/547 (54%), Positives = 399/547 (72%), Gaps = 1/547 (0%)
 Frame = +1

Query: 25   SELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASH 204
            S+L++K C TK+ +Y YGTAGFR  A  L+TVMFTTGI+A LRS+ L G+ VGVMITASH
Sbjct: 3    SKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASH 62

Query: 205  NPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGLDTS 384
            NP +DNGVKIVEP+G+ML  +WEP A +LAN A+  S F++ +A +   ++       + 
Sbjct: 63   NPPEDNGVKIVEPNGAMLDQSWEPMATELANIAA-NSTFDDLKAYVEEKVKKFSPESGSK 121

Query: 385  IVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKREREGG 564
            + P +VVGRDSRES  YLL CL ++  +  +A++++ G +TTPQLH++T+  N ++    
Sbjct: 122  VQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKK---- 177

Query: 565  SAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKDWVV 744
             +    E  YY++FI ++N++ + + I   L    L ID ANGIGGP++++LL  K W  
Sbjct: 178  -SYAVQESSYYNYFIESWNKITALHNITD-LYCSSLTIDTANGIGGPKIQELL--KSWPF 233

Query: 745  PPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDS-LYCSFDGDADRVVFY 921
               ++ ++N++ + P+LLN  CGAD+VKTNQ+LP G+S +S ++ LYCS+DGDADR+VFY
Sbjct: 234  A-SKVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFY 292

Query: 922  YVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIENTLR 1101
            + D + QFHLLDGDKISTLFAK ++K L  A+L + + +GVVQTAYANGSSTNY++ TL 
Sbjct: 293  FQDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLN 352

Query: 1102 CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARGDMLALK 1281
             PVSC KTGVKHLHHEA T YDIG+YFEANGHGTIIFS+ F+QV + EL +A  + +A+ 
Sbjct: 353  VPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKEL-KANSESIAVN 411

Query: 1282 TLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVPDRSIFQ 1461
            TL   S LINQTVGDA+SDML VL+ L+IMK++   WD EYTDLPN L K IVPDRS+F 
Sbjct: 412  TLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFI 471

Query: 1462 TIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLDQFCNEI 1641
            T DQERKL +P GLQ+KID  I+++  GRSFVRASGTEDAVR+YAE     +  +    +
Sbjct: 472  TTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALV 531

Query: 1642 VELVKAS 1662
             +LVK S
Sbjct: 532  TKLVKES 538

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
            Anc_6.11 YEL058W
          Length = 540

 Score =  575 bits (1483), Expect = 0.0
 Identities = 300/554 (54%), Positives = 383/554 (69%), Gaps = 3/554 (0%)
 Frame = +1

Query: 10   DYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVM 189
            D  QL   + K C T+N  Y+YGTAGFR  A  LDTVMFTTGI+AILRSL LQG+Y+GVM
Sbjct: 3    DITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVM 62

Query: 190  ITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKI 369
            ITASHNP QDNGVKIVEP G+ML+ +WE  A  LAN AS   NF  F   L+++I   K+
Sbjct: 63   ITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHG-NFTAFVMHLSQVIA--KL 119

Query: 370  GLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKR 549
             +D +  P ++VG DSRESSPYL+ CL +    VF   V++   +TTPQLHY+T L N  
Sbjct: 120  NIDETTTPRLIVGHDSRESSPYLMECLQAA-APVFDTIVINHTLITTPQLHYLTMLQN-- 176

Query: 550  EREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTS 729
                   +V TE DYY FF  ++N LFS Y  +  L+   L +D ANG+G  Q  K L  
Sbjct: 177  -------DVVTEVDYYKFFSTSWNNLFSLYP-DLNLTFNNLIVDGANGVGSVQFSKFLPY 228

Query: 730  KDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGDADR 909
               +     I  INDK +VP++LN +CGAD+VKTNQ+LP G+   +   LY SFDGDADR
Sbjct: 229  LPQLATLTTI--INDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADR 286

Query: 910  VVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIE 1089
            +VFYYVD+  +FHLLDGDKIST+  K L   L  + L N + +GVVQTAYANGSST YI 
Sbjct: 287  IVFYYVDNNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYIT 346

Query: 1090 NTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARGDM 1269
             +L+ PV CTKTGVKHLHH A +++DIGIYFEANGHGT++FS KF++V++  +       
Sbjct: 347  KSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSE 406

Query: 1270 LALK---TLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIV 1440
               K   +L  FSKLINQTVGD+++D+LAV+ATL+I++++P DWD EY DLPN L KC V
Sbjct: 407  KIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTV 466

Query: 1441 PDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQL 1620
             +R +F+T D ERKL +P GLQ KID  ++KY  GRSFVRASGTEDAVRIYAE +  +++
Sbjct: 467  LNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEV 526

Query: 1621 DQFCNEIVELVKAS 1662
            +    E+ +LV+ S
Sbjct: 527  EALSKEVTQLVENS 540

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
            similar to uniprot|P38628 Saccharomyces cerevisiae
            YEL058W PCM1 Essential N-acetylglucosamine-phosphate
            mutase a hexosephosphate mutase involved in the
            biosynthesis of chitin
          Length = 544

 Score =  572 bits (1474), Expect = 0.0
 Identities = 308/556 (55%), Positives = 390/556 (70%), Gaps = 4/556 (0%)
 Frame = +1

Query: 7    IDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGV 186
            ++ + L ELYDK C+T    Y+YGTAGFR  A  LDTVMFTTGILA +RS+ L+GQYVGV
Sbjct: 2    VNIQLLEELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60

Query: 187  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEK 366
            MITASHNP QDNGVKIV+P G ML   WEP+A +LAN+AS     +E    L +LI   K
Sbjct: 61   MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK--QELIKALDKLIT--K 116

Query: 367  IGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNK 546
            +G+D +    I + RDSRES P LL+ +      + + QV+D   +TTPQLH++T   N+
Sbjct: 117  LGIDDTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQ 176

Query: 547  REREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVP-RLFIDAANGIGGPQLKKLL 723
                 GS+    E  YYS F  A+ ++   ++I    S+P R+ IDAANGIGGP++ ++L
Sbjct: 177  -----GSSSKVEESTYYSAFSSAWTKICGLHDIN---SLPYRVIIDAANGIGGPKVSEML 228

Query: 724  TSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSS-HDSLYCSFDGD 900
                +      + VIN++   PELLN  CGADYVKTNQ  PKG+S +S ++ +YCSFDGD
Sbjct: 229  LKNKFF--SSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGD 286

Query: 901  ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 1080
            ADR+VFYY D +S+F+LLDGDKISTLFAKF  + L  A  EN L++GVVQTAYANGSST 
Sbjct: 287  ADRIVFYYHDEKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTE 346

Query: 1081 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 1260
            Y+ + L  PVSCT TGVKHLHHEA   YDIGIYFEANGHGT+IFS++FH+ I  +L   +
Sbjct: 347  YLSSILEVPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQ 406

Query: 1261 GDML--ALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 1434
             +    ALKTL  F+ LINQTVGDA+SDMLAVLA L I+K +P  WD+EYTDLPNKLVK 
Sbjct: 407  DEKTAKALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKV 466

Query: 1435 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSS 1614
            IVPDRS+F+T + ER+L +P GLQ KID  + ++  GRSFVRASGTEDAVR+YAE     
Sbjct: 467  IVPDRSVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKE 526

Query: 1615 QLDQFCNEIVELVKAS 1662
            + D+    + +LV  S
Sbjct: 527  KADRLAASVSDLVSRS 542

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
            YEL058W
          Length = 528

 Score =  566 bits (1460), Expect = 0.0
 Identities = 296/547 (54%), Positives = 388/547 (70%)
 Frame = +1

Query: 16   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 195
            E L  L ++ C T+  +Y YGTAGFR  ++ LDTVMF TGI+A LRS  L G+ VGVMIT
Sbjct: 3    EPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMIT 62

Query: 196  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGL 375
            ASHNP  DNGVK+VEPDGSML+ +WE  A +LAN  +     E+ +A++ +L   E    
Sbjct: 63   ASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRP-LEDIKAKVGQLTSGE---- 117

Query: 376  DTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKRER 555
             +S+ P ++VGRDSR S P+LL CL ++  S+F A++ D G +TTPQLH++T   N+   
Sbjct: 118  -SSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLT---NETMI 173

Query: 556  EGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKD 735
             G   +   EQ Y++ F+GA++++ +   ++    +P + +D ANGIGGP++  LLT   
Sbjct: 174  TGAHVD---EQAYFAHFLGAWDQIAALQPVK----LPNVVVDCANGIGGPKMSALLTQWG 226

Query: 736  WVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGDADRVV 915
            +     Q  VINDK D PELLN  CGAD+VKT+QRLP G+ P+++D LYCSFDGDADRVV
Sbjct: 227  FA---KQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNAND-LYCSFDGDADRVV 282

Query: 916  FYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIENT 1095
            FYY+D    FHLLDGDKISTLFA F++K L+   L++ L +GVVQTAYANGSST Y+++ 
Sbjct: 283  FYYLDQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDN 342

Query: 1096 LRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARGDMLA 1275
            L+ PVSCTKTGVKHLHHEA   YDIGIYFEANGHGT++FS KFH+ + +   +       
Sbjct: 343  LQVPVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTP----E 398

Query: 1276 LKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVPDRSI 1455
            LK L   +KLINQTVGDA+SDM+AVLA L+I++ +P  WD+E+TDLPNKL K +V DRS 
Sbjct: 399  LKILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSA 458

Query: 1456 FQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLDQFCN 1635
            F T DQER+L +P GLQ KID  +A+   GRSFVRASGTEDAVR+YAE    S+ DQ  +
Sbjct: 459  FTTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSS 518

Query: 1636 EIVELVK 1656
             + +LV+
Sbjct: 519  IVGDLVR 525

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
            Anc_6.11 YEL058W
          Length = 558

 Score =  566 bits (1459), Expect = 0.0
 Identities = 304/569 (53%), Positives = 396/569 (69%), Gaps = 16/569 (2%)
 Frame = +1

Query: 4    KIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVG 183
            ++D  + ++L+ K C+TKN  Y+YGTAGFR  A  LDTVMFTTG +A LRSL   G+ VG
Sbjct: 4    QLDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVG 63

Query: 184  VMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHE 363
            VM+TASHNP  DNGVKIVEP+GSML   WEP A  LAN AS          EL + +  +
Sbjct: 64   VMVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKI-----DELVQFVNAK 118

Query: 364  KIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSN 543
             I L+++ VP ++VGRDSRESS  LL CL    + +F A+++D   +TTPQLH++T+  N
Sbjct: 119  LIELNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYN 178

Query: 544  KREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLS---VPRLFIDAANGIGGPQLK 714
              +      ++  E DYY  F  A+++L S        +   +  L ID+ANGIGGP+++
Sbjct: 179  LEK------DLPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKME 232

Query: 715  KLLTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSP-----SSHDSL 879
             LL  K W     ++ +IN+    PE LN  CGADYVKTNQ+LP G++      SS + +
Sbjct: 233  NLL--KYWKTNY-KVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVI 289

Query: 880  YCSFDGDADRVVFYYVDSESQ-FHLLDGDKISTLFAKFLSKQLELAHL--ENSLRIGVVQ 1050
            +CSFDGDADRVVFYY D +S  F+LLDGDKISTLFA F+S QL+LA +  EN +++GVVQ
Sbjct: 290  HCSFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQ 349

Query: 1051 TAYANGSSTNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQ 1230
            TAYANGSSTNY++  L+ PV+C KTGVKHLHHEA T+YDIG+YFEANGHGTIIFSE F++
Sbjct: 350  TAYANGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYK 409

Query: 1231 VIKSELSRARG-----DMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWD 1395
            +I  +++          + ALKTL   S LINQTVGDA+SDM+ V+A LAI+   P  W+
Sbjct: 410  IINQKINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWN 469

Query: 1396 KEYTDLPNKLVKCIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTE 1575
            KEYTDLPNKL K +VPDRS+F+T DQERKL +P GLQ+KI+ ++AKY  GRSFVRASGTE
Sbjct: 470  KEYTDLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTE 529

Query: 1576 DAVRIYAECQDSSQLDQFCNEIVELVKAS 1662
            DAVR+YAE  D   +++ C E+++    S
Sbjct: 530  DAVRVYAEASD--DVNKLCQEVLDATAES 556

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
            Anc_6.11 YEL058W
          Length = 549

 Score =  564 bits (1454), Expect = 0.0
 Identities = 289/555 (52%), Positives = 392/555 (70%), Gaps = 1/555 (0%)
 Frame = +1

Query: 1    MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 180
            M ID   L ++Y+ TC T++ +Y+YGTAGFR  A  LDTVMF TGI+A  RS+ L G  V
Sbjct: 1    MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPV 60

Query: 181  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 360
            GVM+TASHNP  DNGVK+VEP G+ML+  WEP   +LAN A+  S FE+    +  + + 
Sbjct: 61   GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANES-FEKVYDFILEVSKD 119

Query: 361  EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 540
             K     +  P +++G DSRESSP L + L +T V +++A + + G VTTPQLH+IT L 
Sbjct: 120  PKFPFQEN-KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLW 178

Query: 541  NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 720
            N +  +  + +V +  +YY++F  ++++    Y+     S   L ID+ANGIGGP++  L
Sbjct: 179  NAKYNKNTN-DVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDL 237

Query: 721  LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 900
            +++    +  + + +IN+  + P LLN +CGADYVKTNQ+LPKG+   S+ +L+CSFDGD
Sbjct: 238  ISTWPSTLRGN-VSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGD 296

Query: 901  ADRVVFYYVDSESQ-FHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSST 1077
            ADR+VFYY+    Q FHLLDGDKI+TLFAKFLS  L+  +L + L++GVVQTAYANGSST
Sbjct: 297  ADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSST 356

Query: 1078 NYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRA 1257
            NY+ N L+ PVSCTKTGVKHLHHEA+T+YDIGIYFEANGHGT++FSE+F QV+++E    
Sbjct: 357  NYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKTT 416

Query: 1258 RGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCI 1437
                 A +TL  F K+INQTVGDA++DML V+  L++ K+ P  WD+ Y DLPNKL K I
Sbjct: 417  -----ATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVI 471

Query: 1438 VPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQ 1617
            VPDRS+F T +QER+L +PVGLQ KID+ ++K   GRSFVRASGTEDAVR+YAE     +
Sbjct: 472  VPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEE 531

Query: 1618 LDQFCNEIVELVKAS 1662
             ++   E+ + V +S
Sbjct: 532  TEKLSQEVCKFVLSS 546

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
            YEL058W
          Length = 561

 Score =  564 bits (1453), Expect = 0.0
 Identities = 301/563 (53%), Positives = 396/563 (70%), Gaps = 12/563 (2%)
 Frame = +1

Query: 1    MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQY- 177
            M  + +QL   +++ C+TKN  Y+YGTAGFR  AK LDTVMFTTGI+A LRSL LQ    
Sbjct: 5    MNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNK 64

Query: 178  ---VGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTR 348
               +GVM+TASHNP +DNGVKI+EP+GSMLL  WEP A Q AN A+  S F+EF   L  
Sbjct: 65   HSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANES-FDEFYQLLID 123

Query: 349  LIEHEKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYI 528
             I   +  L+    P +++G DSR+SSP L+  +  +   +F+A++++   VTTPQLH++
Sbjct: 124  SIVTLENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFL 183

Query: 529  TDLSNKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQ 708
            T+L+N      G+AE     D+++ ++     L+  +     L    L IDAANGIG PQ
Sbjct: 184  TNLTNTT----GTAEEINYYDHFNKYLSQLQSLYPPFN----LPFDNLIIDAANGIGAPQ 235

Query: 709  LKKLLTSKDWVVP---PDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPS--SHD 873
            ++KLL +K+   P    + I++IN+ S  P LLN  CGADYVKTNQ+LP+G+     ++ 
Sbjct: 236  VEKLLFTKNKFPPLNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANS 295

Query: 874  SLYCSFDGDADRVVFYYVDS-ESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQ 1050
            +L+CS+DGDADR+VFYY+D   + F+LLDGDKI+TLFAKF S  L +A L + L++GVVQ
Sbjct: 296  TLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQ 355

Query: 1051 TAYANGSSTNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQ 1230
            TAYANGSSTNYI + L+ PVSCTKTGVKHLHHEA T+YDIGIYFEANGHGT+IFS+KFH 
Sbjct: 356  TAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFH- 414

Query: 1231 VIKSELSRAR--GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEY 1404
               SEL++ +  G    +KTL  FS+LINQTVGDA+SDMLAV+A L+I++++P  WDKEY
Sbjct: 415  ---SELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEY 471

Query: 1405 TDLPNKLVKCIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAV 1584
             DLPNKL K IVPDRS F T DQERKL  P GLQ  ++  +A   +GRSFVRASGTEDAV
Sbjct: 472  KDLPNKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAV 531

Query: 1585 RIYAECQDSSQLDQFCNEIVELV 1653
            R+YAE +   + +    ++ +LV
Sbjct: 532  RVYAEAKTQEETEWLSKKVCQLV 554

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
            similar to uniprot|P38628 Saccharomyces cerevisiae
            YEL058W PCM1 Essential N-acetylglucosamine-phosphate
            mutase a hexosephosphate mutase involved in the
            biosynthesis of chitin
          Length = 550

 Score =  556 bits (1433), Expect = 0.0
 Identities = 299/558 (53%), Positives = 386/558 (69%), Gaps = 9/558 (1%)
 Frame = +1

Query: 16   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 195
            + L++L D+ C   +  Y YGTAGFR  A  LDTV+F TGILA LRSL L+G  +GVM+T
Sbjct: 5    DTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVT 64

Query: 196  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEE--------FRAELTRL 351
            ASHNP  DNGVK+VEPDGSM+  +WEP A +LANT +   +  E         + EL   
Sbjct: 65   ASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQ 124

Query: 352  IEHEKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYIT 531
            ++      +  IVP +VVGRDSRES P LL CL ++   +FHA++ D G +TTPQLH++T
Sbjct: 125  LQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLT 184

Query: 532  DLSNKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRL-SVPRLFIDAANGIGGPQ 708
              + K     G A V TE  YY  F+ A++ +   + I + L ++  L IDAANGIG P+
Sbjct: 185  SETAK-----GVANV-TESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPK 238

Query: 709  LKKLLTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCS 888
            +++LL+   W     Q+  INDK   PELLN ECGAD+VK+NQR P G + S+   L CS
Sbjct: 239  VQELLSQ--WACR-GQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST--GLGCS 293

Query: 889  FDGDADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANG 1068
            +DGDADRVVFYY++  ++F LLDGD+IS LFA F +  L+ A L++ L +GVVQTAYANG
Sbjct: 294  YDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANG 353

Query: 1069 SSTNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSEL 1248
            +ST Y++ TL+ PVSC KTGVKHLHHEA T+YDIGIYFEANGHGTIIFS KF++VIK + 
Sbjct: 354  NSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQK 413

Query: 1249 SRARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLV 1428
             R+    +A++TL+ FS+LINQTVGDA+SDML VLA L+I K  P  W +E+TDLPN+L 
Sbjct: 414  ERS----VAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLA 469

Query: 1429 KCIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQD 1608
            K +VPDRS+F T DQER+L  P GLQ KID  +  +  GRSFVRASGTEDAVR+YAE   
Sbjct: 470  KVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAAS 529

Query: 1609 SSQLDQFCNEIVELVKAS 1662
               +++  N + ELV  S
Sbjct: 530  LEDVEKLSNTVKELVVKS 547

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
            similar to uniprot|P38628 Saccharomyces cerevisiae
            YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  546 bits (1406), Expect = 0.0
 Identities = 293/548 (53%), Positives = 376/548 (68%), Gaps = 8/548 (1%)
 Frame = +1

Query: 28   ELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHN 207
            +LY+K C T++  Y+YGTAGFR  A+ LD+VMFTTG++A LRS+  Q   VGVMITASHN
Sbjct: 4    QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63

Query: 208  PYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGLDTSI 387
            P +DNGVKIVE DGSMLL  WEP A +LAN+ +   ++  F + L  +++  ++ +    
Sbjct: 64   PPRDNGVKIVESDGSMLLQDWEPLATRLANSVA---DYHTFESTLNAIMQ--ELNISPGH 118

Query: 388  VPHIVVGRDSRESSPYLLRCLTSTMVSVF-HAQVLDLGCVTTPQLHYITDLSNKREREGG 564
             P IVVG DSRESSP LL  L   + +V   A++ + G +TTPQLH++T           
Sbjct: 119  APQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT----------- 167

Query: 565  SAEVATEQDYY-SFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKDWV 741
             A  A  +DYY  +F+ A+N+LF  Y IE   S  +L ID ANGIGGPQ  K+L+     
Sbjct: 168  -ANPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTD 226

Query: 742  VPP------DQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGDA 903
            +P        QI++ N+    P +LN  CGAD+VKTNQRLP+G++    + LYCSFDGDA
Sbjct: 227  LPHLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRN-LYCSFDGDA 285

Query: 904  DRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNY 1083
            DRVVFYYVD    FHLLDGDKISTL A F++  L+ A L   L++GVVQTAYANGSST Y
Sbjct: 286  DRVVFYYVDDSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTY 345

Query: 1084 IENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARG 1263
            +   L+ PVS  KTGVKHLHHEA T YDIG+YFEANGHGT+IFS+ F++VI+  L++   
Sbjct: 346  VTKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAH 405

Query: 1264 DMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVP 1443
            D   L TL   S+LINQT+GDA+SDMLA++  L I+  +P  WD EYTDLPNKL K +VP
Sbjct: 406  DKSTL-TLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVP 464

Query: 1444 DRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLD 1623
            DRSIF T DQER+L +P GLQ KID+++A  P GRSF+RASGTEDAVR+YAE Q     +
Sbjct: 465  DRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATE 524

Query: 1624 QFCNEIVE 1647
            +   E+ +
Sbjct: 525  KLSTEVTD 532

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
            similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  533 bits (1372), Expect = 0.0
 Identities = 294/550 (53%), Positives = 369/550 (67%), Gaps = 4/550 (0%)
 Frame = +1

Query: 16   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 195
            E++S+LYDK C ++  +Y YGTAGFR  A+ LDTV+FTTG+LA LRS+ L+GQYVG MIT
Sbjct: 5    EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMIT 63

Query: 196  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGL 375
            ASHNP QDNGVK+V+P G ML   WE YA +LAN AS   +  +F   L  L+   + G+
Sbjct: 64   ASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKH--QFLHRLQELMN--QFGI 119

Query: 376  DTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKRER 555
                   IVV RDSRES   LL+ L        +  ++D   +TTPQLH++T   N++  
Sbjct: 120  KADSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQME 179

Query: 556  EGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKD 735
                 EV  E  YYS F+ A  EL   + I   L  P L IDAANG+GG + ++L     
Sbjct: 180  SERVIEV-NEAFYYSHFLSALKELTELFNIPG-LPYP-LVIDAANGVGGAKAEELFMKNT 236

Query: 736  WVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSH-DSLYCSFDGDADRV 912
            +    D   +IN      +LLN  CGADYVKTNQ LP+G+S ++  +SL+CSFDGDADRV
Sbjct: 237  FF--KDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRV 294

Query: 913  VFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIEN 1092
            +FYY D +  FHLLDGDKISTLFAKF    L +A +++++++GVVQTAYANGSST Y+  
Sbjct: 295  IFYYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSE 354

Query: 1093 TLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSEL---SRARG 1263
             L  PVSCT TGVK+LH +A   YD+GIYFEANGHGT+IFSE F+  +   L   S +  
Sbjct: 355  VLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAE 414

Query: 1264 DMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVP 1443
              +ALKTL  FSKLINQTVGDA+SDM+AVLA L I+K  P  WD EYTDLPN L+K +VP
Sbjct: 415  SKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVP 474

Query: 1444 DRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLD 1623
            DRS+F+T + ER+L +P GLQA+ID VI  Y   RSFVRASGTEDAVRIYAE     Q D
Sbjct: 475  DRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQAD 534

Query: 1624 QFCNEIVELV 1653
                +I +LV
Sbjct: 535  DLSIKISQLV 544

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar to
            uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
            Essential N-acetylglucosamine- phosphate mutase a
            hexosephosphate mutase involved in the biosynthesis of
            chitin
          Length = 544

 Score =  528 bits (1359), Expect = 0.0
 Identities = 284/555 (51%), Positives = 383/555 (69%), Gaps = 5/555 (0%)
 Frame = +1

Query: 7    IDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGV 186
            +D + L  LY+  C++    Y+YGTAGFR  A  LDTVMFTTG+LA LRS+ L+G+ VGV
Sbjct: 2    LDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60

Query: 187  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEK 366
            MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+A+   +F  F A L  L+   +
Sbjct: 61   MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSAT--QSFTAFLAYLQNLVS--E 116

Query: 367  IGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNK 546
            +GLDT  +  + V RDSRES P LL  L +    + + ++ D G +TTPQLH++T   N+
Sbjct: 117  LGLDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNE 176

Query: 547  REREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVP-RLFIDAANGIGGPQLKKLL 723
               +           YY  F+ A++++ +   I+   S+P +L IDAANGIG P++K++L
Sbjct: 177  LPNDTAIDRFF----YYKEFLSAWDDITALCGIQ---SLPYKLEIDAANGIGAPRVKEML 229

Query: 724  TSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSH-DSLYCSFDGD 900
            ++  +        V+ND  + P  LN  CGADYVKTNQRLP G+  ++    + CSFDGD
Sbjct: 230  STHKFF--DGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGD 287

Query: 901  ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 1080
            ADR+VFY+ DSE QF LLDGDK++TLFAKF    L  A+L+  L +GVVQTAYANGSST+
Sbjct: 288  ADRIVFYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTH 347

Query: 1081 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELS--- 1251
            YIE  L  PV+CT TGVKHLHHEA   YDIG+YFEANGHGT++FS+KF +V+ S LS   
Sbjct: 348  YIERVLGIPVTCTPTGVKHLHHEAIN-YDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKH 406

Query: 1252 RARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVK 1431
            ++   + +L+ L  F+ LINQTVGDA+SDM+ VLA L+I+K  P  W++EYTDLPNKLVK
Sbjct: 407  QSDSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVK 466

Query: 1432 CIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDS 1611
             +VPDR++F+T + ER+L +P+GLQ KI+ ++A+Y   RSFVRASGTEDAVR+YAE    
Sbjct: 467  VLVPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTR 526

Query: 1612 SQLDQFCNEIVELVK 1656
             + D   + + ++V+
Sbjct: 527  EEADSLASRVSQVVE 541

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
            YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
            186] FULL
          Length = 541

 Score =  521 bits (1341), Expect = e-180
 Identities = 287/554 (51%), Positives = 377/554 (68%), Gaps = 5/554 (0%)
 Frame = +1

Query: 7    IDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGV 186
            +D + L  LY+  C T    Y+YGTAGFR  A  LDTVMFTTG++A LRS+ L+G+ VGV
Sbjct: 2    LDTKALKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60

Query: 187  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEK 366
            MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+AS    F EF A + RL+   +
Sbjct: 61   MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSAS--QGFSEFVASVERLMTKLE 118

Query: 367  IGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNK 546
            +G +      IVV RDSRES P LL    S +  + + +V D G +TTPQLH++T  SN+
Sbjct: 119  VGSNDH--GSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNE 176

Query: 547  REREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVP-RLFIDAANGIGGPQLKKLL 723
              +     E+     YY  F+ A+ E+    +I+   S+P +L IDAANGIG P + ++L
Sbjct: 177  LPK---GTEIGKSL-YYDNFLSAWVEIAELCKID---SLPYKLEIDAANGIGAPVVTEML 229

Query: 724  TSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSH-DSLYCSFDGD 900
            +   +        V+ND+ + P+ LN  CGAD+VKTNQ+LP G++P    + + CSFDGD
Sbjct: 230  SQHKFF--KGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGD 287

Query: 901  ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 1080
            ADR+VFYY      FHLLDGDK++TLFAKF  + L  A L++ L +GVVQTAYANGSST 
Sbjct: 288  ADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTA 347

Query: 1081 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSR-- 1254
            YIE  L   V+CT TGVKHLHHEA  +YDIG+YFEANGHGT++FS KF  VI  +LS   
Sbjct: 348  YIEQVLGISVTCTPTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKL 406

Query: 1255 -ARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVK 1431
             +     +LK L  F+KLINQTVGDA+SDMLAVLA L+I+K +P  WD+EYTDLPNKL+K
Sbjct: 407  ESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIK 466

Query: 1432 CIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDS 1611
             +VPDR++F+T + ER+L +P G+Q KID ++A +  GRSFVRASGTEDAVR+YAE    
Sbjct: 467  VLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATP 526

Query: 1612 SQLDQFCNEIVELV 1653
             + +    ++ +L+
Sbjct: 527  QETEALSQQVEKLL 540

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
            similar to uniprot|P38628 Saccharomyces cerevisiae
            YEL058W PCM1 Essential N-acetylglucosamine-phosphate
            mutase a hexosephosphate mutase involved in the
            biosynthesis of chitin
          Length = 541

 Score =  520 bits (1340), Expect = e-180
 Identities = 282/549 (51%), Positives = 380/549 (69%), Gaps = 6/549 (1%)
 Frame = +1

Query: 28   ELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHN 207
            +LY++ C+  +  Y+YGTAGFR     LDTVMFTTGI+A+LRS+ L+ ++VGVMITASHN
Sbjct: 5    DLYEQYCKQGHA-YTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHN 63

Query: 208  PYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGLDTSI 387
            P +DNGVK+VEP G ML+  WEP A +LAN AS  S+F +  + L  +I   ++ +DT+ 
Sbjct: 64   PPEDNGVKVVEPYGEMLVQNWEPIATKLANAAS--SSFTQLESTLQSIIA--ELNIDTTQ 119

Query: 388  VPHIVVGRDSRESSPYLLRCLTSTMVSVFHA-QVLDLGCVTTPQLHYITDLSNKREREGG 564
            + +I V RDSRES P LL  L +  +SVF A +++D   +TTPQLH++    N   +   
Sbjct: 120  LANITVARDSRESGPRLLAALKAG-ISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQ 178

Query: 565  SAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVP-RLFIDAANGIGGPQLKKLLTSKDWV 741
                  +  YY  F+  +N+L   YE+ +   +P  L ID ANGIG  ++K+L++    +
Sbjct: 179  ----VRDSTYYDHFVSIWNQLTQLYEVTE---LPFHLTIDCANGIGADKVKQLISQAGHM 231

Query: 742  VPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGDADRVVFY 921
            +  + +  +N ++   +LLN  CGAD+VKTNQ  P   +P     LYCSFDGDADRVVFY
Sbjct: 232  LE-NSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKP-SQLYCSFDGDADRVVFY 289

Query: 922  YVDS-ESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIENTL 1098
            YVD  E++FHLLDGDKI+TL AK ++  L    L ++L++GVVQTAYANGSST YI + L
Sbjct: 290  YVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKL 349

Query: 1099 RCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARGD---M 1269
            + PVSCTKTGVKHLHHEA ++YDIGIYFEANGHGT+IFS +F + + S L    G+    
Sbjct: 350  KIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQY 409

Query: 1270 LALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVPDR 1449
             +L +L   S+LINQTVGDA+SDMLAV+ATL+I  + P DWD  Y DLPN+L K IVPDR
Sbjct: 410  KSLLSLKLLSQLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDR 469

Query: 1450 SIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLDQF 1629
            S+F + + ER+L +P GLQAKIDL++ ++P  RSFVRASGTEDAVR+YAE + +    + 
Sbjct: 470  SVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIEL 529

Query: 1630 CNEIVELVK 1656
              ++ ELVK
Sbjct: 530  ATKVGELVK 538

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  514 bits (1323), Expect = e-177
 Identities = 281/553 (50%), Positives = 368/553 (66%), Gaps = 4/553 (0%)
 Frame = +1

Query: 16   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 195
            +++ +LYD+      V Y+YGTAGFR+ A+ L  V+F TG+LA LRSL L G YVGVM+T
Sbjct: 5    QEMVKLYDRHRGCGRV-YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLT 63

Query: 196  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGL 375
            ASHNP +DNGVK+V+P G ML A WE +A  LAN AS     +E    L  L++  ++GL
Sbjct: 64   ASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQ--QELLDALHMLVD--RLGL 119

Query: 376  DTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKRER 555
            D ++   +VV RDSR S P LL  L      +   +V+D G +TTPQLH++T   N+R  
Sbjct: 120  DLALRARVVVARDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNER-- 177

Query: 556  EGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKD 735
              GSA    E  YY+ F+ A  EL + + +E  L  P L +D ANG+G  + ++L     
Sbjct: 178  --GSAAGVREDLYYAHFVAALEELAALHGLET-LPFP-LVVDTANGVGALKARELFRRSP 233

Query: 736  WVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSS-HDSLYCSFDGDADRV 912
                 +++ +IND     ELLN  CGADYVKT Q LP+G+S     +SL+CS+DGDADRV
Sbjct: 234  LF--KNRVSIINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRV 291

Query: 913  VFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIEN 1092
            +FYY+D + +FHLLDGDKISTL AKFL   L  A + + + +GVVQTAYANGSST Y+  
Sbjct: 292  IFYYIDGQERFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSE 351

Query: 1093 TLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSR---ARG 1263
             L  PVSCT TGVKHLH EA  +YD+GIYFEANGHGT+IFSE F   ++  L     +  
Sbjct: 352  VLEVPVSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAK 411

Query: 1264 DMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVP 1443
              L+L+TL  F+ LINQT+GDA++DMLAV+A L+I+  +P DWDK+YTDLPN LVK +VP
Sbjct: 412  ARLSLQTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVP 471

Query: 1444 DRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLD 1623
            DRS+F+T + E++L +P GLQ  ID ++  Y  GRSFVRASGTEDAVRIYAE     Q D
Sbjct: 472  DRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQAD 531

Query: 1624 QFCNEIVELVKAS 1662
            +   ++  LV  S
Sbjct: 532  ELATKVSTLVVES 544

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
            YEL058W
          Length = 538

 Score =  492 bits (1267), Expect = e-169
 Identities = 277/554 (50%), Positives = 358/554 (64%), Gaps = 8/554 (1%)
 Frame = +1

Query: 16   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 195
            E +  ++D  C TK   Y+YGTAGFR  A  LDTVMF TG +A+LRS +L G  VGVM+T
Sbjct: 4    EAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVT 63

Query: 196  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGL 375
            ASHNP +DNGVK+V+P+G ML   WEP A +LAN A+  + F+++    T L+E      
Sbjct: 64   ASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGT-FDQWWEYWTSLVEEGNYTG 122

Query: 376  DTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQV-LDLGCVTT-PQLHYITDLSNKR 549
                   + VG D+RESSP LL+ L    ++V    + +    +T  PQLHY+T L    
Sbjct: 123  GA----RLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSL---- 174

Query: 550  EREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTS 729
            +R+G +   A    Y   F G + +LF    +       RLFID ANG+G  QL++    
Sbjct: 175  QRDGVTDAAA----YNDHFQGCWQKLFPDGVVAWPFD--RLFIDTANGVGAVQLQQFF-- 226

Query: 730  KDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLP------KGLSPSSHDSLYCSF 891
            K W V  ++  ++N     PE LN +CGAD+VKTN RLP      +G S +  D LYCSF
Sbjct: 227  KGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPD-LYCSF 285

Query: 892  DGDADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGS 1071
            DGDADR+VFY+V ++ QFHLLDGDKISTLFAKF+ +    A  ++ L +GVVQTAYANG+
Sbjct: 286  DGDADRIVFYFVKNK-QFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGN 344

Query: 1072 STNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELS 1251
            ST YI + L  P +CTKTGVKHLHH A TQYDIGIYFEANGHGT++FS+KF++V+    S
Sbjct: 345  STRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVAS 404

Query: 1252 RARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVK 1431
                   A  TL  FSKLINQTVGDA++DML VLA L  ++  P  W  EYTDLPN L K
Sbjct: 405  TND----AASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTK 460

Query: 1432 CIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDS 1611
             +VPDRSIF+T DQER+L +P GLQ KID  + ++   RSFVRASGTE+AVRIY E +D 
Sbjct: 461  VVVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDP 520

Query: 1612 SQLDQFCNEIVELV 1653
             ++ +   ++ E V
Sbjct: 521  QEVQELSKQVTEAV 534

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 39.7 bits (91), Expect = 0.022
 Identities = 24/62 (38%), Positives = 32/62 (51%)
 Frame = +1

Query: 169 GQYVGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTR 348
           G  VG+MITASHNP  DNG K+   +G  ++    P+   +A   S   N E F +  T 
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII---PPHDKLIAE--SIIHNLEPFSSPQTG 205

Query: 349 LI 354
            I
Sbjct: 206 TI 207

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 39.7 bits (91), Expect = 0.022
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +1

Query: 82  AGFRTLAKNL-DTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 258
           AGF+ L  N  DT++ T  +   +  L      VGVMITASHNP  DNG K+   +G  +
Sbjct: 124 AGFKVLYLNPGDTLVHTPLVPFTVDHLNAS---VGVMITASHNPKMDNGYKVYFANGCQI 180

Query: 259 LATWEPYAMQLANT 300
           +    P+ + +A +
Sbjct: 181 I---PPHDLNIARS 191

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 39.7 bits (91), Expect = 0.022
 Identities = 23/60 (38%), Positives = 32/60 (53%)
 Frame = +1

Query: 82  AGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 261
           AGF+ +  N       T I+    ++   G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 129 AGFKVIFLNDGDKFVHTPIVPF--TVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQII 186

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 38.9 bits (89), Expect = 0.038
 Identities = 36/139 (25%), Positives = 61/139 (43%), Gaps = 19/139 (13%)
 Frame = +1

Query: 82  AGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 261
           AGF+    N +     T ++     + L    +GVMITASHNP  DNG K+   +G  ++
Sbjct: 127 AGFKVYYLNPNDEFVHTPMVPF--GINLYSASIGVMITASHNPEMDNGYKVYYNNGCQII 184

Query: 262 ATWEPYAMQLA-----NTASFASNFEEFRAELTRLIEHEK-------------IGLDTSI 387
               P+   +A     N    + N+    A +++ IE+ K             + LD  I
Sbjct: 185 ---PPHDKNIAECIEKNLEPLSDNWNT-EAVISKAIENVKLIYSKEDVLQQYMLNLDKYI 240

Query: 388 VP-HIVVGRDSRESSPYLL 441
           +P +I +G   +   P+ +
Sbjct: 241 IPKNISLGTTIKGKKPWFV 259

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 38.9 bits (89), Expect = 0.038
 Identities = 17/31 (54%), Positives = 21/31 (67%)
 Frame = +1

Query: 169 GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 261
           G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 37.7 bits (86), Expect = 0.086
 Identities = 16/28 (57%), Positives = 20/28 (71%)
 Frame = +1

Query: 178 VGVMITASHNPYQDNGVKIVEPDGSMLL 261
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 148 VGVMITASHNPKMDNGYKVYYTNGCQII 175

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.7 bits (86), Expect = 0.086
 Identities = 16/28 (57%), Positives = 20/28 (71%)
 Frame = +1

Query: 178 VGVMITASHNPYQDNGVKIVEPDGSMLL 261
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.7 bits (86), Expect = 0.086
 Identities = 16/28 (57%), Positives = 20/28 (71%)
 Frame = +1

Query: 178 VGVMITASHNPYQDNGVKIVEPDGSMLL 261
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 37.7 bits (86), Expect = 0.086
 Identities = 16/28 (57%), Positives = 20/28 (71%)
 Frame = +1

Query: 178 VGVMITASHNPYQDNGVKIVEPDGSMLL 261
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 37.4 bits (85), Expect = 0.11
 Identities = 22/49 (44%), Positives = 28/49 (57%)
 Frame = +1

Query: 178 VGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFE 324
           VGVMITASHNP  DNG K+   +G  ++    P+   +A   S  SN E
Sbjct: 147 VGVMITASHNPKLDNGYKVYYANGCQII---PPHDSAIAR--SIESNLE 190

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 37.4 bits (85), Expect = 0.11
 Identities = 16/31 (51%), Positives = 20/31 (64%)
 Frame = +1

Query: 169 GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 261
           G   GVMITASHNP  DNG K+   +G  ++
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.4 bits (85), Expect = 0.11
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = +1

Query: 178 VGVMITASHNPYQDNGVKIVEPDGSMLL 261
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 37.4 bits (85), Expect = 0.11
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = +1

Query: 178 VGVMITASHNPYQDNGVKIVEPDGSMLL 261
           +GVMITASHNP  DNG K+   +G  ++
Sbjct: 154 IGVMITASHNPKMDNGYKVYYSNGCQII 181

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 37.4 bits (85), Expect = 0.11
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = +1

Query: 178 VGVMITASHNPYQDNGVKIVEPDGSMLL 261
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 166 VGVMVTASHNPKMDNGYKVYYSNGCQII 193

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 37.0 bits (84), Expect = 0.15
 Identities = 21/60 (35%), Positives = 30/60 (50%)
 Frame = +1

Query: 82  AGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 261
           AGF+    N +     T ++    S+       GVMITASHNP  DNG K+   +G  ++
Sbjct: 127 AGFKVFYLNTENEFVHTPLVPY--SVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQII 184

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 36.2 bits (82), Expect = 0.26
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = +1

Query: 112 DTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 261
           D V+ T  +   +  L+  G   G+MITASHNP  DNG K+   +G  ++
Sbjct: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQII 183

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 36.2 bits (82), Expect = 0.26
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = +1

Query: 181 GVMITASHNPYQDNGVKIVEPDGSMLL 261
           GVMITASHNP  DNG K+   +G  ++
Sbjct: 160 GVMITASHNPKMDNGYKVYYANGCQII 186

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 35.8 bits (81), Expect = 0.34
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +1

Query: 181 GVMITASHNPYQDNGVKIVEPDGSMLL 261
           G+MITASHNP  DNG K+   +G  ++
Sbjct: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 35.8 bits (81), Expect = 0.34
 Identities = 15/30 (50%), Positives = 19/30 (63%)
 Frame = +1

Query: 169 GQYVGVMITASHNPYQDNGVKIVEPDGSML 258
           G   G+MITASHNP  DNG K+   +G  +
Sbjct: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQI 189

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 35.4 bits (80), Expect = 0.45
 Identities = 15/19 (78%), Positives = 16/19 (84%)
 Frame = +1

Query: 178 VGVMITASHNPYQDNGVKI 234
           VGVMITASHNP  DNG K+
Sbjct: 153 VGVMITASHNPKMDNGYKV 171

>KAFR0K02610 Chr11 (542998..547638) [4641 bp, 1546 aa] {ON} 
          Length = 1546

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 33/109 (30%), Positives = 49/109 (44%), Gaps = 11/109 (10%)
 Frame = -2

Query: 1013 ASSSCL----DKNFANNVEILSPSNKWNCDSE-------ST**NTTLSASPSKEQYSESC 867
            A S+CL    +KNF +   + S SN +  DSE       S   + TLS + S   YS S 
Sbjct: 305  ACSTCLALPMEKNFCSGSSVSSMSNTFTDDSEESTTYEISYSSSDTLSYTVSTSDYSSSF 364

Query: 866  EEGERPLGSLWLVFT*SAPHSKFNNSGTSDLSLMTSIWSGGTTQSLEVS 720
                 P  +  +    S P SK  +   S+ S ++S+    TT SL+ +
Sbjct: 365  SSITNPSETTDIS---STPSSKSASESPSETSFLSSVNYDTTTNSLDAT 410

>CAGL0G02915g Chr7 complement(267032..267967) [936 bp, 311 aa] {ON}
           highly similar to uniprot|P53252 Saccharomyces
           cerevisiae YGR086c
          Length = 311

 Score = 32.0 bits (71), Expect = 4.2
 Identities = 17/47 (36%), Positives = 22/47 (46%)
 Frame = -2

Query: 974 VEILSPSNKWNCDSEST**NTTLSASPSKEQYSESCEEGERPLGSLW 834
           ++  S  N+W  DS       TLS     E+Y E  EEGE+  G  W
Sbjct: 252 IDAESALNEWTLDSAQV--KPTLSFKQDYEEYEEDEEEGEQQEGEAW 296

>KLTH0F12914g Chr6 (1069830..1070879) [1050 bp, 349 aa] {ON} similar
            to uniprot|P40004 Saccharomyces cerevisiae YEL004W
          Length = 349

 Score = 32.0 bits (71), Expect = 4.5
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = -3

Query: 1081 NWWNYRSH-KRFAQRQFLENFLNVPVLAV*TRILQTTWKFCHHLTNGIAIPSQHSKTRP 908
            N W YR++ K + +  F  + L++P+L V  R L+  +++  H    ++IP  ++K  P
Sbjct: 199  NDWTYRTYGKHWKESLFYMHLLSLPLLLVNWRQLREEFRYLIHGAKMVSIPFTNAKVPP 257

>CAGL0J10472g Chr10 (1023529..1027566) [4038 bp, 1345 aa] {ON} highly
            similar to uniprot|P38931 Saccharomyces cerevisiae
            YDR443c SCA1 DNA-directed RNA polymerase II
          Length = 1345

 Score = 32.3 bits (72), Expect = 4.5
 Identities = 25/119 (21%), Positives = 49/119 (41%), Gaps = 20/119 (16%)
 Frame = +1

Query: 1369 MKMAPMDWDKE---------------YTDLPNKLVKCI-----VPDRSIFQTIDQERKLQ 1488
            +K+ PMD+ K                Y  LPNK++K       +P++  F+T  Q    +
Sbjct: 1028 LKIVPMDFIKSPLTSVDDYTNLCISIYNILPNKMIKFTHIRKQIPEKLTFKTSQQASAFK 1087

Query: 1489 NPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLDQFCNEIVELVKASA 1665
                +       + K  M  +   ++G E+ ++ +      ++ D+ CN I E+  + A
Sbjct: 1088 YDAYIHLAYSRSVDKQWMFAALSDSAGKENMMKTWYLGSSKNKFDEACNHIWEMALSLA 1146

>CAGL0E04620g Chr5 (446284..447573) [1290 bp, 429 aa] {ON} similar to
            uniprot|P38248 Saccharomyces cerevisiae YBR078w ECM33 or
            uniprot|Q12355 Saccharomyces cerevisiae YDR055w PST1
          Length = 429

 Score = 32.0 bits (71), Expect = 4.8
 Identities = 35/143 (24%), Positives = 60/143 (41%), Gaps = 4/143 (2%)
 Frame = +1

Query: 676  IDAANGIGGPQLK----KLLTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRL 843
            +D  N I  P +      L ++ + ++    +E I+  SD+ E+  F    +   T+   
Sbjct: 118  VDTINLITLPAISTFSSNLKSANNILISDTSLESIDGFSDLEEVAVFNINNNRYLTSL-- 175

Query: 844  PKGLSPSSHDSLYCSFDGDADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLE 1023
             K    +  DSL  SF+GD   + F  +   +   L D D++S  F K  S    L  + 
Sbjct: 176  -KSSVKTVSDSLQFSFNGDQSSLTFDDLLWANNITLRDVDEVS--FKKLESVNSSLGFIN 232

Query: 1024 NSLRIGVVQTAYANGSSTNYIEN 1092
            NS+    V    + G S + + N
Sbjct: 233  NSISSLSVDNLKSVGQSFSIVSN 255

>Smik_14.84 Chr14 complement(151714..153438) [1725 bp, 574 aa] {ON}
           YNL251C (REAL)
          Length = 574

 Score = 32.0 bits (71), Expect = 5.2
 Identities = 42/194 (21%), Positives = 71/194 (36%), Gaps = 31/194 (15%)
 Frame = +1

Query: 277 YAMQLANTASFASNFE-------EFRAELTRLIEHEKIGLDTSIVPHIVVGRDSRESSPY 435
           +AM + NT + A++ +         +  L+ L +   + L+ S VP  +   D  +    
Sbjct: 150 FAMDITNTTATAASQQLSSDPKQRSKQILSNLKKSSPLNLNIS-VPIDLTSTDPAKQQTA 208

Query: 436 LLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKREREGGSAE-------------- 573
           L   + +       +    +  +T  Q H IT+  ++RERE                   
Sbjct: 209 LFHLIAALQKHFKTSSSQTVATITPSQTHTITEYGSRRERERERERYHSRRNRSRSPPAP 268

Query: 574 ----VATEQDYY------SFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLL 723
               +A  +D Y       + IGA N  F T       +   L+ D  N    P  +   
Sbjct: 269 FPQPLAGRKDRYPSVAQDQYSIGAPNTTFGT-------NNHHLYPDELNVSNNPHYRPKP 321

Query: 724 TSKDWVVPPDQIEV 765
            S D  +PPD I+V
Sbjct: 322 VSYDSTLPPDHIKV 335

>AER246W Chr5 (1092359..1093795) [1437 bp, 478 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR109W (CTM1)
          Length = 478

 Score = 31.6 bits (70), Expect = 6.6
 Identities = 14/32 (43%), Positives = 16/32 (50%)
 Frame = +3

Query: 72  LRYGWVQDPS*EFGHGDVHHWYTGHSQVAEAP 167
           +R GW+   S   G  D   WY GH QV  AP
Sbjct: 1   MRCGWMAGSSETVGIMDTADWYIGHGQVTVAP 32

>TBLA0F00560 Chr6 (140436..141932) [1497 bp, 498 aa] {ON} Anc_3.202
            YBR003W
          Length = 498

 Score = 31.6 bits (70), Expect = 6.7
 Identities = 22/94 (23%), Positives = 40/94 (42%)
 Frame = +1

Query: 1189 NGHGTIIFSEKFHQVIKSELSRARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAI 1368
            N  G + F+ K        ++   GD L  +   C S+L N  V + +S+ +A L     
Sbjct: 220  NPSGNVAFTNK--------MAVLAGDFLLGRATVCISRLENPEVVELMSNSIANLVEGEF 271

Query: 1369 MKMAPMDWDKEYTDLPNKLVKCIVPDRSIFQTID 1470
            M++  M  D + T + N  +   +P     Q ++
Sbjct: 272  MQLKNMVLDSDLTSIDNGKISLPIPSPKFEQYLN 305

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 25.0 bits (53), Expect(2) = 7.6
 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 2/64 (3%)
 Frame = +1

Query: 574 VATEQDYYSFFIGAFNELFSTYEIEKRLSVP--RLFIDAANGIGGPQLKKLLTSKDWVVP 747
           + T +DY  F    F+       I K+      +L  D+ NGI GP  K +    ++ +P
Sbjct: 185 IDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVD-EFDLP 243

Query: 748 PDQI 759
            D++
Sbjct: 244 ADEV 247

 Score = 24.6 bits (52), Expect(2) = 7.6
 Identities = 32/130 (24%), Positives = 52/130 (40%), Gaps = 5/130 (3%)
 Frame = +1

Query: 85  GFRTLAKNLDTVMFTTGILAILRSL--KLQGQYVGVMITASHN---PYQDNGVKIVEPDG 249
           G R L    + ++ T     ++RS   K  G   G+++TASHN   P  D G+K      
Sbjct: 80  GVRKLIIGQNGLLSTPAASHVIRSYAEKCTG---GIILTASHNPGGPENDLGIK------ 130

Query: 250 SMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGLDTSIVPHIVVGRDSRESS 429
                        LAN             E+++ + H KI  D   V    +G+D ++  
Sbjct: 131 -----------YNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKD-QQYG 178

Query: 430 PYLLRCLTST 459
           P L+  + +T
Sbjct: 179 PLLVDIIDTT 188

>ZYRO0G10670g Chr7 complement(857355..861167) [3813 bp, 1270 aa] {ON}
            similar to uniprot|P39702 Saccharomyces cerevisiae
            YAL002W VPS8 involved in vacuolar protein sorting
            required for localization and trafficking of the CPY
            sorting receptor Vps8p is a membrane-associated
            hydrophilic protein which contains a C-terminal
            cysteine-rich region that conforms to the H2 variant of
            the RING finger Zn2 binding motif.
          Length = 1270

 Score = 31.6 bits (70), Expect = 7.7
 Identities = 15/48 (31%), Positives = 28/48 (58%)
 Frame = +1

Query: 622  ELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKDWVVPPDQIEV 765
            ++F+TY+IE+ +S   L I   + +G  QL +   +K W +  D+ E+
Sbjct: 1152 DVFTTYDIERHISRLILEIVQESSVGVGQLYESTLTKGWPIENDECEI 1199

>KAFR0L02140 Chr12 (411877..421464) [9588 bp, 3196 aa] {ON} 
          Length = 3196

 Score = 31.6 bits (70), Expect = 8.1
 Identities = 42/148 (28%), Positives = 65/148 (43%), Gaps = 16/148 (10%)
 Frame = -2

Query: 1007 SSCL----DKNFANNVEILSPSNKWNCDSE-------ST**NTTLSASPSKEQYSESCEE 861
            S+CL    ++NF +   + S SN +  DSE       S   + TLS + S   YS S   
Sbjct: 322  SACLAAPTERNFCSGSSVSSMSNTFTDDSEESTTYEISYSSSDTLSYTVSTSDYSSSFSS 381

Query: 860  GERPLGSLWLVFT*SAPHSKFNNSGTSDLSLMTSIWSGGTTQSLE--VSNFFNCGPPIPL 687
               P  +  +    S P SK  +   S+ S ++S     TT SL+   +  ++    +  
Sbjct: 382  ITNPSKTTEIS---STPSSKSASESPSETSSLSSANYYTTTNSLDATATGSYSGTGSLDA 438

Query: 686  AASMNNLGTDSLFSI---SYVEKSSLKA 612
             A+ +  GTDSL +    SY   +SL A
Sbjct: 439  TATGSYSGTDSLDATATGSYSGTNSLDA 466

>Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]
           {ON} YJL112W (MDV1) - Involved in mitochondrial division
           [contig 260] FULL
          Length = 721

 Score = 31.2 bits (69), Expect = 9.5
 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 2/123 (1%)
 Frame = +1

Query: 364 KIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSN 543
           +IG   S     + G  S E +   +   +S    + H  +   G  ++  L  + +  N
Sbjct: 13  QIGRAVSTTASALFGSQSMEDT---ILSYSSPYKKLLHQTITHSG--SSSALTKLRNTKN 67

Query: 544 KREREGGSA--EVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKK 717
             ++EG +A  ++ +  +  SFF   F++  +++ +   LS   L+   +NGI G + +K
Sbjct: 68  IFKKEGNTAFQDIYSAPNGKSFFSNQFSDTKTSFRVLSYLSEDLLYDIPSNGIPGGKGQK 127

Query: 718 LLT 726
           LLT
Sbjct: 128 LLT 130

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 164,137,687
Number of extensions: 3756568
Number of successful extensions: 11144
Number of sequences better than 10.0: 52
Number of HSP's gapped: 11033
Number of HSP's successfully gapped: 53
Length of query: 556
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 441
Effective length of database: 40,294,809
Effective search space: 17770010769
Effective search space used: 17770010769
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)