Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_5.296.11ON55555529940.0
YEL058W (PCM1)6.11ON55755726740.0
Skud_5.316.11ON55755626290.0
Suva_5.106.11ON55355425900.0
TPHA0M002106.11ON54555915980.0
Kpol_1032.26.11ON53954715410.0
KAFR0L003406.11ON54055415320.0
SAKL0E00902g6.11ON54455615290.0
TBLA0G009806.11ON55857015230.0
TDEL0G046006.11ON52854715130.0
NCAS0F002006.11ON54955515100.0
ZYRO0F00506g6.11ON55055814980.0
NDAI0K028906.11ON56156314880.0
CAGL0B03597g6.11ON54054814340.0
Ecym_30146.11ON55155014150.0
KLTH0C11506g6.11ON54455514020.0
Kwal_56.223556.11ON54155413960.0
ACR015W6.11ON55255613690.0
KLLA0D00858g6.11ON54154913680.0
KNAG0E009406.11ON53855413271e-178
TPHA0I002508.840ON629153950.007
KNAG0J002708.840ON62574940.009
TDEL0B005708.840ON63073930.012
KLLA0D01573g8.840ON60762910.018
Kpol_1068.88.840ON63231900.029
NDAI0K004108.840ON62673880.046
NCAS0C004108.840ON62593880.050
CAGL0M02981g8.840ON61741870.065
Skud_13.4508.840ON62240860.069
YMR278W (PGM3)8.840ON62228860.070
TBLA0B032508.840ON64368860.072
Kwal_27.102588.840ON62031860.072
Suva_13.4668.840ON62228860.080
ZYRO0G14190g8.840ON61049850.10
Smik_13.4918.840ON62228850.11
KAFR0B039208.840ON62464840.13
ABL126W8.840ON62427830.16
KLTH0C03872g8.840ON62150830.18
SAKL0D01474g8.840ON62427820.24
Ecym_46118.840ON63030820.26
CAGL0J10472g5.559ON1345115751.7
Skud_9.195.702ON168089707.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_5.29
         (555 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)  1157   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...  1034   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)  1017   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)  1002   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   620   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   598   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   594   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   593   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   591   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   587   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   586   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   581   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   577   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   556   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   549   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   544   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   542   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   531   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   531   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   515   e-178
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    41   0.007
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    41   0.009
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    40   0.012
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    40   0.018
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    39   0.029
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    39   0.046
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    39   0.050
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    38   0.065
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    38   0.069
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    38   0.070
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    38   0.072
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    38   0.072
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    38   0.080
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    37   0.10 
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    37   0.11 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    37   0.13 
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    37   0.16 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    37   0.18 
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    36   0.24 
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    36   0.26 
CAGL0J10472g Chr10 (1023529..1027566) [4038 bp, 1345 aa] {ON} hi...    33   1.7  
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    32   7.6  

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 1157 bits (2994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/555 (100%), Positives = 555/555 (100%)

Query: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60
           MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV
Sbjct: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120
           GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120

Query: 121 EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 180
           EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS
Sbjct: 121 EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 180

Query: 181 NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 240
           NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL
Sbjct: 181 NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 240

Query: 241 LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 300
           LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD
Sbjct: 241 LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 300

Query: 301 ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360
           ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN
Sbjct: 301 ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360

Query: 361 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 420
           YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR
Sbjct: 361 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 420

Query: 421 GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIV 480
           GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIV
Sbjct: 421 GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIV 480

Query: 481 PDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQL 540
           PDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQL
Sbjct: 481 PDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQL 540

Query: 541 DQFCNEIVELVKASA 555
           DQFCNEIVELVKASA
Sbjct: 541 DQFCNEIVELVKASA 555

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 1034 bits (2674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/557 (87%), Positives = 529/557 (94%), Gaps = 2/557 (0%)

Query: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60
           MK+DYEQL +LYD TCRTKNVQ+SYGTAGFRTLAKNLDTVMF+TGILA+LRSLKLQGQYV
Sbjct: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120
           GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLAN ASFA+NFEEFR EL +LIEH
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH 120

Query: 121 EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 180
           EKI L+T++VPHIVVGRDSRESSPYLLRCLTS+M SVFHAQVLDLGCVTTPQLHYITDLS
Sbjct: 121 EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS 180

Query: 181 NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 240
           N+R+ EG +A VATEQDYYSFFIGAFNELF+TY++EKRLSVP+LFID ANGIGGPQLKKL
Sbjct: 181 NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL 240

Query: 241 LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 300
           L S+DW VP +Q+EVIND+SDVPELLNFECGADYVKTNQRLPKGLSPSS DSLYCSFDGD
Sbjct: 241 LASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGD 300

Query: 301 ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360
           ADRVVFYYVDS S+FHLLDGDKISTLFAKFLSKQLELAHLE+SL+IGVVQTAYANGSST 
Sbjct: 301 ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360

Query: 361 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 420
           YI+NTL CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFH+ IKSELS+++
Sbjct: 361 YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420

Query: 421 --GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 478
             GD LAL+TL CFS+LINQTVGDA+SDMLAVLATLAI+KM+PMDWD+EYTDLPNKLVKC
Sbjct: 421 LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC 480

Query: 479 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSS 538
           IVPDRSIFQT DQERKL NPVGLQ KIDLV+AKYPMGRSFVRASGTEDAVR+YAEC+DSS
Sbjct: 481 IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS 540

Query: 539 QLDQFCNEIVELVKASA 555
           +L QFC+E+VE VKASA
Sbjct: 541 KLGQFCDEVVEHVKASA 557

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 1017 bits (2629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/556 (87%), Positives = 520/556 (93%), Gaps = 2/556 (0%)

Query: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60
           MKIDYEQL +LYD+TCRTKNVQYSYGTAGFRTLAK+LDTVMFTTGILA+LRSLKLQGQYV
Sbjct: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120
           GVMITASHNPYQDNGVKIVEPDGSMLLA+WEPYAMQLAN ASFA++FEEF AEL +LIE 
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120

Query: 121 EKIGLDTS-IVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDL 179
           EKI L  S + PHIVVGRDSRESSPYLLRCLTSTM SVFHA+VLDLGCVTTPQLHYITDL
Sbjct: 121 EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180

Query: 180 SNKREREGGSA-EVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLK 238
           SN+REREG SA   ATEQDYYSFFIGAFNELF+TY++EKRLSVP+LFID ANGIGGPQLK
Sbjct: 181 SNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLK 240

Query: 239 KLLTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFD 298
           KLL SKDWVVP DQIE+INDKSDVP+LLN ECGADYVKTNQRLPKGLSPSS +SLYCSFD
Sbjct: 241 KLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFD 300

Query: 299 GDADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSS 358
           GDADRVVFYYVDSE +FHLLDGDKISTLFAKFLSKQLE+A+LE SL+IGVVQTAYANGSS
Sbjct: 301 GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360

Query: 359 TNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSR 418
           T YI++TL CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQ I+SELS+
Sbjct: 361 TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420

Query: 419 ARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 478
             G  LALKTL CF+KLINQTVGDA+SDMLAVLATLAI+KMAPM+WD+EY DLPNKLVKC
Sbjct: 421 PNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKC 480

Query: 479 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSS 538
           IVPDRSIFQT DQERKLQNPVGLQ+KID VIAKYPMGRSFVRASGTEDAVR+YAECQD S
Sbjct: 481 IVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMS 540

Query: 539 QLDQFCNEIVELVKAS 554
           +LDQFCNEIV  VKAS
Sbjct: 541 KLDQFCNEIVGYVKAS 556

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/554 (84%), Positives = 516/554 (93%), Gaps = 2/554 (0%)

Query: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60
           MKIDY+QL +LY++TC TKN+QYSYGTAGFRTLAK+LDTVMFTTGILA+LRSLKLQGQYV
Sbjct: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120
           GVMITASHNPYQDNGVKIVEPDGSMLLA WEPYAMQLAN ASFA+ F+EF AEL +LIEH
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120

Query: 121 EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 180
           EKI LD +  PH+VVGRDSRESSP+LLRCLTSTM SVFHA V+DLGCVTTPQLHY+T+LS
Sbjct: 121 EKIDLDAA--PHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLS 178

Query: 181 NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 240
           NKR+REGGSA+VATEQDYYSFFI AFNELF+T +IEKRLSVP+LF+D ANGIGGPQLKKL
Sbjct: 179 NKRQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKL 238

Query: 241 LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 300
           L SKDW VP D+IE++NDKSDVP+LLNFECGADYVKTNQRLPKGLSPSS DSLYCSFDGD
Sbjct: 239 LASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGD 298

Query: 301 ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360
           ADRVVFYYVD ES+FHLLDGDKISTLFAKFLSKQLELA+L +SL+IGVVQTAYANGSST+
Sbjct: 299 ADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTS 358

Query: 361 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 420
           YI++TL CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFS+KFHQ I+SELSRA+
Sbjct: 359 YIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQ 418

Query: 421 GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIV 480
           G +LAL TL CF+ LINQTVGDA+SDMLAVLATL+I+ MAP DWDKEYTDLPNKLVKCIV
Sbjct: 419 GSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIV 478

Query: 481 PDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQL 540
           PDRSIFQT DQERKLQNP GLQ KID VI KY MGRSFVRASGTEDAVR+YAECQD ++L
Sbjct: 479 PDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKL 538

Query: 541 DQFCNEIVELVKAS 554
           DQFCNE+VE VK+S
Sbjct: 539 DQFCNEVVEYVKSS 552

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/559 (57%), Positives = 398/559 (71%), Gaps = 22/559 (3%)

Query: 3   IDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGV 62
           + +  L  +++  C T+N +Y YGTAGFR  A  LDTVM TTG+LA LRS+ L G+ VGV
Sbjct: 1   MHWNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEK 122
           MITASHN   DNGVKIVEPDGSML  +WEP+A +LAN ASF  + +EF+  L       K
Sbjct: 61  MITASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYK 120

Query: 123 IGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNK 182
           +  D+ I P +VVGRDSR+S P LL+CL S  V +   +++D G +TTPQLH++T+  N 
Sbjct: 121 V--DSGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINT 178

Query: 183 REREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLT 242
            +    S    TE DYYSFF+ A+  + + + I K L  PRL+IDAANGIGGP++ KL  
Sbjct: 179 TK----SRAPVTEDDYYSFFMDAWVSITALHGI-KVLQSPRLYIDAANGIGGPKVSKLFE 233

Query: 243 SKDWVVP-PDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHD---SLYCSFD 298
               V P   Q  ++N+    P LLN +CGADYVKTNQRLPK + P++     +LYCSFD
Sbjct: 234 ----VWPQAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFD 289

Query: 299 GDADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSS 358
           GDADR+VFYY D+++ FHLLDGDKISTLFA F+SKQL+ A L   + +GVVQTAYANG+S
Sbjct: 290 GDADRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNS 349

Query: 359 TNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSR 418
           TNY+EN L  PVSC KTGVKHLHHEA T YD+GIYFEANGHGTI+FS KF +  +S L +
Sbjct: 350 TNYLENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCES-LLK 408

Query: 419 ARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 478
              + L +KTL  F+ LINQTVGDA+SDML VLA L+IMK+ P  WDKEYTDLPN L K 
Sbjct: 409 ENNESLEVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKV 468

Query: 479 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAEC---Q 535
           +VPDRS+F T DQERKL  P G Q KID ++AKY  GRSFVRASGTEDAVR+YAE    Q
Sbjct: 469 VVPDRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQ 528

Query: 536 DSSQLDQFCNEIVELVKAS 554
           D++ L++   E+ + V AS
Sbjct: 529 DAAALNE---EVSKAVLAS 544

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/547 (54%), Positives = 398/547 (72%), Gaps = 12/547 (2%)

Query: 9   SELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASH 68
           S+L++K C TK+ +Y YGTAGFR  A  L+TVMFTTGI+A LRS+ L G+ VGVMITASH
Sbjct: 3   SKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASH 62

Query: 69  NPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGLDTS 128
           NP +DNGVKIVEP+G+ML  +WEP A +LAN A+  S F++ +A +   ++       + 
Sbjct: 63  NPPEDNGVKIVEPNGAMLDQSWEPMATELANIAA-NSTFDDLKAYVEEKVKKFSPESGSK 121

Query: 129 IVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKREREGG 188
           + P +VVGRDSRES  YLL CL ++  +  +A++++ G +TTPQLH++T+  N ++    
Sbjct: 122 VQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKK---- 177

Query: 189 SAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKDWVV 248
            +    E  YY++FI ++N++ + + I   L    L ID ANGIGGP++++LL  K W  
Sbjct: 178 -SYAVQESSYYNYFIESWNKITALHNITD-LYCSSLTIDTANGIGGPKIQELL--KSWPF 233

Query: 249 PPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSP-SSHDSLYCSFDGDADRVVFY 307
              ++ ++N++ + P+LLN  CGAD+VKTNQ+LP G+S  S+ + LYCS+DGDADR+VFY
Sbjct: 234 A-SKVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFY 292

Query: 308 YVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIENTLR 367
           + D + QFHLLDGDKISTLFAK ++K L  A+L + + +GVVQTAYANGSSTNY++ TL 
Sbjct: 293 FQDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLN 352

Query: 368 CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARGDMLALK 427
            PVSC KTGVKHLHHEA T YDIG+YFEANGHGTIIFS+ F+QV + EL +A  + +A+ 
Sbjct: 353 VPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKEL-KANSESIAVN 411

Query: 428 TLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVPDRSIFQ 487
           TL   S LINQTVGDA+SDML VL+ L+IMK++   WD EYTDLPN L K IVPDRS+F 
Sbjct: 412 TLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFI 471

Query: 488 TIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLDQFCNEI 547
           T DQERKL +P GLQ+KID  I+++  GRSFVRASGTEDAVR+YAE     +  +    +
Sbjct: 472 TTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALV 531

Query: 548 VELVKAS 554
            +LVK S
Sbjct: 532 TKLVKES 538

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/554 (54%), Positives = 385/554 (69%), Gaps = 19/554 (3%)

Query: 4   DYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVM 63
           D  QL   + K C T+N  Y+YGTAGFR  A  LDTVMFTTGI+AILRSL LQG+Y+GVM
Sbjct: 3   DITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVM 62

Query: 64  ITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKI 123
           ITASHNP QDNGVKIVEP G+ML+ +WE  A  LAN AS   NF  F   L+++I   K+
Sbjct: 63  ITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHG-NFTAFVMHLSQVIA--KL 119

Query: 124 GLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKR 183
            +D +  P ++VG DSRESSPYL+ CL +    VF   V++   +TTPQLHY+T L N  
Sbjct: 120 NIDETTTPRLIVGHDSRESSPYLMECLQAA-APVFDTIVINHTLITTPQLHYLTMLQN-- 176

Query: 184 EREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTS 243
                  +V TE DYY FF  ++N LFS Y  +  L+   L +D ANG+G  Q  K L  
Sbjct: 177 -------DVVTEVDYYKFFSTSWNNLFSLYP-DLNLTFNNLIVDGANGVGSVQFSKFLPY 228

Query: 244 KDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGDADR 303
              +     I  INDK +VP++LN +CGAD+VKTNQ+LP G+   +   LY SFDGDADR
Sbjct: 229 LPQLATLTTI--INDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDADR 286

Query: 304 VVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIE 363
           +VFYYVD+  +FHLLDGDKIST+  K L   L  + L N + +GVVQTAYANGSST YI 
Sbjct: 287 IVFYYVDNNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYIT 346

Query: 364 NTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSEL---SRAR 420
            +L+ PV CTKTGVKHLHH A +++DIGIYFEANGHGT++FS KF++V++  +   S + 
Sbjct: 347 KSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSE 406

Query: 421 GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIV 480
               A  +L  FSKLINQTVGD+++D+LAV+ATL+I++++P DWD EY DLPN L KC V
Sbjct: 407 KIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTV 466

Query: 481 PDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQL 540
            +R +F+T D ERKL +P GLQ KID  ++KY  GRSFVRASGTEDAVRIYAE +  +++
Sbjct: 467 LNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEV 526

Query: 541 DQFCNEIVELVKAS 554
           +    E+ +LV+ S
Sbjct: 527 EALSKEVTQLVENS 540

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/556 (55%), Positives = 390/556 (70%), Gaps = 19/556 (3%)

Query: 3   IDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGV 62
           ++ + L ELYDK C+T    Y+YGTAGFR  A  LDTVMFTTGILA +RS+ L+GQYVGV
Sbjct: 2   VNIQLLEELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEK 122
           MITASHNP QDNGVKIV+P G ML   WEP+A +LAN+AS     +E    L +LI   K
Sbjct: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK--QELIKALDKLIT--K 116

Query: 123 IGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNK 182
           +G+D +    I + RDSRES P LL+ +      + + QV+D   +TTPQLH++T   N+
Sbjct: 117 LGIDDTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQ 176

Query: 183 REREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVP-RLFIDAANGIGGPQLKKLL 241
                GS+    E  YYS F  A+ ++   ++I    S+P R+ IDAANGIGGP++ ++L
Sbjct: 177 -----GSSSKVEESTYYSAFSSAWTKICGLHDIN---SLPYRVIIDAANGIGGPKVSEML 228

Query: 242 TSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSS-HDSLYCSFDGD 300
               +      + VIN++   PELLN  CGADYVKTNQ  PKG+S +S ++ +YCSFDGD
Sbjct: 229 LKNKFF--SSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGD 286

Query: 301 ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360
           ADR+VFYY D +S+F+LLDGDKISTLFAKF  + L  A  EN L++GVVQTAYANGSST 
Sbjct: 287 ADRIVFYYHDEKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTE 346

Query: 361 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 420
           Y+ + L  PVSCT TGVKHLHHEA   YDIGIYFEANGHGT+IFS++FH+ I  +L   +
Sbjct: 347 YLSSILEVPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQ 406

Query: 421 GDML--ALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 478
            +    ALKTL  F+ LINQTVGDA+SDMLAVLA L I+K +P  WD+EYTDLPNKLVK 
Sbjct: 407 DEKTAKALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKV 466

Query: 479 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSS 538
           IVPDRS+F+T + ER+L +P GLQ KID  + ++  GRSFVRASGTEDAVR+YAE     
Sbjct: 467 IVPDRSVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKE 526

Query: 539 QLDQFCNEIVELVKAS 554
           + D+    + +LV  S
Sbjct: 527 KADRLAASVSDLVSRS 542

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/570 (53%), Positives = 396/570 (69%), Gaps = 32/570 (5%)

Query: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60
            ++D  + ++L+ K C+TKN  Y+YGTAGFR  A  LDTVMFTTG +A LRSL   G+ V
Sbjct: 3   FQLDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAV 62

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120
           GVM+TASHNP  DNGVKIVEP+GSML   WEP A  LAN AS          EL + +  
Sbjct: 63  GVMVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGK-----IDELVQFVNA 117

Query: 121 EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 180
           + I L+++ VP ++VGRDSRESS  LL CL    + +F A+++D   +TTPQLH++T+  
Sbjct: 118 KLIELNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAY 177

Query: 181 NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLS---VPRLFIDAANGIGGPQL 237
           N  +      ++  E DYY  F  A+++L S        +   +  L ID+ANGIGGP++
Sbjct: 178 NLEK------DLPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKM 231

Query: 238 KKLLTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSP-----SSHDS 292
           + LL  K W     ++ +IN+    PE LN  CGADYVKTNQ+LP G++      SS + 
Sbjct: 232 ENLL--KYWKTNY-KVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNV 288

Query: 293 LYCSFDGDADRVVFYYVDSESQ-FHLLDGDKISTLFAKFLSKQLELAHL--ENSLRIGVV 349
           ++CSFDGDADRVVFYY D +S  F+LLDGDKISTLFA F+S QL+LA +  EN +++GVV
Sbjct: 289 IHCSFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVV 348

Query: 350 QTAYANGSSTNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFH 409
           QTAYANGSSTNY++  L+ PV+C KTGVKHLHHEA T+YDIG+YFEANGHGTIIFSE F+
Sbjct: 349 QTAYANGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFY 408

Query: 410 QVIKSELS-----RARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDW 464
           ++I  +++          + ALKTL   S LINQTVGDA+SDM+ V+A LAI+   P  W
Sbjct: 409 KIINQKINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIW 468

Query: 465 DKEYTDLPNKLVKCIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGT 524
           +KEYTDLPNKL K +VPDRS+F+T DQERKL +P GLQ+KI+ ++AKY  GRSFVRASGT
Sbjct: 469 NKEYTDLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGT 528

Query: 525 EDAVRIYAECQDSSQLDQFCNEIVELVKAS 554
           EDAVR+YAE  D   +++ C E+++    S
Sbjct: 529 EDAVRVYAEASD--DVNKLCQEVLDATAES 556

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/547 (54%), Positives = 388/547 (70%), Gaps = 24/547 (4%)

Query: 6   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 65
           E L  L ++ C T+  +Y YGTAGFR  ++ LDTVMF TGI+A LRS  L G+ VGVMIT
Sbjct: 3   EPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMIT 62

Query: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGL 125
           ASHNP  DNGVK+VEPDGSML+ +WE  A +LAN  +     E+ +A++ +L   E    
Sbjct: 63  ASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLA-NRPLEDIKAKVGQLTSGE---- 117

Query: 126 DTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKRER 185
            +S+ P ++VGRDSR S P+LL CL ++  S+F A++ D G +TTPQLH++T   N+   
Sbjct: 118 -SSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLT---NETMI 173

Query: 186 EGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKD 245
            G   +   EQ Y++ F+GA++++ +   ++    +P + +D ANGIGGP++  LLT   
Sbjct: 174 TGAHVD---EQAYFAHFLGAWDQIAALQPVK----LPNVVVDCANGIGGPKMSALLTQWG 226

Query: 246 WVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGDADRVV 305
           +     Q  VINDK D PELLN  CGAD+VKT+QRLP G+ P+++D LYCSFDGDADRVV
Sbjct: 227 FA---KQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNAND-LYCSFDGDADRVV 282

Query: 306 FYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIENT 365
           FYY+D    FHLLDGDKISTLFA F++K L+   L++ L +GVVQTAYANGSST Y+++ 
Sbjct: 283 FYYLDQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDN 342

Query: 366 LRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARGDMLA 425
           L+ PVSCTKTGVKHLHHEA   YDIGIYFEANGHGT++FS KFH+ + +   +       
Sbjct: 343 LQVPVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTP----E 398

Query: 426 LKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVPDRSI 485
           LK L   +KLINQTVGDA+SDM+AVLA L+I++ +P  WD+E+TDLPNKL K +V DRS 
Sbjct: 399 LKILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSA 458

Query: 486 FQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLDQFCN 545
           F T DQER+L +P GLQ KID  +A+   GRSFVRASGTEDAVR+YAE    S+ DQ  +
Sbjct: 459 FTTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSS 518

Query: 546 EIVELVK 552
            + +LV+
Sbjct: 519 IVGDLVR 525

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/555 (51%), Positives = 394/555 (70%), Gaps = 10/555 (1%)

Query: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60
           M ID   L ++Y+ TC T++ +Y+YGTAGFR  A  LDTVMF TGI+A  RS+ L G  V
Sbjct: 1   MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120
           GVM+TASHNP  DNGVK+VEP G+ML+  WEP   +LAN A+  S FE+    +  + + 
Sbjct: 61  GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANES-FEKVYDFILEVSKD 119

Query: 121 EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 180
            K     +  P +++G DSRESSP L + L +T V +++A + + G VTTPQLH+IT L 
Sbjct: 120 PKFPFQEN-KPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLW 178

Query: 181 NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 240
           N +  +  + +V +  +YY++F  ++++    Y+     S   L ID+ANGIGGP++  L
Sbjct: 179 NAKYNKN-TNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDL 237

Query: 241 LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 300
           +++    +  + + +IN+  + P LLN +CGADYVKTNQ+LPKG+   S+ +L+CSFDGD
Sbjct: 238 ISTWPSTLRGN-VSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGD 296

Query: 301 ADRVVFYYV-DSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSST 359
           ADR+VFYY+ + + +FHLLDGDKI+TLFAKFLS  L+  +L + L++GVVQTAYANGSST
Sbjct: 297 ADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSST 356

Query: 360 NYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRA 419
           NY+ N L+ PVSCTKTGVKHLHHEA+T+YDIGIYFEANGHGT++FSE+F QV+++E    
Sbjct: 357 NYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNEPKTT 416

Query: 420 RGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCI 479
                A +TL  F K+INQTVGDA++DML V+  L++ K+ P  WD+ Y DLPNKL K I
Sbjct: 417 -----ATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVI 471

Query: 480 VPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQ 539
           VPDRS+F T +QER+L +PVGLQ KID+ ++K   GRSFVRASGTEDAVR+YAE     +
Sbjct: 472 VPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEE 531

Query: 540 LDQFCNEIVELVKAS 554
            ++   E+ + V +S
Sbjct: 532 TEKLSQEVCKFVLSS 546

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/558 (53%), Positives = 386/558 (69%), Gaps = 24/558 (4%)

Query: 6   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 65
           + L++L D+ C   +  Y YGTAGFR  A  LDTV+F TGILA LRSL L+G  +GVM+T
Sbjct: 5   DTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVT 64

Query: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEE--------FRAELTRL 117
           ASHNP  DNGVK+VEPDGSM+  +WEP A +LANT +   +  E         + EL   
Sbjct: 65  ASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQ 124

Query: 118 IEHEKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYIT 177
           ++      +  IVP +VVGRDSRES P LL CL ++   +FHA++ D G +TTPQLH++T
Sbjct: 125 LQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLT 184

Query: 178 DLSNKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRL-SVPRLFIDAANGIGGPQ 236
             + K     G A V TE  YY  F+ A++ +   + I + L ++  L IDAANGIG P+
Sbjct: 185 SETAK-----GVANV-TESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPK 238

Query: 237 LKKLLTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCS 296
           +++LL+   W     Q+  INDK   PELLN ECGAD+VK+NQR P G + S+   L CS
Sbjct: 239 VQELLS--QWACR-GQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST--GLGCS 293

Query: 297 FDGDADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANG 356
           +DGDADRVVFYY++  ++F LLDGD+IS LFA F +  L+ A L++ L +GVVQTAYANG
Sbjct: 294 YDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANG 353

Query: 357 SSTNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSEL 416
           +ST Y++ TL+ PVSC KTGVKHLHHEA T+YDIGIYFEANGHGTIIFS KF++VIK + 
Sbjct: 354 NSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQK 413

Query: 417 SRARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLV 476
            R+    +A++TL+ FS+LINQTVGDA+SDML VLA L+I K  P  W +E+TDLPN+L 
Sbjct: 414 ERS----VAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLA 469

Query: 477 KCIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQD 536
           K +VPDRS+F T DQER+L  P GLQ KID  +  +  GRSFVRASGTEDAVR+YAE   
Sbjct: 470 KVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAAS 529

Query: 537 SSQLDQFCNEIVELVKAS 554
              +++  N + ELV  S
Sbjct: 530 LEDVEKLSNTVKELVVKS 547

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/563 (53%), Positives = 389/563 (69%), Gaps = 25/563 (4%)

Query: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQ-- 58
           M  + +QL   +++ C+TKN  Y+YGTAGFR  AK LDTVMFTTGI+A LRSL LQ    
Sbjct: 5   MNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNK 64

Query: 59  --YVGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTR 116
              +GVM+TASHNP +DNGVKI+EP+GSMLL  WEP A Q AN A+  S F+EF   L  
Sbjct: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANES-FDEFYQLLID 123

Query: 117 LIEHEKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYI 176
            I   +  L+    P +++G DSR+SSP L+  +  +   +F+A++++   VTTPQLH+ 
Sbjct: 124 SIVTLENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHF- 182

Query: 177 TDLSNKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQ 236
                       +   A E +YY  F    ++L S Y     L    L IDAANGIG PQ
Sbjct: 183 ------LTNLTNTTGTAEEINYYDHFNKYLSQLQSLYP-PFNLPFDNLIIDAANGIGAPQ 235

Query: 237 LKKLLTSKDWVVP---PDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPS--SHD 291
           ++KLL +K+   P    + I++IN+ S  P LLN  CGADYVKTNQ+LP+G+     ++ 
Sbjct: 236 VEKLLFTKNKFPPLNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANS 295

Query: 292 SLYCSFDGDADRVVFYYVDS-ESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQ 350
           +L+CS+DGDADR+VFYY+D   + F+LLDGDKI+TLFAKF S  L +A L + L++GVVQ
Sbjct: 296 TLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQ 355

Query: 351 TAYANGSSTNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQ 410
           TAYANGSSTNYI + L+ PVSCTKTGVKHLHHEA T+YDIGIYFEANGHGT+IFS+KFH 
Sbjct: 356 TAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFH- 414

Query: 411 VIKSELSRAR--GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEY 468
              SEL++ +  G    +KTL  FS+LINQTVGDA+SDMLAV+A L+I++++P  WDKEY
Sbjct: 415 ---SELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEY 471

Query: 469 TDLPNKLVKCIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAV 528
            DLPNKL K IVPDRS F T DQERKL  P GLQ  ++  +A   +GRSFVRASGTEDAV
Sbjct: 472 KDLPNKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAV 531

Query: 529 RIYAECQDSSQLDQFCNEIVELV 551
           R+YAE +   + +    ++ +LV
Sbjct: 532 RVYAEAKTQEETEWLSKKVCQLV 554

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/548 (53%), Positives = 374/548 (68%), Gaps = 27/548 (4%)

Query: 10  ELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHN 69
           +LY+K C T++  Y+YGTAGFR  A+ LD+VMFTTG++A LRS+  Q   VGVMITASHN
Sbjct: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63

Query: 70  PYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGLDTSI 129
           P +DNGVKIVE DGSMLL  WEP A +LAN+ +   ++  F + L  +++  ++ +    
Sbjct: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVA---DYHTFESTLNAIMQ--ELNISPGH 118

Query: 130 VPHIVVGRDSRESSPYLLRCLTSTMVSVF-HAQVLDLGCVTTPQLHYITDLSNKREREGG 188
            P IVVG DSRESSP LL  L   + +V   A++ + G +TTPQLH++T           
Sbjct: 119 APQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT----------- 167

Query: 189 SAEVATEQDYY-SFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKDWV 247
            A  A  +DYY  +F+ A+N+LF  Y IE   S  +L ID ANGIGGPQ  K+L+     
Sbjct: 168 -ANPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTD 226

Query: 248 VPP------DQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGDA 301
           +P        QI++ N+    P +LN  CGAD+VKTNQRLP+G++    + LYCSFDGDA
Sbjct: 227 LPHLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRN-LYCSFDGDA 285

Query: 302 DRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNY 361
           DRVVFYYVD    FHLLDGDKISTL A F++  L+ A L   L++GVVQTAYANGSST Y
Sbjct: 286 DRVVFYYVDDSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTY 345

Query: 362 IENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARG 421
           +   L+ PVS  KTGVKHLHHEA T YDIG+YFEANGHGT+IFS+ F++VI+  L++   
Sbjct: 346 VTKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAH 405

Query: 422 DMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVP 481
           D   L      S+LINQT+GDA+SDMLA++  L I+  +P  WD EYTDLPNKL K +VP
Sbjct: 406 DKSTLTLR-LLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVP 464

Query: 482 DRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLD 541
           DRSIF T DQER+L +P GLQ KID+++A  P GRSF+RASGTEDAVR+YAE Q     +
Sbjct: 465 DRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATE 524

Query: 542 QFCNEIVE 549
           +   E+ +
Sbjct: 525 KLSTEVTD 532

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/550 (53%), Positives = 369/550 (67%), Gaps = 14/550 (2%)

Query: 6   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 65
           E++S+LYDK C ++  +Y YGTAGFR  A+ LDTV+FTTG+LA LRS+ L+GQYVG MIT
Sbjct: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMIT 63

Query: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGL 125
           ASHNP QDNGVK+V+P G ML   WE YA +LAN AS   +  +F   L  L+    I  
Sbjct: 64  ASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKH--QFLHRLQELMNQFGIKA 121

Query: 126 DTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKRER 185
           D+     IVV RDSRES   LL+ L        +  ++D   +TTPQLH++T   N++  
Sbjct: 122 DSE--ARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQME 179

Query: 186 EGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKD 245
                EV  E  YYS F+ A  EL   + I   L  P L IDAANG+GG + ++L     
Sbjct: 180 SERVIEV-NEAFYYSHFLSALKELTELFNIPG-LPYP-LVIDAANGVGGAKAEELFMKNT 236

Query: 246 WVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSH-DSLYCSFDGDADRV 304
           +    D   +IN      +LLN  CGADYVKTNQ LP+G+S ++  +SL+CSFDGDADRV
Sbjct: 237 FF--KDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRV 294

Query: 305 VFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIEN 364
           +FYY D +  FHLLDGDKISTLFAKF    L +A +++++++GVVQTAYANGSST Y+  
Sbjct: 295 IFYYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSE 354

Query: 365 TLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSEL---SRARG 421
            L  PVSCT TGVK+LH +A   YD+GIYFEANGHGT+IFSE F+  +   L   S +  
Sbjct: 355 VLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAE 414

Query: 422 DMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVP 481
             +ALKTL  FSKLINQTVGDA+SDM+AVLA L I+K  P  WD EYTDLPN L+K +VP
Sbjct: 415 SKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVP 474

Query: 482 DRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLD 541
           DRS+F+T + ER+L +P GLQA+ID VI  Y   RSFVRASGTEDAVRIYAE     Q D
Sbjct: 475 DRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQAD 534

Query: 542 QFCNEIVELV 551
               +I +LV
Sbjct: 535 DLSIKISQLV 544

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/555 (51%), Positives = 383/555 (69%), Gaps = 20/555 (3%)

Query: 3   IDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGV 62
           +D + L  LY+  C++    Y+YGTAGFR  A  LDTVMFTTG+LA LRS+ L+G+ VGV
Sbjct: 2   LDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEK 122
           MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+A+   +F  F A L  L+   +
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSAT--QSFTAFLAYLQNLVS--E 116

Query: 123 IGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNK 182
           +GLDT  +  + V RDSRES P LL  L +    + + ++ D G +TTPQLH++T   N+
Sbjct: 117 LGLDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNE 176

Query: 183 REREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVP-RLFIDAANGIGGPQLKKLL 241
              +           YY  F+ A++++ +   I+   S+P +L IDAANGIG P++K++L
Sbjct: 177 LPNDTAIDRFF----YYKEFLSAWDDITALCGIQ---SLPYKLEIDAANGIGAPRVKEML 229

Query: 242 TSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSH-DSLYCSFDGD 300
           ++  +        V+ND  + P  LN  CGADYVKTNQRLP G+  ++    + CSFDGD
Sbjct: 230 STHKFF--DGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGD 287

Query: 301 ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360
           ADR+VFY+ DSE QF LLDGDK++TLFAKF    L  A+L+  L +GVVQTAYANGSST+
Sbjct: 288 ADRIVFYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTH 347

Query: 361 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELS--- 417
           YIE  L  PV+CT TGVKHLHHEA   YDIG+YFEANGHGT++FS+KF +V+ S LS   
Sbjct: 348 YIERVLGIPVTCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKH 406

Query: 418 RARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVK 477
           ++   + +L+ L  F+ LINQTVGDA+SDM+ VLA L+I+K  P  W++EYTDLPNKLVK
Sbjct: 407 QSDSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVK 466

Query: 478 CIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDS 537
            +VPDR++F+T + ER+L +P+GLQ KI+ ++A+Y   RSFVRASGTEDAVR+YAE    
Sbjct: 467 VLVPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTR 526

Query: 538 SQLDQFCNEIVELVK 552
            + D   + + ++V+
Sbjct: 527 EEADSLASRVSQVVE 541

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/554 (51%), Positives = 378/554 (68%), Gaps = 20/554 (3%)

Query: 3   IDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGV 62
           +D + L  LY+  C T    Y+YGTAGFR  A  LDTVMFTTG++A LRS+ L+G+ VGV
Sbjct: 2   LDTKALKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEK 122
           MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+AS    F EF A + RL+   +
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSAS--QGFSEFVASVERLMTKLE 118

Query: 123 IGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNK 182
           +G +      IVV RDSRES P LL    S +  + + +V D G +TTPQLH++T  SN+
Sbjct: 119 VGSNDH--GSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNE 176

Query: 183 REREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVP-RLFIDAANGIGGPQLKKLL 241
             +     E+  +  YY  F+ A+ E+    +I+   S+P +L IDAANGIG P + ++L
Sbjct: 177 LPK---GTEIG-KSLYYDNFLSAWVEIAELCKID---SLPYKLEIDAANGIGAPVVTEML 229

Query: 242 TSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSS-HDSLYCSFDGD 300
           +   +        V+ND+ + P+ LN  CGAD+VKTNQ+LP G++P    + + CSFDGD
Sbjct: 230 SQHKFF--KGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGD 287

Query: 301 ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360
           ADR+VFYY      FHLLDGDK++TLFAKF  + L  A L++ L +GVVQTAYANGSST 
Sbjct: 288 ADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTA 347

Query: 361 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSR-- 418
           YIE  L   V+CT TGVKHLHHEA  +YDIG+YFEANGHGT++FS KF  VI  +LS   
Sbjct: 348 YIEQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKL 406

Query: 419 -ARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVK 477
            +     +LK L  F+KLINQTVGDA+SDMLAVLA L+I+K +P  WD+EYTDLPNKL+K
Sbjct: 407 ESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIK 466

Query: 478 CIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDS 537
            +VPDR++F+T + ER+L +P G+Q KID ++A +  GRSFVRASGTEDAVR+YAE    
Sbjct: 467 VLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATP 526

Query: 538 SQLDQFCNEIVELV 551
            + +    ++ +L+
Sbjct: 527 QETEALSQQVEKLL 540

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/556 (50%), Positives = 371/556 (66%), Gaps = 23/556 (4%)

Query: 6   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 65
           +++ +LYD+  R     Y+YGTAGFR+ A+ L  V+F TG+LA LRSL L G YVGVM+T
Sbjct: 5   QEMVKLYDRH-RGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLT 63

Query: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGL 125
           ASHNP +DNGVK+V+P G ML A WE +A  LAN AS     +E    L  L++  ++GL
Sbjct: 64  ASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQ--QELLDALHMLVD--RLGL 119

Query: 126 DTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKRER 185
           D ++   +VV RDSR S P LL  L      +   +V+D G +TTPQLH++T   N+R  
Sbjct: 120 DLALRARVVVARDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNER-- 177

Query: 186 EGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKD 245
             GSA    E  YY+ F+ A  EL + + +E  L  P L +D ANG+G  + ++L     
Sbjct: 178 --GSAAGVREDLYYAHFVAALEELAALHGLET-LPFP-LVVDTANGVGALKARELFRRSP 233

Query: 246 WVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSS-HDSLYCSFDGDADRV 304
                +++ +IND     ELLN  CGADYVKT Q LP+G+S     +SL+CS+DGDADRV
Sbjct: 234 LF--KNRVSIINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRV 291

Query: 305 VFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIEN 364
           +FYY+D + +FHLLDGDKISTL AKFL   L  A + + + +GVVQTAYANGSST Y+  
Sbjct: 292 IFYYIDGQERFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSE 351

Query: 365 TLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSEL------SR 418
            L  PVSCT TGVKHLH EA  +YD+GIYFEANGHGT+IFSE F   ++  L      ++
Sbjct: 352 VLEVPVSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAK 411

Query: 419 ARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 478
           AR   L+L+TL  F+ LINQT+GDA++DMLAV+A L+I+  +P DWDK+YTDLPN LVK 
Sbjct: 412 AR---LSLQTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKV 468

Query: 479 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSS 538
           +VPDRS+F+T + E++L +P GLQ  ID ++  Y  GRSFVRASGTEDAVRIYAE     
Sbjct: 469 VVPDRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQ 528

Query: 539 QLDQFCNEIVELVKAS 554
           Q D+   ++  LV  S
Sbjct: 529 QADELATKVSTLVVES 544

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/549 (51%), Positives = 380/549 (69%), Gaps = 21/549 (3%)

Query: 10  ELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHN 69
           +LY++ C+  +  Y+YGTAGFR     LDTVMFTTGI+A+LRS+ L+ ++VGVMITASHN
Sbjct: 5   DLYEQYCKQGHA-YTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHN 63

Query: 70  PYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGLDTSI 129
           P +DNGVK+VEP G ML+  WEP A +LAN AS  S+F +  + L  +I   ++ +DT+ 
Sbjct: 64  PPEDNGVKVVEPYGEMLVQNWEPIATKLANAAS--SSFTQLESTLQSIIA--ELNIDTTQ 119

Query: 130 VPHIVVGRDSRESSPYLLRCLTSTMVSVFHA-QVLDLGCVTTPQLHYITDLSNKREREGG 188
           + +I V RDSRES P LL  L +  +SVF A +++D   +TTPQLH++    N   +   
Sbjct: 120 LANITVARDSRESGPRLLAALKAG-ISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQ 178

Query: 189 SAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVP-RLFIDAANGIGGPQLKKLLTSKDWV 247
                 +  YY  F+  +N+L   YE+ +   +P  L ID ANGIG  ++K+L++    +
Sbjct: 179 ----VRDSTYYDHFVSIWNQLTQLYEVTE---LPFHLTIDCANGIGADKVKQLISQAGHM 231

Query: 248 VPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGDADRVVFY 307
           +  + +  +N ++   +LLN  CGAD+VKTNQ  P   +P     LYCSFDGDADRVVFY
Sbjct: 232 LE-NSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKP-SQLYCSFDGDADRVVFY 289

Query: 308 YVDS-ESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIENTL 366
           YVD  E++FHLLDGDKI+TL AK ++  L    L ++L++GVVQTAYANGSST YI + L
Sbjct: 290 YVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKL 349

Query: 367 RCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRARGD---M 423
           + PVSCTKTGVKHLHHEA ++YDIGIYFEANGHGT+IFS +F + + S L    G+    
Sbjct: 350 KIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQY 409

Query: 424 LALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKCIVPDR 483
            +L +L   S+LINQTVGDA+SDMLAV+ATL+I  + P DWD  Y DLPN+L K IVPDR
Sbjct: 410 KSLLSLKLLSQLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDR 469

Query: 484 SIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLDQF 543
           S+F + + ER+L +P GLQAKIDL++ ++P  RSFVRASGTEDAVR+YAE + +    + 
Sbjct: 470 SVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIEL 529

Query: 544 CNEIVELVK 552
             ++ ELVK
Sbjct: 530 ATKVGELVK 538

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  515 bits (1327), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 277/554 (50%), Positives = 359/554 (64%), Gaps = 31/554 (5%)

Query: 6   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 65
           E +  ++D  C TK   Y+YGTAGFR  A  LDTVMF TG +A+LRS +L G  VGVM+T
Sbjct: 4   EAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVT 63

Query: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGL 125
           ASHNP +DNGVK+V+P+G ML   WEP A +LAN A+  + F+++    T L+E      
Sbjct: 64  ASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGT-FDQWWEYWTSLVEEG---- 118

Query: 126 DTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQV-LDLGCVTT-PQLHYITDLSNKR 183
           + +    + VG D+RESSP LL+ L    ++V    + +    +T  PQLHY+T L    
Sbjct: 119 NYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSL---- 174

Query: 184 EREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTS 243
           +R+G    V     Y   F G + +LF    +       RLFID ANG+G  QL++    
Sbjct: 175 QRDG----VTDAAAYNDHFQGCWQKLFPDGVVAWPFD--RLFIDTANGVGAVQLQQFF-- 226

Query: 244 KDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLP------KGLSPSSHDSLYCSF 297
           K W V  ++  ++N     PE LN +CGAD+VKTN RLP      +G S +  D LYCSF
Sbjct: 227 KGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPD-LYCSF 285

Query: 298 DGDADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGS 357
           DGDADR+VFY+V ++ QFHLLDGDKISTLFAKF+ +    A  ++ L +GVVQTAYANG+
Sbjct: 286 DGDADRIVFYFVKNK-QFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGN 344

Query: 358 STNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELS 417
           ST YI + L  P +CTKTGVKHLHH A TQYDIGIYFEANGHGT++FS+KF++V+    S
Sbjct: 345 STRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGVAS 404

Query: 418 RARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVK 477
                  A  TL  FSKLINQTVGDA++DML VLA L  ++  P  W  EYTDLPN L K
Sbjct: 405 TND----AASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTK 460

Query: 478 CIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDS 537
            +VPDRSIF+T DQER+L +P GLQ KID  + ++   RSFVRASGTE+AVRIY E +D 
Sbjct: 461 VVVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDP 520

Query: 538 SQLDQFCNEIVELV 551
            ++ +   ++ E V
Sbjct: 521 QEVQELSKQVTEAV 534

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 65/153 (42%), Gaps = 26/153 (16%)

Query: 27  TAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86
            AGF+    N +     T ++     + L    +GVMITASHNP  DNG K+   +G  +
Sbjct: 126 NAGFKVYYLNPNDEFVHTPMVPF--GINLYSASIGVMITASHNPEMDNGYKVYYNNGCQI 183

Query: 87  LATWEPYAMQLA-----NTASFASNFEEFRAELTRLIEHEK-------------IGLDTS 128
           +    P+   +A     N    + N+    A +++ IE+ K             + LD  
Sbjct: 184 IP---PHDKNIAECIEKNLEPLSDNWNT-EAVISKAIENVKLIYSKEDVLQQYMLNLDKY 239

Query: 129 IVP-HIVVGRDSRESSPYLLRC-LTSTMVSVFH 159
           I+P +I +G   +   P+ +   +      +FH
Sbjct: 240 IIPKNISLGTTIKGKKPWFVYTPMHGVGYQIFH 272

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 28  AGFRTLAKNL-DTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86
           AGF+ L  N  DT++ T  +   +  L      VGVMITASHNP  DNG K+   +G  +
Sbjct: 124 AGFKVLYLNPGDTLVHTPLVPFTVDHLNAS---VGVMITASHNPKMDNGYKVYFANGCQI 180

Query: 87  LATWEPYAMQLANT 100
           +    P+ + +A +
Sbjct: 181 IP---PHDLNIARS 191

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 28  AGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           AGF+ +  N       T I+    ++   G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 129 AGFKVIFLNDGDKFVHTPIVPF--TVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQII 186

Query: 88  ATWEPYAMQLANT 100
               P+  ++A +
Sbjct: 187 P---PHDSEIAQS 196

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTR 116
           G  VG+MITASHNP  DNG K+   +G  ++    P+   +A   S   N E F +  T 
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQIIP---PHDKLIAE--SIIHNLEPFSSPQTG 205

Query: 117 LI 118
            I
Sbjct: 206 TI 207

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 17/73 (23%)

Query: 60  VGVMITASHNPYQDNGVK--------IVEPDGSMLLAT----WEPYAMQLANTASFASNF 107
           +GVMITASHNP  DNG K        I+ P    + AT     EP++      ++F  N 
Sbjct: 154 IGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKNL 213

Query: 108 EE-----FRAELT 115
           +E      R E+T
Sbjct: 214 KEKKLVYVREEMT 226

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 38/93 (40%), Gaps = 14/93 (15%)

Query: 28  AGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVK--------IV 79
           AGF+      D   F    L     L L+   VGVMITASHNP  DNG K        I+
Sbjct: 123 AGFKVFYLTPDD-QFVHTPLVPFSVLNLKAS-VGVMITASHNPKMDNGYKVYYDNACQII 180

Query: 80  EPD----GSMLLATWEPYAMQLANTASFASNFE 108
            P       M+    EP++      A+F    E
Sbjct: 181 PPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLE 213

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANT 100
           VGVMITASHNP  DNG K+   +G  ++    P+   +A T
Sbjct: 148 VGVMITASHNPKMDNGYKVYYTNGCQIIP---PHDHGIAET 185

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLAN 99
           VGVMITASHNP  DNG K+   +G  ++    P+   ++N
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIP---PHDQAISN 187

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 37.7 bits (86), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 11/68 (16%)

Query: 28  AGFRTLAKNLDTV--------MFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIV 79
           AGF+    N D++        + T  +   +++LK     VGVM+TASHNP  DNG K+ 
Sbjct: 129 AGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKAS---VGVMVTASHNPKMDNGYKVY 185

Query: 80  EPDGSMLL 87
             +G  ++
Sbjct: 186 YSNGCQII 193

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 37.7 bits (86), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           G   GVMITASHNP  DNG K+   +G  ++
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFE 108
           VGVMITASHNP  DNG K+   +G  ++    P+   +A   S  SN E
Sbjct: 147 VGVMITASHNPKLDNGYKVYYANGCQIIP---PHDSAIAR--SIESNLE 190

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 24  SYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDG 83
           ++  AGF+    N +     T ++    S+       GVMITASHNP  DNG K+   +G
Sbjct: 123 TFLNAGFKVFYLNTENEFVHTPLVPY--SVDKLRSACGVMITASHNPKDDNGYKVYYSNG 180

Query: 84  SMLL 87
             ++
Sbjct: 181 CQII 184

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87
           GVMITASHNP  DNG K+   +G  ++
Sbjct: 160 GVMITASHNPKMDNGYKVYYANGCQII 186

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 38  DTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           D V+ T  +   +  L+  G   G+MITASHNP  DNG K+   +G  ++
Sbjct: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQII 183

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87
           G+MITASHNP  DNG K+   +G  ++
Sbjct: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSML 86
           G   G+MITASHNP  DNG K+   +G  +
Sbjct: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQI 189

>CAGL0J10472g Chr10 (1023529..1027566) [4038 bp, 1345 aa] {ON} highly
            similar to uniprot|P38931 Saccharomyces cerevisiae
            YDR443c SCA1 DNA-directed RNA polymerase II
          Length = 1345

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 50/115 (43%), Gaps = 20/115 (17%)

Query: 457  MKMAPMDWDK-------EYTDL--------PNKLVKCI-----VPDRSIFQTIDQERKLQ 496
            +K+ PMD+ K       +YT+L        PNK++K       +P++  F+T  Q    +
Sbjct: 1028 LKIVPMDFIKSPLTSVDDYTNLCISIYNILPNKMIKFTHIRKQIPEKLTFKTSQQASAFK 1087

Query: 497  NPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSSQLDQFCNEIVELV 551
                +       + K  M  +   ++G E+ ++ +      ++ D+ CN I E+ 
Sbjct: 1088 YDAYIHLAYSRSVDKQWMFAALSDSAGKENMMKTWYLGSSKNKFDEACNHIWEMA 1142

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
           YIL149C (REAL)
          Length = 1680

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 12/89 (13%)

Query: 335 LELAHLENSLRIGVVQTAY-ANGSSTNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIY 393
           LE+ +L N LR+  +Q  + +N S TN +E TLR  +  T+  +K  H +      I  Y
Sbjct: 845 LEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQ------IKAY 898

Query: 394 FEANGHGTIIFSEKFHQVIKSELSRARGD 422
            E      I  +E   + +  EL +A+ D
Sbjct: 899 EE-----IISTNENVLKELNGELKKAKED 922

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,281,180
Number of extensions: 2407912
Number of successful extensions: 6221
Number of sequences better than 10.0: 48
Number of HSP's gapped: 6299
Number of HSP's successfully gapped: 48
Length of query: 555
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 440
Effective length of database: 40,294,809
Effective search space: 17729715960
Effective search space used: 17729715960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)