Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_5.286.12ON74744021e-52
YEL059C-A (SOM1)6.12ON74743403e-43
Suva_5.96.12ON73733319e-42
Skud_5.306.12ON74743195e-40
KLLA0D00880g6.12ON71731686e-17
Ecym_30156.12ON70731546e-15
Kwal_56.223596.12ON91731522e-14
KLTH0C11484g6.12ON89751462e-13
Kpol_1032.36.12ON78811435e-13
SAKL0E00924g6.12ON97811445e-13
ACR014C6.12ON70731363e-12
TPHA0M002206.12ON78791331e-11
TDEL0G045906.12ON74771243e-10
ZYRO0F00528g6.12ON77771201e-09
KNAG0E009306.12ON109551133e-08
NCAS0F002106.12ON7983888e-05
KAFR0L003506.12ON7159879e-05
TBLA0G009906.12ON7883760.005
NCAS0A035304.180ON86064602.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_5.28
         (74 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...   159   1e-52
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...   135   3e-43
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...   132   9e-42
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...   127   5e-40
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    69   6e-17
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    64   6e-15
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    63   2e-14
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    61   2e-13
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    60   5e-13
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    60   5e-13
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    57   3e-12
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    56   1e-11
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    52   3e-10
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    51   1e-09
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    48   3e-08
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    39   8e-05
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    38   9e-05
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    34   0.005
NCAS0A03530 Chr1 complement(698730..701312) [2583 bp, 860 aa] {O...    28   2.1  

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score =  159 bits (402), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 74/74 (100%), Positives = 74/74 (100%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60
          MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60

Query: 61 PATNYEVTDTYTNS 74
          PATNYEVTDTYTNS
Sbjct: 61 PATNYEVTDTYTNS 74

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score =  135 bits (340), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 62/74 (83%), Positives = 67/74 (90%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60
          MAPPTTIR+RDQALAPL  LDSQ +C+LKELVQWECQFKGA+YVCSPFKRLFEHC+   K
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60

Query: 61 PATNYEVTDTYTNS 74
           ATNYEVTDTYTNS
Sbjct: 61 SATNYEVTDTYTNS 74

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score =  132 bits (331), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 64/73 (87%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60
          MAPPTTIR+RDQALAPL  LDS+  C LKELVQWECQFKGADYVCSPF+RLFEHC   G+
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60

Query: 61 PATNYEVTDTYTN 73
           ATNYEVTDTYTN
Sbjct: 61 AATNYEVTDTYTN 73

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score =  127 bits (319), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 63/74 (85%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60
          MAPPTTIRSRDQALAPL ALDS   CQLKELVQWECQF+ ADYVC PFKRLFE C+   K
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60

Query: 61 PATNYEVTDTYTNS 74
           AT+YEVTDTYTNS
Sbjct: 61 SATDYEVTDTYTNS 74

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 69.3 bits (168), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60
          MAPPT I   D        L    +C LK LVQ EC F G DYVC+PFKRLFE C+    
Sbjct: 1  MAPPTKILGLD---TQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDG 57

Query: 61 PATNYEVTDTYTN 73
             N EVT+  TN
Sbjct: 58 RVLNIEVTNLNTN 70

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 63.9 bits (154), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60
          MAPPT I +RD+ + P+++      C L  L+Q EC F G +YVC PFKRLFE C    K
Sbjct: 1  MAPPTPIITRDE-VEPILS--RTKDCILASLIQNECHFDGHNYVCIPFKRLFEECT-LNK 56

Query: 61 PATNYEVTDTYTN 73
               EVTD  TN
Sbjct: 57 RRVRIEVTDISTN 69

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 63.2 bits (152), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 44/73 (60%), Gaps = 3/73 (4%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60
          MAPPT +  +++ L PL+  +  A+C  K L Q EC F G  YVC PFKR+F+ C   GK
Sbjct: 1  MAPPTVVFGKEE-LEPLLR-NVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGK 58

Query: 61 PATNYEVTDTYTN 73
           +   EVTD  TN
Sbjct: 59 -SIRIEVTDRNTN 70

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 60.8 bits (146), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 46/75 (61%), Gaps = 7/75 (9%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQAS--CQLKELVQWECQFKGADYVCSPFKRLFEHCVEH 58
          MAPPT +  +++    L  +  +A+  C LK LVQ EC+F G +YVC+PFKRLF+ C   
Sbjct: 1  MAPPTLVFGKEE----LKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKEC-GA 55

Query: 59 GKPATNYEVTDTYTN 73
          GK     EVTD  TN
Sbjct: 56 GKRIVRIEVTDQDTN 70

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 59.7 bits (143), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 12/81 (14%)

Query: 1  MAPPTTIRSRDQALAP----LMALDSQASCQLKELVQWECQFKGA---DYVCSPFKRLFE 53
          MAPPT I+SR++ L       M  + +  C L  + Q++C+F+ +   +Y+C PFKRLFE
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 54 HCVEHGKPATNYEVTDTYTNS 74
           C          EVTD +TN+
Sbjct: 61 EC-----SGIRIEVTDRFTNN 76

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 60.1 bits (144), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 9/81 (11%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60
          MAPPT +  +D+  + L  +  +  C LK L+Q EC F G +Y+C PFKRLF+ C+   K
Sbjct: 1  MAPPTPVFGKDELESLLKKV--KPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSK 58

Query: 61 P-------ATNYEVTDTYTNS 74
                      E+TD +TN 
Sbjct: 59 TKDGRTSRTVRIEITDRHTND 79

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 57.0 bits (136), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60
          MAPPT + +R++ +AP  AL +   C L  L Q EC F G  YVC PF+RLF  C  + K
Sbjct: 1  MAPPTPVLTREE-VAP--ALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTLN-K 56

Query: 61 PATNYEVTDTYTN 73
               E+T+  TN
Sbjct: 57 RRVRIEITERNTN 69

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 55.8 bits (133), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 43/79 (54%), Gaps = 10/79 (12%)

Query: 1  MAPPTTIRSRDQALAPLMALD--SQASCQLKELVQWECQF---KGADYVCSPFKRLFEHC 55
          MAP T +  R+   A L A    ++  C+LK L Q+ECQF   +   Y+C PFKRLFE C
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

Query: 56 VEHGKPATNYEVTDTYTNS 74
                 T+YE T   TNS
Sbjct: 61 A-----GTSYETTAQPTNS 74

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 52.4 bits (124), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 8/77 (10%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGAD---YVCSPFKRLFEHCVE 57
          MAPPT + +R++    L  +    +C LK L Q++CQ + A    Y C PFKRLF+ C +
Sbjct: 1  MAPPTPVLAREE----LPEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRD 56

Query: 58 -HGKPATNYEVTDTYTN 73
            G+  +  EVT   TN
Sbjct: 57 PSGRFKSRIEVTSPLTN 73

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 50.8 bits (120), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 40/77 (51%), Gaps = 9/77 (11%)

Query: 1  MAPPTTIRSRDQA---LAPLMALDSQASCQLKELVQWECQFKG-ADYVCSPFKRLFEHCV 56
          MAPPT I + +Q       +  L  +  C+LK L Q  C  +   +Y+C PFKR+FE C+
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60

Query: 57 EHGKPATNYEVTDTYTN 73
           H       EVTD  TN
Sbjct: 61 GHA-----LEVTDADTN 72

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 48.1 bits (113), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHC 55
          MAP   + +R+    P      Q  C LKELVQ+ C+  G  + C+PF+RLFE C
Sbjct: 1  MAPNVRVLTRNDVPLP----QPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC 51

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 38.5 bits (88), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 15/83 (18%)

Query: 1  MAPPTTIRSRDQ-----ALAPLMALDSQA----SCQLKELVQWECQF-KGADYVCSPFKR 50
          MAPP  +  +D      AL+     ++ A     C+  +L Q++CQ  +   Y+C PFKR
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQYICFPFKR 60

Query: 51 LFEHCVEHGKPATNYEVTDTYTN 73
          +F+ C          EVT+  +N
Sbjct: 61 VFQEC-----QGVRTEVTNVDSN 78

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 38.1 bits (87), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFK-GADYVCSPFKRLFEHCVEH 58
          MAP   +   D A   +   +    CQL  LVQ+ C+++ G    C PFKR+F  C++ 
Sbjct: 1  MAPMIRVMDGDAAEREVKGAEG---CQLYSLVQYNCEYRVGGTLECFPFKRMFLECLDK 56

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 33.9 bits (76), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 16/83 (19%)

Query: 1  MAPPTTIRSRDQALAPLMAL-------DSQASCQLKE--LVQWECQFKGADYV-CSPFKR 50
          MAPP TI+++++ L  L  +       D++ S + K+  + Q+EC       + C PFKR
Sbjct: 1  MAPPVTIQTKEE-LDILEKVNRKNRKDDTKKSAKPKKYSITQYECFDNDKGQIECFPFKR 59

Query: 51 LFEHCVEHGKPATNYEVTDTYTN 73
          +F+   E+ +     E+TD  TN
Sbjct: 60 IFQQVGEYRR-----EITDETTN 77

>NCAS0A03530 Chr1 complement(698730..701312) [2583 bp, 860 aa] {ON}
           Anc_4.180 YLR347C
          Length = 860

 Score = 27.7 bits (60), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 11/64 (17%)

Query: 11  DQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKR------LFEHCV----EHGK 60
           DQAL  ++ L +  S Q+KE   W C  + AD V    K       + + C+    EH K
Sbjct: 409 DQALPAVLNLTNDESLQVKETASW-CIGRVADLVPESIKADTHLPGVVQACLKGLQEHPK 467

Query: 61  PATN 64
            ATN
Sbjct: 468 VATN 471

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.130    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,884,264
Number of extensions: 243854
Number of successful extensions: 471
Number of sequences better than 10.0: 19
Number of HSP's gapped: 465
Number of HSP's successfully gapped: 19
Length of query: 74
Length of database: 53,481,399
Length adjustment: 46
Effective length of query: 28
Effective length of database: 48,206,763
Effective search space: 1349789364
Effective search space used: 1349789364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)