Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_5.276.14ON60860826620.0
YEL060C (PRB1)6.14ON63548523240.0
Skud_5.296.14ON60848523010.0
Suva_5.76.14ON66449222380.0
SAKL0E01012g6.14ON54449517390.0
TDEL0G045506.14ON56448016790.0
Kwal_56.223876.14ON54348416530.0
KLTH0C11396g6.14ON55049216460.0
NCAS0F002206.14ON69544516240.0
KLLA0D00979g6.14ON56148416010.0
TBLA0A073006.14ON57347515990.0
NDAI0K028806.14ON70449315880.0
CAGL0B03619g6.14ON46847214960.0
ACR012C6.14ON54148314940.0
ZYRO0C07942g6.14ON54848314930.0
Kpol_1032.56.14ON68048714880.0
KNAG0E009206.14ON53145614240.0
KAFR0L003606.14ON50247914090.0
Ecym_30186.14ON57547513930.0
Kpol_1045.756.14ON47746213730.0
Suva_15.1786.14ON47641512661e-169
TPHA0M002306.14ON58542012641e-167
Skud_15.1646.14ON48241812481e-166
Smik_15.1726.14ON47841812421e-165
YOR003W (YSP3)6.14ON47841812211e-162
CAGL0E02651g6.14ON48541610561e-137
KAFR0B065506.14ON45641810021e-130
NCAS0D026306.14ON4514219181e-117
NDAI0I022806.14ON4824368381e-105
KNAG0F02970singletonON4204127981e-100
CAGL0L13266gsingletonON5794588082e-99
ZYRO0D08822g6.313ON4903804731e-51
NCAS0D043906.313ON4924374633e-50
Suva_3.846.313ON5273234558e-49
Kpol_1028.616.313ON5183214541e-48
Smik_3.1496.313ON4913164521e-48
TDEL0A072806.313ON4363734445e-48
SAKL0A02002g6.313ON4793654441e-47
YCR045C (RRT12)6.313ON4913934423e-47
Skud_3.1246.313ON5403234435e-47
KNAG0I024706.313ON4754064352e-46
Kpol_1018.56.313ON4653204316e-46
KAFR0J024506.313ON4783604263e-45
TBLA0F039706.313ON7343064357e-45
CAGL0L10802g6.313ON5173404241e-44
KLTH0A06094g6.313ON4963164231e-44
NDAI0I005606.313ON4833954142e-43
Ecym_21056.313ON6103224095e-42
TPHA0D037606.313ON6073194024e-41
AAR069W6.313ON7683273969e-40
Kwal_23.61836.313ON4934113843e-39
KLLA0F06028g6.313ON5083253818e-39
Kwal_33.133721.78ON3773343371e-33
KLTH0F02288g1.78ON3803203061e-29
TBLA0A067006.313ON4972593058e-29
Kpol_2000.691.78ON3863152972e-28
ZYRO0F16764g1.78ON3863292601e-23
TPHA0B045201.78ON3883112335e-20
TDEL0C062301.78ON3643342228e-19
TBLA0A054101.78ON3822801962e-15
Skud_7.10na 1ON566112840.14
SAKL0G00440g2.6ON83663790.56
NCAS0A008802.6ON83366790.66
ZYRO0F15598g2.6ON79063790.68
Skud_14.1012.6ON81967761.4
TBLA0B001302.6ON84259733.1
CAGL0J07546g2.6ON78960733.4
YNL238W (KEX2)2.6ON81464733.5
Suva_14.1062.6ON80964723.9
KAFR0A080402.6ON76663716.1
Smik_14.972.6ON81464708.3
KNAG0A041808.463ON85659699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_5.27
         (608 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...  1030   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   899   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   890   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   866   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   674   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   651   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   641   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   638   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   630   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   621   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   620   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   616   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   580   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   580   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   579   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   577   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   553   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   547   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   541   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   533   0.0  
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   492   e-169
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   491   e-167
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   485   e-166
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   483   e-165
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   474   e-162
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   411   e-137
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   390   e-130
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     358   e-117
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   327   e-105
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              311   e-100
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   315   2e-99
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   186   1e-51
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   182   3e-50
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   179   8e-49
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   179   1e-48
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   178   1e-48
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   175   5e-48
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   175   1e-47
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   174   3e-47
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   175   5e-47
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   172   2e-46
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   170   6e-46
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   168   3e-45
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   172   7e-45
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   167   1e-44
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   167   1e-44
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    164   2e-43
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   162   5e-42
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   159   4e-41
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   157   9e-40
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   152   3e-39
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   151   8e-39
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   134   1e-33
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   122   1e-29
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   122   8e-29
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   119   2e-28
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   104   1e-23
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    94   5e-20
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    90   8e-19
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    80   2e-15
Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON} Y...    37   0.14 
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    35   0.56 
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    35   0.66 
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    35   0.68 
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    34   1.4  
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    33   3.1  
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    33   3.4  
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    33   3.5  
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    32   3.9  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    32   6.1  
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    32   8.3  
KNAG0A04180 Chr1 (567264..569834) [2571 bp, 856 aa] {ON} Anc_8.4...    31   9.9  

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score = 1030 bits (2662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/608 (84%), Positives = 515/608 (84%)

Query: 1   MKLENTLFTLGALGSISAALVIPNLENAADNHELVSKDKDQETSGNLKFASGDXXXXXXX 60
           MKLENTLFTLGALGSISAALVIPNLENAADNHELVSKDKDQETSGNLKFASGD       
Sbjct: 1   MKLENTLFTLGALGSISAALVIPNLENAADNHELVSKDKDQETSGNLKFASGDGEKSIKK 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPHRXXXXXXXXXXXXXXXXXXXXXXX 120
                                             PHR                       
Sbjct: 61  GHSGGGHGGSHRNGHTGGKGTKSEEGESSDDEDKPHRKGGCHDKKKKKGKKGKKVKSKKH 120

Query: 121 XXXTLEKGRPNNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQ 180
              TLEKGRPNNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQ
Sbjct: 121 DGKTLEKGRPNNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQ 180

Query: 181 LQSVENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPL 240
           LQSVENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPL
Sbjct: 181 LQSVENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPL 240

Query: 241 VDFVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG 300
           VDFVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG
Sbjct: 241 VDFVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG 300

Query: 301 VNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 360
           VNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            LRSN
Sbjct: 301 VNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSN 360

Query: 361 GSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420
           GSGTMSDVVKGVEY              GFKGSTANMSLGGGKSPALDLAVNAAVEAGIH
Sbjct: 361 GSGTMSDVVKGVEYAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420

Query: 421 FAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 480
           FAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG
Sbjct: 421 FAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 480

Query: 481 SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKD 540
           SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKD
Sbjct: 481 SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKD 540

Query: 541 ILFDIPEDTPNFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEFIGSKTDLLFEQVRD 600
           ILFDIPEDTPNFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEFIGSKTDLLFEQVRD
Sbjct: 541 ILFDIPEDTPNFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEFIGSKTDLLFEQVRD 600

Query: 601 VLDKLNII 608
           VLDKLNII
Sbjct: 601 VLDKLNII 608

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/485 (89%), Positives = 449/485 (92%)

Query: 124 TLEKGRPNNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQS 183
           TLEKGR +N+LAPLVSTAQFNPDAISKIIPNRYI+VFK+G P+EE++FHKE+V QAQLQS
Sbjct: 151 TLEKGRHHNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQS 210

Query: 184 VENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDF 243
           VENLSAEDAFF ST+DT LSTSEAGGIQDSFNIDN+FSGYIGYFTQEI+DLIRQNPLVDF
Sbjct: 211 VENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDF 270

Query: 244 VERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI 303
           VERDS+VEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI
Sbjct: 271 VERDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI 330

Query: 304 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 363
           NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG
Sbjct: 331 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSG 390

Query: 364 TMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAV 423
           TMSDVVKGVEY              GFKGSTANMSLGGGKSPALDLAVNAAVE GIHFAV
Sbjct: 391 TMSDVVKGVEYAAKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAV 450

Query: 424 AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDE 483
           AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD+
Sbjct: 451 AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDD 510

Query: 484 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILF 543
           ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILF
Sbjct: 511 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILF 570

Query: 544 DIPEDTPNFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEFIGSKTDLLFEQVRDVLD 603
           DIPEDTPN LIYNGGGQDLSAFWNDTKKSH SG K ELNMDEFIGSKTDL+F+QVRD+LD
Sbjct: 571 DIPEDTPNVLIYNGGGQDLSAFWNDTKKSHSSGFKQELNMDEFIGSKTDLIFDQVRDILD 630

Query: 604 KLNII 608
           KLNII
Sbjct: 631 KLNII 635

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/53 (69%), Positives = 43/53 (81%)

Query: 1  MKLENTLFTLGALGSISAALVIPNLENAADNHELVSKDKDQETSGNLKFASGD 53
          MKLENTLFTLGALGSISAALVIPNLENAAD+HEL++K+   E    ++F   D
Sbjct: 1  MKLENTLFTLGALGSISAALVIPNLENAADHHELINKEDHHERPRKVEFTKDD 53

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/485 (88%), Positives = 443/485 (91%)

Query: 124 TLEKGRPNNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQS 183
           TLEK R N KLAPLVSTAQF+P A+ KIIPNRYI+VFKKGVP+E  +FHKESVHQAQLQS
Sbjct: 124 TLEKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQS 183

Query: 184 VENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDF 243
           VENLSAEDAFF STRD+ LSTSE GGIQDSFNIDN+FSGYIGYFTQEIIDLIRQNPLVDF
Sbjct: 184 VENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDF 243

Query: 244 VERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI 303
           VERDSVVEAT+FDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVN+
Sbjct: 244 VERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNV 303

Query: 304 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 363
           NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG
Sbjct: 304 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSG 363

Query: 364 TMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAV 423
           TMSDVVKGVEY              GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAV
Sbjct: 364 TMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAV 423

Query: 424 AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDE 483
           AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIGSD+
Sbjct: 424 AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDD 483

Query: 484 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILF 543
           ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFE+GQDSLTPQQLK KLIHYSTKDILF
Sbjct: 484 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILF 543

Query: 544 DIPEDTPNFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEFIGSKTDLLFEQVRDVLD 603
           D+PEDTPN LIYNGGGQDLSAFWNDTKKSH S  K ELNMDEFIGSKTDL+FEQVRDVLD
Sbjct: 544 DVPEDTPNALIYNGGGQDLSAFWNDTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRDVLD 603

Query: 604 KLNII 608
           KLNII
Sbjct: 604 KLNII 608

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (80%)

Query: 1  MKLENTLFTLGALGSISAALVIPNLENAADNHELVSKDKDQETSGNLKFASG 52
          MKLENTL TLGALGSISAALVIPNLE+AAD+HELV +D  QE  G+   A G
Sbjct: 1  MKLENTLLTLGALGSISAALVIPNLEHAADHHELVVEDNHQERVGHAVHAGG 52

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/492 (85%), Positives = 442/492 (89%), Gaps = 8/492 (1%)

Query: 125 LEKGRP-------NNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVH 177
           LEKG+          KLAPLVST QFNPDAI+KIIPNRYI+VFKK VP EE  FH+E+V 
Sbjct: 173 LEKGKEPHGKDHHRGKLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQ 232

Query: 178 QAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQ 237
           QAQLQSVENL+AEDAFF STRD  LS+SEAGGIQDSFNID++FSGYIGYFTQEI+DLIRQ
Sbjct: 233 QAQLQSVENLAAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQ 292

Query: 238 NPLVDFVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVI 297
           NPLVDFVE+DSVVEAT+FDTQNSAPWGLAR+SHRERLNLGSFNKYLYDDDAGRGVTSYVI
Sbjct: 293 NPLVDFVEKDSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVI 352

Query: 298 DTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXL 357
           DTGVN+NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            L
Sbjct: 353 DTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVL 412

Query: 358 RSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEA 417
           RSNGSGTMSDV+KGVEY              GFKGSTANMSLGGGKSPALDLAVNAAVEA
Sbjct: 413 RSNGSGTMSDVLKGVEYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEA 472

Query: 418 GIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILST 477
           GIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSN+GKCVDVFAPGLNILST
Sbjct: 473 GIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILST 532

Query: 478 YIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYS 537
           YIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFE+GQDSLTPQQLKKKLIHYS
Sbjct: 533 YIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYS 592

Query: 538 TKDILFDIPEDTPNFLIYNGGGQDLSAFWNDTKKSH-PSGSKHELNMDEFIGSKTDLLFE 596
           TKDILFDIP+DTPN LIYNGGGQDLSAFWNDTKKSH  SG K ELN+DEFIGSKTDL+FE
Sbjct: 593 TKDILFDIPDDTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEFIGSKTDLIFE 652

Query: 597 QVRDVLDKLNII 608
           QVRDVLDKLNII
Sbjct: 653 QVRDVLDKLNII 664

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (77%)

Query: 1  MKLENTLFTLGALGSISAALVIPNLENAADNHELVSKDKDQETSGNLKF 49
          MKL+NTLFTLGALG ISAALVIPNLE+ AD+ EL+ K+   +   + +F
Sbjct: 1  MKLQNTLFTLGALGGISAALVIPNLEDTADHRELMGKEDHHDGPKHAEF 49

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/495 (68%), Positives = 390/495 (78%), Gaps = 20/495 (4%)

Query: 126 EKGRPNNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVE 185
           EKG    KLAPLVS+ Q  P   + IIP+RYI+VFKK    EE++FHKE + +A  +SV 
Sbjct: 58  EKGE-EVKLAPLVSSPQ--P---ANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVA 111

Query: 186 NLSAEDAFFTSTR---DTY--LSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPL 240
            L ++D+FF +T+   D Y   + S  GGIQ+SF+I N+ +GYIGYFT E++D IR N  
Sbjct: 112 KLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQW 171

Query: 241 VDFVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG 300
           V+F+E+DS+V A+EFDTQN APWGL+RISHRERLNLGSFNKYLYDDDAG+GVTSYVIDTG
Sbjct: 172 VEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTG 231

Query: 301 VNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 360
           +N+NHKDF  RA+WGKT+P NDED DGNGHGTHCAGTIAS+HYG            LRSN
Sbjct: 232 INVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSN 291

Query: 361 GSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420
           GSGTMSDVVKGVE+              GFKGSTANMSLGGGKSPALDLAVNAAV+AGIH
Sbjct: 292 GSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIH 351

Query: 421 FAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 480
           FAVAAGNENQDACNTSPA+A+ AITVGASTLSDDRAYFSNWGKCVD+FAPGLN+LSTYIG
Sbjct: 352 FAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIG 411

Query: 481 SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKD 540
           S+ ATATLSGTSMASPHVAGLLTYFLSLQP SDSEFF+     +TP QLKKKLI YSTKD
Sbjct: 412 SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQ--ASGITPAQLKKKLIAYSTKD 469

Query: 541 ILFDIPEDTPNFLIYNGGGQDLSAFWNDTKKS-HPSGSKH---ELNMDEFIGS---KTDL 593
           +L+++PEDTPN+LIYNGGGQDLS FW  +++     GS     +  + E I S   KTDL
Sbjct: 470 VLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDL 529

Query: 594 LFEQVRDVLDKLNII 608
           LFE+VR V DKLNII
Sbjct: 530 LFEEVRSVFDKLNII 544

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/480 (66%), Positives = 376/480 (78%), Gaps = 13/480 (2%)

Query: 132 NKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAED 191
           +K+   V+     P+A     P+RYIVV K   PEE +  H E++ Q+QLQSV  L+ +D
Sbjct: 95  HKMGEGVAPLSIPPNAF----PHRYIVVLKHSSPEE-IALHMEAITQSQLQSVGELAQDD 149

Query: 192 AFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVE 251
            FF++           GGIQDSF++  + +GY+GYFT  +++LIR++P+VDFVE DS V 
Sbjct: 150 PFFSAQ-----GVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVH 204

Query: 252 ATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKR 311
           A+EFDTQN APWGL+RISHRERLNLGSFNKYL+DD+AG+GVTSYVIDTG+N+ H+DFE R
Sbjct: 205 ASEFDTQNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGR 264

Query: 312 AIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKG 371
           A WGKTIP NDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG+MSDV+KG
Sbjct: 265 AHWGKTIPTNDEDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKG 324

Query: 372 VEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQD 431
           VE+              GFKGSTANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGNENQD
Sbjct: 325 VEFAAQSHQKAVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQD 384

Query: 432 ACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGT 491
           ACNTSPA+A++A+TVGASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIGSD+ATATLSGT
Sbjct: 385 ACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGT 444

Query: 492 SMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPN 551
           SMASPHVAGLLTYFLSLQP SDS+FF+ G   +TP+QLKKKLI YSTKDIL+D+PEDTPN
Sbjct: 445 SMASPHVAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPN 504

Query: 552 FLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEF---IGSKTDLLFEQVRDVLDKLNII 608
            LIYNGGG  L  FW+   K   +    + ++ E    +G+KTD LF+QVRDVLD+LNII
Sbjct: 505 ALIYNGGGHGLKGFWDGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/484 (66%), Positives = 371/484 (76%), Gaps = 16/484 (3%)

Query: 134 LAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAF 193
           L+PLV TA+   DAI    P+RYIVVFK  V  EEV+FH E V +A  QSV  L A DAF
Sbjct: 67  LSPLV-TARNMYDAI----PHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAF 121

Query: 194 FTSTRDT---YLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVV 250
           F +T D     ++TS  GGI DSF+++ +  GYIGYFTQEI+D IR NPLV FVE+DS+V
Sbjct: 122 FEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMV 181

Query: 251 EATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 310
            A EFDTQN APWGL+RISHRE+LNLGSFNKYLYDD AG+GVTSYVIDTG+NI+HKDFE 
Sbjct: 182 YANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEG 241

Query: 311 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVK 370
           RA WGKT+P ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+MSDVVK
Sbjct: 242 RAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVK 301

Query: 371 GVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQ 430
           GVE+              GFKGSTANMSLGGGKSPALD+AVNAAV+AGIHFAVAAGNENQ
Sbjct: 302 GVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQ 361

Query: 431 DACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSG 490
           DACN+SPA+A+ AITVGASTL+DDRAYFSNWGKCVD+FAPGLN+LSTYIGS+ ATATLSG
Sbjct: 362 DACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSG 421

Query: 491 TSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTP 550
           TSMASPHVAGLLTYFLSLQP SDSE+F      +TP QLKKKLI YSTK+ L D+PEDT 
Sbjct: 422 TSMASPHVAGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTKNALGDLPEDTV 480

Query: 551 NFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEF------IGSKTDLLFEQVRDVLDK 604
           N+LIYNGGGQDL  FW    +   + +K      EF      +  KTD L+E++R++ + 
Sbjct: 481 NYLIYNGGGQDLDDFWVKDLEEKVADAKDN-TASEFESIIDALEEKTDGLYEEIREIFEG 539

Query: 605 LNII 608
           LNII
Sbjct: 540 LNII 543

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/492 (65%), Positives = 373/492 (75%), Gaps = 22/492 (4%)

Query: 133 KLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDA 192
           +L+PLVS++          IP+RYIVVFK+ +  EEV+FHK+ V +A LQSV  L +   
Sbjct: 65  ELSPLVSSS-----GKYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHE 119

Query: 193 FFTST------RD-------TYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNP 239
           FFTST      RD       ++ + +  GGIQDSF++  + +GYIGYFT EI+D IR NP
Sbjct: 120 FFTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNP 179

Query: 240 LVDFVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDT 299
           LVDFVE+DSVV A EF TQN APWGL+RISHRE+LNLGSFNKYLYDDDAG+GVTSYVIDT
Sbjct: 180 LVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDT 239

Query: 300 GVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRS 359
           GVN++HKDFE RA WGKTIP ND D DGNGHGTHCAGTIASKHYG            LRS
Sbjct: 240 GVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRS 299

Query: 360 NGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGI 419
           NGSG+MSDVVKGVE+              GFKGSTANMSLGGGKSPALD+AVNAAV+AGI
Sbjct: 300 NGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGI 359

Query: 420 HFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYI 479
           HFAVAAGNENQDACN+SPASA+ A+TVGASTL+DDRAYFSNWGKCVD+FAPGLN+LSTYI
Sbjct: 360 HFAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYI 419

Query: 480 GSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTK 539
           GSD ATATLSGTSMASPHVAGLLTYFLSLQP SDSE+F      +TP QLKKKLI YSTK
Sbjct: 420 GSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTK 478

Query: 540 DILFDIPEDTPNFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEFIGS---KTDLLFE 596
           ++L DIP+DT N+LI+NGGG+ L  FW                ++ FI +   KTD+L+E
Sbjct: 479 NVLGDIPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALEEKTDVLYE 538

Query: 597 QVRDVLDKLNII 608
           ++R+V D +NII
Sbjct: 539 EIREVFDHMNII 550

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/445 (69%), Positives = 359/445 (80%), Gaps = 11/445 (2%)

Query: 131 NNKLAPLVSTAQF--------NPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQ 182
           N K+APLV+   +        N +A S IIPNRYIVVFKK +  EEV+FHKE ++Q QL+
Sbjct: 70  NLKMAPLVTPTPYPVVSGASANSNANSNIIPNRYIVVFKKSILPEEVDFHKELINQIQLE 129

Query: 183 SVENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVD 242
           S   L  +D FF+++     S ++ GGI  +FNI N+ +GY+GYFT E+++LIR NPLV+
Sbjct: 130 SAAKLPKDDKFFSASAIEDESINQ-GGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVE 188

Query: 243 FVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVN 302
           +VE+DS+V+ATEFD QN+APWGLARISHRERLNLGSFNKYLYDDDAG+GVT YVIDTG+N
Sbjct: 189 YVEKDSLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGIN 248

Query: 303 INHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGS 362
             H DF KRA+WGKTIPLND+D+DGNGHGTHCAGTIAS HYG            LRSNGS
Sbjct: 249 TEHNDFNKRAVWGKTIPLNDKDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGS 308

Query: 363 GTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFA 422
           G+MSDV+KGVE+              GFKGSTANMSLGGGKSP LDLAVNAAV+AGIHFA
Sbjct: 309 GSMSDVIKGVEFAAESHIKAAKEKKKGFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFA 368

Query: 423 VAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD 482
           VAAGNENQDACNTSPASA++AITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIG D
Sbjct: 369 VAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDD 428

Query: 483 EATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDIL 542
           +ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFF+  +  LTP Q+KKKLI+YS+KD+L
Sbjct: 429 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTE--LTPAQMKKKLINYSSKDVL 486

Query: 543 FDIPEDTPNFLIYNGGGQDLSAFWN 567
           FD+PE TPN LI+NG G +L   WN
Sbjct: 487 FDLPEGTPNKLIFNGAGGNLDDLWN 511

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/484 (64%), Positives = 366/484 (75%), Gaps = 15/484 (3%)

Query: 134 LAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAF 193
           LAPL +      + I+  IPNRYI+VFKK    +EV FH+E V     +++ +L+  D F
Sbjct: 84  LAPLSTV-----NDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPF 138

Query: 194 FTSTRDTY-----LSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDS 248
           FT+T   +      + S  GGIQDSF+I    SGY+GYFT+E+ID IR++PLV+FVE DS
Sbjct: 139 FTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDS 198

Query: 249 VVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDF 308
           +V +  F+TQNSAPWGLARISHRE+LNLGSFNKYLYDDDAG+GVT+YV+DTGVN+NHKDF
Sbjct: 199 MVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDF 258

Query: 309 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDV 368
           + RA+WGKTIP +D D+DGNGHGTHCAGTI S HYG            LRSNGSGTMSDV
Sbjct: 259 DGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDV 318

Query: 369 VKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNE 428
           VKGVEY              GFKGSTANMSLGGGKSPALDLAVNAAV+AG+HFAVAAGNE
Sbjct: 319 VKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNE 378

Query: 429 NQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATL 488
           NQDACNTSPA+A+ AITVGASTLSD+RAYFSNWGKCVD+F PGLNILSTYIGSD ATATL
Sbjct: 379 NQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATL 438

Query: 489 SGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPED 548
           SGTSMA+PHV GLLTYFLSLQP +DSE+F      +TP QLKKKLI +STK++L D+PED
Sbjct: 439 SGTSMATPHVVGLLTYFLSLQPDADSEYFH-AAGGITPSQLKKKLIDFSTKNVLSDLPED 497

Query: 549 TPNFLIYNGGGQDLSAFW-NDTKKSHPSGSKHELNMDEFIG---SKTDLLFEQVRDVLDK 604
           T N+LIYNGGGQDL   W  D        +  E +++  I    SKTD +F+ VR +LD+
Sbjct: 498 TVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQ 557

Query: 605 LNII 608
            NII
Sbjct: 558 FNII 561

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 1  MKLENTLFTLGALGSISAALVIP--NLENAADNHELVSKD 38
          MK ENTL T+ AL +++ ALVIP  N EN   +  +  KD
Sbjct: 1  MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKD 40

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/475 (65%), Positives = 359/475 (75%), Gaps = 12/475 (2%)

Query: 134 LAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAF 193
           +APL S +  +P     IIP+RYI+ FKK V  EE++FH++S+++ Q QS+  L  +  +
Sbjct: 111 IAPLYSQS-LHP---QNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPY 166

Query: 194 FTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEAT 253
           F S     L       I DSFNI+++  GYIGYFT ++ID IR NPLV FVE+DS V   
Sbjct: 167 FNSVEGLDLQQP----IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNIN 222

Query: 254 EFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAI 313
           EFDTQN APWGLARISHRERLNLGSFNKYL+DD AG GVT+YVIDTGVN+ H DFE RA 
Sbjct: 223 EFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRAS 282

Query: 314 WGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVE 373
           WGKTIP NDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG+MSDV+KGVE
Sbjct: 283 WGKTIPNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVE 342

Query: 374 YXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDAC 433
           Y              GFKGSTANMSLGGGKSP+LDLAVNAAV+AGIHFAVAAGNENQDAC
Sbjct: 343 YATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDAC 402

Query: 434 NTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSM 493
           NTSPASA  AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD+ATATLSGTSM
Sbjct: 403 NTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSM 462

Query: 494 ASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFL 553
           ASPHVAGLL+YFLSLQP  DSEF    +  +TP QLKK+LI Y TKDIL DIPE TPN L
Sbjct: 463 ASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVL 522

Query: 554 IYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEFIGSKTDLLFEQVRDVLDKLNII 608
           ++NG GQDLS FWN +K +    ++   N+D  +G   D+L++Q   +  K+N++
Sbjct: 523 VFNGAGQDLSDFWNISKPADLESNEVYKNLD-LVG---DVLYDQFTGIFKKMNLL 573

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/493 (63%), Positives = 373/493 (75%), Gaps = 20/493 (4%)

Query: 133 KLAPLVSTAQFNPDAIS------KIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVEN 186
           KLAPL+ T  F  D  +      +I+PN+YI+VFK  +  +E+++HKE + + Q QS   
Sbjct: 215 KLAPLI-TPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASR 273

Query: 187 LSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVER 246
           L     FF ST +    +   GGI  SFNI+NI SGY GYFTQE+IDLIR NPLV +VER
Sbjct: 274 LPPHHHFFHSTSEEEEESFRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVER 333

Query: 247 DSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHK 306
           DS+V+ TEF+TQN+APWGL+RISHRERLNLGSFNKYLYDDDAG+GVT +VIDTG+N+NH 
Sbjct: 334 DSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHV 393

Query: 307 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 366
           DF KRAIWGKTIP ND+D+DGNGHGTHCAGTIAS HYG            LRSNGSG+MS
Sbjct: 394 DFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMS 453

Query: 367 DVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 426
           DV+KGVE+               +KGSTANMSLGGGKSP LDLAVNAAVEAGIHF+VAAG
Sbjct: 454 DVIKGVEFAAETHLNNEKNKKD-YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAG 512

Query: 427 NENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DEAT 485
           NENQDACN+SPASA+ AITVGASTLSDDRAYFSNWG+CVDVFAPGLNILSTY+G  ++ T
Sbjct: 513 NENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNT 572

Query: 486 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQD-SLTPQQLKKKLIHYSTKDILFD 544
           ATLSGTSMASPHVAGLLTYFLSLQP S S FF    D  +TP+QLKKKLI YST DIL+D
Sbjct: 573 ATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD 632

Query: 545 IPEDTPNFLIYNGGGQDLSAFWNDT--KKSHPSGSKHE--LNMDEFIGS-----KTDLLF 595
           +P+ TPN LIYNG G D+S  WN    +++H   + HE  +N +  + S     KTDL F
Sbjct: 633 LPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPA-HEDKINFENLVDSDSMSGKTDLFF 691

Query: 596 EQVRDVLDKLNII 608
           +Q+R+V +K+NII
Sbjct: 692 DQIRNVFEKMNII 704

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/472 (62%), Positives = 351/472 (74%), Gaps = 18/472 (3%)

Query: 151 IIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGI 210
           ++P++YIVV KKGV  E V      V  A   ++ +L  E  FF       L     GGI
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPR---GGI 57

Query: 211 QDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISH 270
           +D FNI+++F G IGYF + ++ L+ ++ +V+FVERDSVV A+ FDTQN+APWGLARISH
Sbjct: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117

Query: 271 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 330
           R+RLNLG+FNKYLYD+  G GVT+YVIDTG+N+ H +F+ RA WGKTIPLND D+DGNGH
Sbjct: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177

Query: 331 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGF 390
           GTHCAGTIASKHYG            L+S+GSGTMSDV+KGVEY               F
Sbjct: 178 GTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-F 236

Query: 391 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 450
           KGSTANMSLGGGKSPALD+AVNAAV AGIHFAVAAGNENQDACNTSPASA+KAITVGAST
Sbjct: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296

Query: 451 LSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDEATATLSGTSMASPHVAGLLTYFLSLQ 509
           LSDDRAYFSNWGKCVD+FAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLLTYFLSLQ
Sbjct: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356

Query: 510 PGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPE-DTPNFLIYNGGGQDLSAFWND 568
           P SDSEF++  +  +TP QLKKKLI YSTK++L D+P+ D+PN LIYNG G DL  FWN 
Sbjct: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416

Query: 569 T-----KKSHPSGS-KHELNMD---EFIGSK---TDLLFEQVRDVLDKLNII 608
           T        HP      EL +D   + +G +   TD LF QVR++LDK+NII
Sbjct: 417 TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/483 (60%), Positives = 347/483 (71%), Gaps = 20/483 (4%)

Query: 143 FNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDT-- 200
           F  D +++ IP++YIVVF++GV +EE  FH E V  A  +SV  L  + AFF STR    
Sbjct: 62  FRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENN 121

Query: 201 ---YLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDT 257
                +T   GGI+  F +     GY+GYFT++++ L+R NP V FVE DS+V A++F T
Sbjct: 122 EFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTT 181

Query: 258 QNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKT 317
           QN APWGLAR+SHRE+LN GSFNKYLYDD++G GVTSYVIDTG+NI+H DFE RA+WGKT
Sbjct: 182 QNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKT 241

Query: 318 IPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXX 377
           IP ND D DGNGHGTHCAGTIASK YG            LRSNG+G+MSDV++GVEY   
Sbjct: 242 IPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVK 301

Query: 378 XXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSP 437
                      GFKGSTANMSLGGG+S ALDLAV+AAV+AGIHFAVAAGNENQDACNTSP
Sbjct: 302 AHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSP 361

Query: 438 ASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPH 497
           A++ KAITVGASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIGSD A ATLSGTSMASPH
Sbjct: 362 AASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPH 421

Query: 498 VAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNG 557
           VAGLLTYFLSLQP  DSEF    + +++P+ LKKK+I + TKD L  +P  T N LIYNG
Sbjct: 422 VAGLLTYFLSLQPDGDSEF--RNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNG 479

Query: 558 GGQDLSAFWNDTKKSHPSGSKHELNMDE------------FIGSKTDLLFEQVRDVLDKL 605
           GG DLS FW +  K   SG K     DE             + S TD +F   R +LD++
Sbjct: 480 GGADLSDFWGNKPKK-VSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRM 538

Query: 606 NII 608
           NII
Sbjct: 539 NII 541

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/483 (60%), Positives = 351/483 (72%), Gaps = 12/483 (2%)

Query: 131 NNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAE 190
            ++ APLV      P+    ++ NRYI++FKKGV  +E+ FH+E + Q  LQ V  L  E
Sbjct: 73  QDRFAPLVV-----PEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEE 127

Query: 191 DAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVV 250
            +FF   R   +  S  GGI  +F+I+ +  GY GYF  +++D+IR +PL++ VE+DSVV
Sbjct: 128 HSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVV 187

Query: 251 EATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 310
              + DT+N APWGLARISHRERLNLGS+NKYLYD+  G GVTSYVIDTGVN++H  F  
Sbjct: 188 YTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGG 247

Query: 311 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVK 370
           RA WGKTIP  D D DGNGHGTHCAGTI S  YG            LRSNGSG+MSDV+K
Sbjct: 248 RAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLK 307

Query: 371 GVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQ 430
           GVE+              GFKGSTANMSLGGGKSP+LD AVNAAV AG++FAVAAGNE+Q
Sbjct: 308 GVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQ 367

Query: 431 DACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSG 490
           DACNTSPASA   ITVGASTLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSD +TATLSG
Sbjct: 368 DACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSG 427

Query: 491 TSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTP 550
           TSMASPHVAGLL YFLSLQPGSDSE F+ G  S++P QLKKKL+ +STKD+L DIP  TP
Sbjct: 428 TSMASPHVAGLLAYFLSLQPGSDSE-FDAGS-SISPDQLKKKLLAFSTKDVLSDIPSGTP 485

Query: 551 NFLIYNGGGQDLSAFW--NDTKKSHPSGSKHELNMDEFI---GSKTDLLFEQVRDVLDKL 605
           N LIYNGGG DLS FW   +  +      K +L + + +   GSKTD +F Q+R ++D+L
Sbjct: 486 NLLIYNGGGGDLSGFWGSKEVAQELEFNEKVDLELHDLVDELGSKTDAVFGQIRGLMDRL 545

Query: 606 NII 608
           +II
Sbjct: 546 DII 548

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/487 (58%), Positives = 359/487 (73%), Gaps = 20/487 (4%)

Query: 126 EKGRPNNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVE 185
           EK     K APL S      + +  +IPN+YI+VFKK V  +++  HK+ + +AQ Q   
Sbjct: 208 EKSGEKVKYAPLHSMENTKYENL--VIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQ--- 262

Query: 186 NLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVE 245
                   + S  D   S+S  GGI+++FN+ N+F GYIG+F ++++  IR +P+VDFVE
Sbjct: 263 --------YASVSDE-TSSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVE 313

Query: 246 RDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINH 305
           +DS+V A E DTQN+APWGLARISHR+ LNLGS+NKYLYDD AG GVT+YVIDTG+NI H
Sbjct: 314 QDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKH 373

Query: 306 KDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTM 365
           K+F  RA+WGKTIP ND+D+DGNGHGTHCAGTIASK+YG            LRS+GSGTM
Sbjct: 374 KEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTM 433

Query: 366 SDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAA 425
           SDV+KGVEY              GFKGSTANMSLGGGKS +LDLAV+AAV++GIHFAVAA
Sbjct: 434 SDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAA 493

Query: 426 GNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEAT 485
           GNENQDACN+SPA+++ AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEAT
Sbjct: 494 GNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEAT 553

Query: 486 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDI 545
           ATLSGTSMASPHVAGLL+YFLS+QP +DSEFF  G +S++P QLKKKLI YSTK++  D+
Sbjct: 554 ATLSGTSMASPHVAGLLSYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDL 613

Query: 546 PEDTPNFLIYNGGGQDLSAFWNDTKKS--HPSGSKHELNMDEFIGSK---TDLLFEQVRD 600
           PE TPN L+YN  G ++S FW    +S   P+    E  +++ + S     D     ++ 
Sbjct: 614 PEKTPNLLVYN-AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQ 672

Query: 601 VLDKLNI 607
           V +++++
Sbjct: 673 VFERMDL 679

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (64%)

Query: 1  MKLENTLFTLGALGSISAALVIPNLENAADNHELVSK 37
          MKL+ TL ++  L ++ ++LVIP      D+ +L++K
Sbjct: 1  MKLDKTLVSVATLATLGSSLVIPEFARDLDDKKLLAK 37

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/456 (60%), Positives = 336/456 (73%), Gaps = 21/456 (4%)

Query: 154 NRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGIQDS 213
           N+YI++FK+GV  E+++ HK+ + Q  L++  ++SA+                   + DS
Sbjct: 96  NKYIILFKEGVTAEQISAHKQLLQQVLLET-SDVSAQGI--------------VADVLDS 140

Query: 214 FNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISHRER 273
           F+++ + SGY+   +  +++L+R++P V  VE+DS V   EFDTQN+APWGLARISHR+ 
Sbjct: 141 FDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDP 200

Query: 274 LNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTH 333
           L+LGSFNKYLYDD AG GV SY+IDTG+N+ HK+FE RA WGKTIP ND D DGNGHGTH
Sbjct: 201 LSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTH 260

Query: 334 CAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGS 393
           CAGTIASKHYG            LRSNGSG+MSDV+ GVE+               FKGS
Sbjct: 261 CAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGS 320

Query: 394 TANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSD 453
           TANMSLGGGKSP+LD  V+AAV+ G+HF+VAAGNENQDACNTSPA++++AITVGASTLSD
Sbjct: 321 TANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSD 380

Query: 454 DRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSD 513
           DRAYFSNWG CVD+FAPGLNILSTY GSD+ATATLSGTSMASPHVAGLLTYFLSLQP   
Sbjct: 381 DRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKS 440

Query: 514 SEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFWNDT-KKS 572
           S+F    Q  +TP+QLKKKL+ YSTK +LFD+PEDTPN LIYNGGG DLS FW D  KKS
Sbjct: 441 SQFGTSAQ--ITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKS 498

Query: 573 HPSGSKHELNMDEFIGSKTDLLFEQVRDVLDKLNII 608
           H     HE +    + + +D +FEQVR +  KLNI 
Sbjct: 499 HKPLFAHEYDN---VWASSDAMFEQVRAMFGKLNIF 531

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/479 (58%), Positives = 341/479 (71%), Gaps = 30/479 (6%)

Query: 134 LAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAF 193
           LAP+      N DA   IIP+RYI+VFK GV +E++ FHKE +    LQ     S +   
Sbjct: 46  LAPV-----HNADA-ENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSND--- 96

Query: 194 FTSTRDTYLSTSEA-----GGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDS 248
           FT    T ++  E+     GGI   F+I ++ SGYI Y + E++  IR NPL+ F+E D+
Sbjct: 97  FTEYLQTDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDT 156

Query: 249 VVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDF 308
           +V  T+F+TQN+APWGLARISHRE LNL +FNKYLYDDDAG+ V +YVIDTGV++NH +F
Sbjct: 157 MVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEF 216

Query: 309 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDV 368
             RA WGKTIPLND+D+DGNGHGTH AGTI S+HYG            LRSNGSG+MSDV
Sbjct: 217 HSRAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDV 276

Query: 369 VKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNE 428
           VKGVE+                KGS ANMSLGGGKSPALDLAVNAAV+AGIHFAVAAGNE
Sbjct: 277 VKGVEF-AVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 335

Query: 429 NQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DEATAT 487
           NQ+ACN+SPASA++A+TVGAST+SD+RAYFSNWG+CVD+FAPGLNILSTYIG+ D+ TAT
Sbjct: 336 NQNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTAT 395

Query: 488 LSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPE 547
           LSGTSMASPHVAGLL Y+LSLQP   SEF      +++  QLKKKLI Y+TKD+L D+PE
Sbjct: 396 LSGTSMASPHVAGLLAYYLSLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPE 452

Query: 548 DTPNFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEFIGSKTDLLFEQVRDVLDKLN 606
            TPN LIYNGGGQDLS FWN      P  +        +IG      F +++ + D LN
Sbjct: 453 GTPNVLIYNGGGQDLSDFWNLQNSKIPGSN--------YIGYN---YFSKLKTLFDDLN 500

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/475 (57%), Positives = 341/475 (71%), Gaps = 20/475 (4%)

Query: 149 SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYL----ST 204
           S+ IP+RYIV+FK GV + +V  H++ V  A ++++  L    +FF +T   +     + 
Sbjct: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165

Query: 205 SEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWG 264
           S  GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DS+V A++F+TQ  APWG
Sbjct: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225

Query: 265 LARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED 324
           LAR+SHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+NI+H +FE RA WGKTIP ND D
Sbjct: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285

Query: 325 LDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXX 384
            DGNGHGTHCAGTIASK YG            LR+NG+GTMSDV++GVEY          
Sbjct: 286 YDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASG 345

Query: 385 XXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAI 444
                FKGSTANMSLGGGKS AL+LAV+AAV AGIHFAVAAGNENQDACNTSPAS+ K I
Sbjct: 346 DPN--FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403

Query: 445 TVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTY 504
           TV ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL Y
Sbjct: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463

Query: 505 FLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSA 564
           FLSLQP S SE++     S++P+ LKKK++ Y +K++L ++P  T N LI+NGGG  L +
Sbjct: 464 FLSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521

Query: 565 FWN---DTKKSHPSGSKHELNMDEF--------IGSKTDLLFEQVRDVLDKLNII 608
           FWN   D  +     S H    D+F        + S +  LF ++R+ LD+L++I
Sbjct: 522 FWNSKCDGCEQEKVSSSHG-KADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/462 (57%), Positives = 331/462 (71%), Gaps = 20/462 (4%)

Query: 149 SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFT-STRDTYLSTSEA 207
           S++IP  YIVVF +GV + E++ H E++ Q QLQSV +L  +  FFT ST     S    
Sbjct: 32  SEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLL 91

Query: 208 GGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLAR 267
           GG++D F I N   GY G FT E+++ +R +PLV F+ERDS+V  TE  TQ +APWGLAR
Sbjct: 92  GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLAR 151

Query: 268 ISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDG 327
           ISHR RLNL +FNKYLYDD  G+GV +YVIDTG+NI + DF  RA WGKTIP  + ++DG
Sbjct: 152 ISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDG 211

Query: 328 NGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXX 387
           NGHGTH AGTIAS HYG            LRSNG+G+MSDV+KGVEY             
Sbjct: 212 NGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAHQRDVGTA- 270

Query: 388 XGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVG 447
            GFKGS ANMSLGGGKS +LDLAVNAAV AG+HFAVAAGNENQDACNTSPA+A++AITVG
Sbjct: 271 -GFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITVG 329

Query: 448 ASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLS 507
           ASTLSD RAYFSNWG+CV +FAPGLNILSTYIGS +ATATLSGTSMASPH+AGL+ YFLS
Sbjct: 330 ASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLS 389

Query: 508 LQPGSDSEFFELGQ-DSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566
           LQP   S+F+  GQ  ++TP QLKKK++ + TK+ L D+P +TPN + YNG G+ L  FW
Sbjct: 390 LQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFW 449

Query: 567 NDTKKSHPSGSKHELNMDEFIGSKTDLLF-EQVRDVLDKLNI 607
                          N ++++ +   L+  EQ++ +L+K+NI
Sbjct: 450 ---------------NANDYVKNYQSLVITEQLQFILNKMNI 476

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  492 bits (1266), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 235/415 (56%), Positives = 304/415 (73%), Gaps = 5/415 (1%)

Query: 152 IPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGIQ 211
           +P RYI+ F +      +  HK  + + Q +SV  L+ +DAFF ST  +  S  + GGI 
Sbjct: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST--SAPSDLQFGGID 124

Query: 212 DSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISHR 271
             F+I+ +F GY GYFT+E+I  + Q+P++ F+E++S V+ T    Q  APWGL RISHR
Sbjct: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184

Query: 272 ERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHG 331
           E+   G   +YLY+D AGRGVTSYV+DTG++INH+DFE RA+WG  IP NDE  D NGHG
Sbjct: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244

Query: 332 THCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFK 391
           THCAG I S+H+G            LRSNG GT+SDV+KG+EY               FK
Sbjct: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGPKFK 304

Query: 392 GSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTL 451
           GSTAN+SLG  KSPA+++AVNAAVE+G+HFA+AAGNE++DAC +SPA A+K+ITVGAST 
Sbjct: 305 GSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364

Query: 452 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPG 511
           SDDRA+FS+WG CVDVFAPG+NILSTYIGS  A+ +LSGTSMA+PHVAG+L+YFLSLQP 
Sbjct: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424

Query: 512 SDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566
           SDSEFF+    +++PQQLK+K+I++ST+ +L D+ EDTPN LIYNGGG+ L  FW
Sbjct: 425 SDSEFFD---STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  491 bits (1264), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 254/420 (60%), Positives = 314/420 (74%), Gaps = 16/420 (3%)

Query: 154 NRYIVVFKKGVPEEEVNFHKESVHQA-QLQSVENLSAEDAFFTSTRDTYLSTSEAGGIQD 212
           +RYI+VFKKGV +E+V+ H + +    +  S E   A     ++ RD +        + D
Sbjct: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGF------DRVMD 187

Query: 213 SFNIDNIFSGYIGYF-TQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISHR 271
           +F +   FSGYI    + +I+D IR NPLVD+VE+DSVV + + +TQN+APWGLARISHR
Sbjct: 188 TFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHR 246

Query: 272 ERLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 330
           E LNLG+FNKYLY  + AG+GVT+YV+DTG++++H +F +RA WGKTIP+ND D+DGNGH
Sbjct: 247 EGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGH 306

Query: 331 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXX----XXXXX 386
           GTHCAGTI S+HYG            LRS+GSGTMSDV+KGVE+                
Sbjct: 307 GTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDK 366

Query: 387 XXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITV 446
              +KG+TANMSLGGGKSPALD AVNAAV+AG+HFAVAAGNENQDACN+SPA+A+ AITV
Sbjct: 367 NSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITV 426

Query: 447 GASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFL 506
           GASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIG+++ATATLSGTSMASPHVAGLLTY L
Sbjct: 427 GASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLL 486

Query: 507 SLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566
           SLQP   SEF+ +    LTP Q+KKK+I Y+TK+ L D+P DTPN LIYNGG    + FW
Sbjct: 487 SLQPDKGSEFY-VPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS-TDFW 544

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  485 bits (1248), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 228/418 (54%), Positives = 297/418 (71%), Gaps = 3/418 (0%)

Query: 149 SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAG 208
           SK +P RYI+VF + +    +  H + + +AQ  SV  ++ +D+F  +   +     + G
Sbjct: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 125

Query: 209 GIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARI 268
           GI  SF+I+ +F GY GYFT E+I+++ Q+PLV F+E +S V  +    Q  APWGL RI
Sbjct: 126 GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRI 185

Query: 269 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 328
           SHRER   G   +YLY+D AG GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 186 SHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLN 245

Query: 329 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXX 388
           GHGTHCAG I S+H+G            LRSNG GT+SDV+KG+EY              
Sbjct: 246 GHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRGS 305

Query: 389 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 448
            FKGSTAN+SLG  KSPA+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 306 KFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 365

Query: 449 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 508
           ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+L+Y LSL
Sbjct: 366 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 425

Query: 509 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566
           QP  DSEFF    D+++PQQLK+K++ +ST+ +L D+ E+TPN L+YNGGG+ L  FW
Sbjct: 426 QPAQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  483 bits (1242), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 229/418 (54%), Positives = 299/418 (71%), Gaps = 3/418 (0%)

Query: 149 SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAG 208
           +++IP RYIVVF + +  + +  H++ V +A   SV  L+ +D F      +     + G
Sbjct: 64  TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLG 123

Query: 209 GIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARI 268
           GI  SF+I+ +F GY GYFT EI++L+ Q+PL+ F+E++S V  +    Q  APWGL RI
Sbjct: 124 GIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRI 183

Query: 269 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 328
           SHRE+   G   +YLY+D AGRGVTSYV+DTG++  H+DFE RA+WG  IP NDE  D N
Sbjct: 184 SHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLN 243

Query: 329 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXX 388
           GHGTHCAG I SKHYG            LRSNG GT+SDV+KG+EY              
Sbjct: 244 GHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSK 303

Query: 389 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 448
            FKGSTAN+SLG  KS A+++AV+AAV++G+HFA+AAGNEN+DAC +SPA A K+ITVGA
Sbjct: 304 EFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGA 363

Query: 449 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 508
           ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMA+PHVAG+L+YFLSL
Sbjct: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSL 423

Query: 509 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566
           QP  DSE+F+   ++L+PQ+LK+K++ +ST  +L DI ++TPN LIYNGGG+ L   W
Sbjct: 424 QPAPDSEYFD---NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  474 bits (1221), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 228/418 (54%), Positives = 300/418 (71%), Gaps = 3/418 (0%)

Query: 149 SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAG 208
           ++ +P RY++VF + +  +++  H + V +    SV  L+  DAF+     +  S S+ G
Sbjct: 64  TEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKSQFG 123

Query: 209 GIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARI 268
           GI + F+I+ +F GY GYFT EII +I Q+P++ FVE+++ V+ +    Q  APWGL R+
Sbjct: 124 GIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLHRV 183

Query: 269 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 328
           SHRE+   G   +YLY+D AG+GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 184 SHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLN 243

Query: 329 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXX 388
           GHGTHCAG I SKH+G            LRSNG GT+SDV+KG+EY              
Sbjct: 244 GHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNK 303

Query: 389 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 448
            FKGSTAN+SLG  KS A+++AVNAAV++G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 304 EFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 363

Query: 449 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 508
           ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS  AT +LSGTSMASPHVAG+L+YFLSL
Sbjct: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSL 423

Query: 509 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566
           QP  DSEFF    D+ +PQ+LK+K++ +ST+ +L DI +DTPN LIYNGGG+ L  FW
Sbjct: 424 QPAPDSEFF---NDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  411 bits (1056), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 213/416 (51%), Positives = 277/416 (66%), Gaps = 5/416 (1%)

Query: 151 IIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGI 210
           IIPNRYIV+FK  V ++E+  H  ++ +    S+     +  F  +T+   +ST    G+
Sbjct: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDIST-RGIGL 129

Query: 211 QDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISH 270
           Q  F+I    +GYIGYFT+     I  +PLV+ VE DS+V    +  Q   PWGL RIS 
Sbjct: 130 QHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQ 189

Query: 271 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 330
           RE+L +     Y YDD  G+   ++VIDTG+ ++H+DFE RA WGKTI  ND D D NGH
Sbjct: 190 REKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGH 249

Query: 331 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGF 390
           GTHCAGTIASKHYG            LRS+GSG+MSDV++GVEY                
Sbjct: 250 GTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEY-TVEAYNDLKKTKSNL 308

Query: 391 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 450
           KG+  NMSLG  KS AL+ A++AA  AGI FAVAAGNE+ DACN+SPASA   ITVG ST
Sbjct: 309 KGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGGST 368

Query: 451 LSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQP 510
           LSDD A+FSN+G+CVD+FAPG+NI+STYIGS  AT +LSGTSM+SPHVAG+L Y+LSLQP
Sbjct: 369 LSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQP 428

Query: 511 GSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFW 566
              S+F+     +++P+ LKKK+++Y+T   L  +P +T N L+YNGGG++LS FW
Sbjct: 429 DHKSQFYH-EHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  390 bits (1002), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 200/418 (47%), Positives = 262/418 (62%), Gaps = 21/418 (5%)

Query: 151 IIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGI 210
           II ++YIV+FK      E   H         + ++N     ++    +D + S       
Sbjct: 59  IIKDQYIVIFKNSAMMAEKELH--------FKQLKNFIKTYSYEWDEKDDHKSN------ 104

Query: 211 QDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISH 270
            + F I    SGYI     E + L+RQ+P+V  +E DS V A +   Q   PWGL+RIS 
Sbjct: 105 LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164

Query: 271 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 330
           R R+ +G    Y YDD     VT+YV+DTG+ I+H+ F  RA WGKTI  ND D D +GH
Sbjct: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224

Query: 331 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGF 390
           GTH AG IAS  +G            LRSNG G MSDV+KG+E+                
Sbjct: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYS---- 280

Query: 391 KGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAST 450
           KGS  N+SLG  KSPAL LA++AA+   IHFAVAAGNEN DAC TSPA A +AITVGAS 
Sbjct: 281 KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340

Query: 451 LSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQP 510
            SD+RA+FSNWG+CVDVFAPG+N++STYIGSD AT +LSGTS A+P+ AGL+ Y+LSLQP
Sbjct: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQP 400

Query: 511 GSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFWND 568
             DS +F      +TP +LK+K++ + +KD+L+++PE+TPN +IYNG G++LS FW D
Sbjct: 401 DKDSGYF---TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKD 455

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  358 bits (918), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 194/421 (46%), Positives = 251/421 (59%), Gaps = 26/421 (6%)

Query: 152 IPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGIQ 211
           IPN+YIV+FK     +  +  +E+ H A L S                  L+T     I 
Sbjct: 53  IPNQYIVLFKS----DTTDIQRET-HLATLNS----------------WLLNTDPQYTIL 91

Query: 212 DSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISHR 271
            SF + +   GY     +++I  +  +P++  +E+DS V A     Q  +PWGLARIS R
Sbjct: 92  HSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQR 151

Query: 272 ERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHKDFEKRAIWGKTI-PLNDEDLDGNG 329
           ERL L     Y YDD  A      Y++DTG+N NH +F+ RA WG    P+     D NG
Sbjct: 152 ERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENG 211

Query: 330 HGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXX-XX 388
           HGTHCAG I S  YG            L + G G MS V++G+EY               
Sbjct: 212 HGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQT 271

Query: 389 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 448
           GFKGS  N+SLG GKSPAL   + AAV+ G+HFAVAAGNE+ DAC+TSPA +  A+TVGA
Sbjct: 272 GFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGA 331

Query: 449 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DEATATLSGTSMASPHVAGLLTYFLS 507
           S+ SDDR +FSNWG CVDVFAPG+NI+STYIG  +  T +LSGTSM++P V GL+ YFLS
Sbjct: 332 SSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLS 391

Query: 508 LQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFWN 567
           LQP + S+F+  G  S TP QLK K+I +ST+ +L +IPE TPN ++YNGGG  L  FWN
Sbjct: 392 LQPDTKSQFYT-GITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450

Query: 568 D 568
           +
Sbjct: 451 N 451

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  327 bits (838), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/436 (44%), Positives = 261/436 (59%), Gaps = 34/436 (7%)

Query: 152 IPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGIQ 211
           IP++YIV+F+    + +++  +        Q + +L  ED    +  D Y        + 
Sbjct: 63  IPDQYIVLFENDTTDLQISRFE--------QFLSSLIEEDNQKYNVNDNY------SKVL 108

Query: 212 DSFNIDN-----IFSGYIGYFTQEIID-LIRQNPLVDFVERDSVVEATEFDTQNSAPWGL 265
             F I N     I    I  F +++ + +     ++  +ERDS V   +F TQ  + WGL
Sbjct: 109 SRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGL 168

Query: 266 ARISHRERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED 324
           +RIS R  L L     Y YDD+ +G+GV  Y++DTG+N NH +FE RA WG ++P+ +  
Sbjct: 169 SRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPS 228

Query: 325 L-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXX 383
           L D NGHGTHCAG I SK YG            L   G G+MSDV+ G+E+         
Sbjct: 229 LEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKT 288

Query: 384 XXXXXG------FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSP 437
                       FKGS  N+SLG  KSP+LD+A+ +A + GIH  VAAGNE++DAC TSP
Sbjct: 289 NNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSP 348

Query: 438 ASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDEATATLSGTSMASP 496
           A +   ITVGAS+ SDDRA+FSNWG CVDVFAPG+NI STYIG ++  T +LSG+SM+SP
Sbjct: 349 ADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSP 408

Query: 497 HVAGLLTYFLSLQPGSDSEFFELGQDSL-TPQQLKKKLIHYSTKDILFDIPEDTPNFLIY 555
            V+GL  Y+LSLQP   S+F     DSL TP QLK+K+I +ST  +L ++P DT N L+Y
Sbjct: 409 FVSGLTAYYLSLQPDVSSQF----HDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVY 464

Query: 556 NGGGQDLSAFWNDTKK 571
           NGGG+DLS FWN T+K
Sbjct: 465 NGGGKDLSGFWNATRK 480

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  311 bits (798), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 168/412 (40%), Positives = 239/412 (58%), Gaps = 32/412 (7%)

Query: 175 SVHQAQLQSVENLSAEDAFFTSTRDTYLS-------------------TSEAGGIQ---- 211
           +V+ A +  + +LS E  FF S + T L+                   +  AG       
Sbjct: 15  AVYGAAVPPLADLSGEHRFFMSGKSTILNEFLVMFKPMVDREEVEVGLSVLAGRFPLAQF 74

Query: 212 DSFNIDNIFSGY-IGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISH 270
           + F+I +   G+ +  F    +  + Q P V+ VE +S V A     Q   PWGL R+S 
Sbjct: 75  EQFHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQ 134

Query: 271 RERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNG 329
           R+R+ +G    Y YD   + + V  Y++DTG+ ++H++FE RA WGKTI  ND D D NG
Sbjct: 135 RDRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNG 194

Query: 330 HGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXG 389
           HGTHCAG +    YG            L + G G MSDV++G+E+               
Sbjct: 195 HGTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLTRNQDE--- 251

Query: 390 FKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGAS 449
            +GS  N+SLG G+SPAL   V AA+  G+HFAVAAGNE+ +AC +SPA+ D  +TVG S
Sbjct: 252 VRGSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGS 311

Query: 450 TLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDE-ATATLSGTSMASPHVAGLLTYFLSL 508
           T SDDRA+FSNWG C+DVFAPG+N+ S+Y+G+ +  T +LSGTS ++PHVAGL+ Y LSL
Sbjct: 312 TFSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSL 371

Query: 509 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQ 560
           +P + S+F     +   P QLK+KL+  +T+  LF++P+DT N +I+NG  Q
Sbjct: 372 EPDTKSQFHTAWSN---PAQLKQKLVSLATEGKLFEVPDDTANLMIFNGVKQ 420

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  315 bits (808), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 170/458 (37%), Positives = 264/458 (57%), Gaps = 16/458 (3%)

Query: 129 RPNNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLS 188
           RP N  APLV+    N +  + I+P RYIV+FK      E+  H ++V + QL+   +L+
Sbjct: 46  RPGNVKAPLVAPLGENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLA 105

Query: 189 AEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDS 248
             D FF  TRD   ST E GG+  +F+I + F+GY+GYFT E+++ IR+  +VD+VE DS
Sbjct: 106 PNDPFFHHTRDKEFSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDS 165

Query: 249 VVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDF 308
           ++   + +T +++ W LARISHR +L L +FN+Y +D + G+ + +Y++DTGV   H  +
Sbjct: 166 ILTIDDKETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYY 225

Query: 309 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDV 368
            +R I G  I  N+++ D NGHGT  AG +  +  G            L   G GT+S++
Sbjct: 226 IERTIRGIVITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNI 285

Query: 369 VKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNE 428
           +KG+ +              G  G+    S+ G KS +L+ A +  V +GIH  V AG +
Sbjct: 286 IKGLSF--VNHHHPQRIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTK 343

Query: 429 NQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATAT- 487
             +ACN+SPAS+ K ITV   +++D+     NWG CVD++ PG  + +TY   +    T 
Sbjct: 344 GINACNSSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTN 403

Query: 488 ---LSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQD---SLTPQQLKKKLIHYSTKDI 541
              ++G+S A+  VAGLL YF SLQPG       LG      LTP++LK++LI + TK  
Sbjct: 404 EISVTGSSAAAAQVAGLLAYFASLQPG-------LGTPDVIPLTPEELKERLIDFGTKGK 456

Query: 542 LFDIPEDTPNFLIYNGGGQDLSAFWNDTKKSHPSGSKH 579
           L ++   +PN + +NG G +L +F+ND  +  P+ +K+
Sbjct: 457 LTNLERMSPNIIAFNGAGGNLDSFFNDGSEIVPTATKN 494

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  186 bits (473), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 132/380 (34%), Positives = 176/380 (46%), Gaps = 64/380 (16%)

Query: 220 FSGYIGYFTQEIIDLIRQNPLV-------DFVERDSVVEATEFD---------------- 256
           F G     +Q++++ IR NPLV        F   D V+   E                  
Sbjct: 61  FRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGFNP 120

Query: 257 ----TQNSAPWGLARISHRERLNLG---------SFNKYLYDDDAGRGVTSYVIDTGVNI 303
                Q  AP  LAR+S R  L            SFN Y Y    GR + +Y+IDTG+  
Sbjct: 121 FKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYK 180

Query: 304 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 363
            HKDF  RAI+G+     +   D NGHGTH AG + S ++G            L + G G
Sbjct: 181 EHKDFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQG 239

Query: 364 TMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAV 423
            ++ V+  VE+              G KG  AN+SLG  ++  ++ A+ AA EAG+   V
Sbjct: 240 NLTTVISAVEFAVNHCKSS------GKKGCVANLSLGAVRNSVINQAIKAAHEAGLIIVV 293

Query: 424 AAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD 482
           AAGN N +AC  SPASA +AITVGA    +D  A FSNWG CVD+FA G+ + S      
Sbjct: 294 AAGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPP 353

Query: 483 EATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDI- 541
                 SGTSMASP V GL+   L                 + P+ +K KL+  +T D+ 
Sbjct: 354 HKPIAFSGTSMASPSVTGLVAILL--------------DKGVEPENIKAKLVELATHDLL 399

Query: 542 ----LFDIPEDTPNFLIYNG 557
               LF  P  TPN + +NG
Sbjct: 400 QRRTLFFKP-GTPNRIAFNG 418

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  182 bits (463), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 153/437 (35%), Positives = 216/437 (49%), Gaps = 76/437 (17%)

Query: 169 VNFHKESVH-QAQLQSVENLSAEDAFFTSTRDTYLSTSE--AGGIQDSFNIDNIFSGYIG 225
           + F +E ++ +  L S++   +  +F  ST     S  E     I  +F+I + F G+  
Sbjct: 14  ITFLQEPIYGREYLVSLKQNDSIQSFMDSTITRGRSVKEYLRDKIGKTFSIGS-FKGFTV 72

Query: 226 YFTQEIIDLIRQNPLVDFVERDSVVEATE-------------FD-----------TQNSA 261
             T ++++ I++NPLV  V  +  V A E             FD            Q  A
Sbjct: 73  DLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKCSVKVQYGA 132

Query: 262 PWGLARISHRERL---------NLGSFNKYLYDDDA-GRGVTSYVIDTGVNINHKDFEKR 311
           P  LAR+S R++L          L S  KY YD  + G  V +Y+ID+G+ + H++F  R
Sbjct: 133 PRHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGASVNAYIIDSGIYLEHEEFNGR 191

Query: 312 AIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVK 370
           AI G  I L  E   D NGHGTH AG + SK YG            L   G G+++ V+ 
Sbjct: 192 AIPG--IDLTGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSLAMVLG 249

Query: 371 GVEYXXXXXXXXXXXXXXGFKG-STANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNEN 429
           G+E+                KG   AN+SLG  ++  L+ A+ AA++AG+   VAAGN N
Sbjct: 250 GIEFAVKHCQETSK------KGRCVANLSLGSMRTAILNKAIKAAIDAGLVVVVAAGNNN 303

Query: 430 QDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSDEAT 485
            +AC  SPASA +AITVGA    DDR    A FSNWG+C+D+FAPG+ I S  I  D+  
Sbjct: 304 LNACWYSPASAPEAITVGAF---DDRIDAIAKFSNWGQCLDIFAPGVVIKSLSIFKDKED 360

Query: 486 ATLSGTSMASPHVAGLLTYFLSLQPGSDSE-----FFELGQDSLTPQQLKKKLIHYSTKD 540
            T SGTSMASP VAGL    L+L  G  +E       E+G D++           +  + 
Sbjct: 361 VTYSGTSMASPTVAGLAA--LTLDQGVSAEEVKDYILEMGTDNV-----------FHRRS 407

Query: 541 ILFDIPEDTPNFLIYNG 557
           +LF     TPN + +NG
Sbjct: 408 LLF--KPGTPNKICFNG 422

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  179 bits (455), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 120/323 (37%), Positives = 165/323 (51%), Gaps = 36/323 (11%)

Query: 251 EATEFDTQNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGV 301
           EA     Q  AP  LARIS   +L             FN Y  D+  G+GV +Y++DTG+
Sbjct: 154 EAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGI 213

Query: 302 NINHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 360
           +  H +FE R I G  + L  E   D NGHGTH AG + S+ +G            L  +
Sbjct: 214 HAEHPEFEDRVIQG--VDLTKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKD 271

Query: 361 GSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420
           GSG  S+V+ G+E+                K   AN+SLG  +SP +++AV  A+E GI 
Sbjct: 272 GSGEASNVLSGLEFIVEHCTKVSRPQG---KKCVANLSLGSFRSPIINMAVEGAIEEGIV 328

Query: 421 FAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYI 479
           F  AAGN N DA   SPASA+  ITVGA     D  A FSNWG CV++FAPG+ I S   
Sbjct: 329 FVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSH 388

Query: 480 GSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTK 539
            +D  +  LSGTSM++P V G+    LS                + P+ + +++ + ST+
Sbjct: 389 LNDNESLVLSGTSMSTPIVTGVAAVLLS--------------KGIEPELIAQEIEYLSTR 434

Query: 540 DI-----LFDIPEDTPNFLIYNG 557
           ++     LF  P  TPN ++YNG
Sbjct: 435 NVFHRRTLFFKP-STPNQILYNG 456

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  179 bits (454), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 124/321 (38%), Positives = 158/321 (49%), Gaps = 40/321 (12%)

Query: 256 DTQNSAPWGLARISHRERL--------NLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHK 306
           + Q  AP  L RIS R +L            F  Y Y+D   G  + +Y++DTG+   H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 307 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 366
           DFE R I G  +   +   D NGHGTH AG + SK +G            L   GSG ++
Sbjct: 212 DFENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 367 DVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 426
            V+ G+++                K   ANMSLG  ++  ++ A++ A +AG+   VAAG
Sbjct: 271 TVLSGIQFAVDHCRLMRETQG---KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 427 NENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNI--LSTYIG 480
           N N  AC TSPASA  AITVGA    DDR    AYFSNWG CVD+FAPG+ I  LS    
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 481 SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKD 540
           S     T SGTSMASP VAGL    L                 + P  +K KL+H STKD
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILL--------------DKGVEPFDVKDKLLHLSTKD 430

Query: 541 ILFDI----PEDTPNFLIYNG 557
           +   +       TPN + YNG
Sbjct: 431 VFNKLTLFFKYGTPNKIAYNG 451

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  178 bits (452), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 122/316 (38%), Positives = 162/316 (51%), Gaps = 36/316 (11%)

Query: 258 QNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGVNINHKDF 308
           Q+ AP  LARIS   +L             FN Y  DD  G+ V +Y++DTG+  +H +F
Sbjct: 125 QSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEF 184

Query: 309 EKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 367
           E R I G  I L  E   D NGHGTH AG + SK YG            L  +GSG  S+
Sbjct: 185 EDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASN 242

Query: 368 VVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN 427
           V+ G+E+                K   AN+SLG  +SP +++AV  A+E GI F  AAGN
Sbjct: 243 VLSGLEFIVEHCTRVSRPQG---KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGN 299

Query: 428 ENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATA 486
            N DA   SPASA+  ITVGA     D  A FSNWG CV++FAPG+ I S    +   T 
Sbjct: 300 FNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFNDTL 359

Query: 487 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDI----- 541
            LSGTSM++P V G+    LS                + P+ + ++L + ST+++     
Sbjct: 360 VLSGTSMSTPIVTGVAAVLLS--------------KGIEPEMIAQELEYLSTRNVFHRRT 405

Query: 542 LFDIPEDTPNFLIYNG 557
           LF  P  TPN ++YNG
Sbjct: 406 LFFKP-STPNQILYNG 420

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  175 bits (444), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 126/373 (33%), Positives = 176/373 (47%), Gaps = 61/373 (16%)

Query: 229 QEIIDLIRQNPLV-------DFVERDSV-VEATEFDT-----QNSAPWGLARISHRERLN 275
           ++++D IR++PLV        FV  D    E   F++     Q  AP  L+R+S R +L 
Sbjct: 72  RDLVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLP 131

Query: 276 L----------GSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL 325
                      GSFN Y  +   G G+ +Y+IDTG+   H +F  RA++G       EDL
Sbjct: 132 YDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFG-------EDL 184

Query: 326 ------DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXX 379
                 DGNGHGTH AG + S  YG            L + G G ++ V+  +E+     
Sbjct: 185 TGEGPGDGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAVNHC 244

Query: 380 XXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPAS 439
                      KG   N+SLG  ++  ++ AV AA EAGI   VAAGN N +AC  SPAS
Sbjct: 245 RSSEG------KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPAS 298

Query: 440 ADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHV 498
           A +AITVGA    +D  A FSNWG CVD+FAPG+ + S            SGTSMASP +
Sbjct: 299 APEAITVGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSI 358

Query: 499 AGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDIL----FDIPEDTPNFLI 554
            GL    L               + +   ++K  ++  +T D+           TPN + 
Sbjct: 359 TGLAAILL--------------DEGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVA 404

Query: 555 YNGGGQDLSAFWN 567
           +NG  ++   F N
Sbjct: 405 FNGVKKNDDKFSN 417

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  175 bits (444), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/365 (33%), Positives = 173/365 (47%), Gaps = 52/365 (14%)

Query: 220 FSGYIGYFTQEIIDLIRQNPLVD----------FVERDSVVE--ATEFDTQNSAPWGLAR 267
           F G+   F ++ ++ +++NPLV           F +++ + E  +  +  Q  AP  LAR
Sbjct: 61  FEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLAR 120

Query: 268 ISHRERLNLGS-------FNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPL 320
           +S R  L           FN Y      G  V +Y+IDTG+   HKD   RA +G  + +
Sbjct: 121 LSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM-V 179

Query: 321 NDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXX 380
            +   D NGHGTH AG + S+ +G            L + G G ++ V+  +E+      
Sbjct: 180 GEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSVNHCK 239

Query: 381 XXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASA 440
                         AN+SLG  ++  L+ AV AAVE+G+   VAAGN N +AC  SPASA
Sbjct: 240 KSGML-------CVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASA 292

Query: 441 DKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASP 496
             AITVGA    DDR    A FSNWG CVDVFA G+ ++S            SGTSMASP
Sbjct: 293 ISAITVGA---FDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASP 349

Query: 497 HVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDIL----FDIPEDTPNF 552
            VAGL    L                 + P  +K+K+I  +T+++           TPN 
Sbjct: 350 SVAGLAAVLL--------------DSGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNR 395

Query: 553 LIYNG 557
           + +NG
Sbjct: 396 IAFNG 400

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  174 bits (442), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 133/393 (33%), Positives = 188/393 (47%), Gaps = 66/393 (16%)

Query: 210 IQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSA-------- 261
           I+  F+I + F G     ++ +++ ++++PLV  +  +   EA E D+ NSA        
Sbjct: 49  IEKKFSIGS-FRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAFEGDSVNSAESSYTFNA 107

Query: 262 ---------------------PWGLARISHRERLNL---------GSFNKYLYDDDAGRG 291
                                P  LARIS   +L             FN Y   D  G+ 
Sbjct: 108 TAKYSYEDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQD 167

Query: 292 VTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXX 350
           V +Y++DTG+  +H +FE R I G  I L  E   D NGHGTH AG + SK YG      
Sbjct: 168 VNAYIMDTGIFADHPEFEDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKRVN 225

Query: 351 XXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLA 410
                 L  +GSG  S+V+ G+E+                K   AN+SLG  +SP +++A
Sbjct: 226 LVEVKVLGKDGSGEASNVLSGLEFIVEHCTKVSRPQG---KKCVANLSLGSFRSPIINMA 282

Query: 411 VNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFA 469
           V  A+E GI F  AAGN N DA   SPASA+  ITVGA     D  A FSNWG CV++FA
Sbjct: 283 VEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFA 342

Query: 470 PGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQL 529
           PG+ I S    +   T  LSGTSM++P V G+    LS                + P+ +
Sbjct: 343 PGVEIESLSHLNYNDTLILSGTSMSTPIVTGVAAILLS--------------KGIEPEMI 388

Query: 530 KKKLIHYSTKDI-----LFDIPEDTPNFLIYNG 557
            +++ + ST+++     LF  P  TPN ++YNG
Sbjct: 389 AQEIEYLSTRNVFHRRTLFFKP-STPNQILYNG 420

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  175 bits (443), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 123/323 (38%), Positives = 163/323 (50%), Gaps = 36/323 (11%)

Query: 251 EATEFDTQNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGV 301
           EA     Q+ AP  LARIS   +L             FN Y  DD  G+ V +Y++DTG+
Sbjct: 167 EAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGI 226

Query: 302 NINHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 360
             +H +FE R I G  I L  E   D NGHGTH AG + SK YG            L  +
Sbjct: 227 FSDHPEFEDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKD 284

Query: 361 GSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420
           GSG  S+V+ G+E+                K   AN+SLG  +SP +++AV  A+E GI 
Sbjct: 285 GSGEASNVLSGLEFIVEHCTRVSRPQG---KKCVANLSLGSFRSPIINMAVEGAIEEGIV 341

Query: 421 FAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYI 479
           F  AAGN N DA   SPASA+  ITVGA     D  A FSNWG CV++FAPG+ I S   
Sbjct: 342 FVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSH 401

Query: 480 GSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTK 539
            + E T  LSGTSM++P V G+    LS                + P  + +++ + ST+
Sbjct: 402 LNYEDTLILSGTSMSTPIVTGVAAVLLS--------------KGIEPALIAQEIEYLSTR 447

Query: 540 DI-----LFDIPEDTPNFLIYNG 557
           ++     LF  P  T N ++YNG
Sbjct: 448 NVFHRRTLFFKP-STANQILYNG 469

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  172 bits (435), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 135/406 (33%), Positives = 185/406 (45%), Gaps = 54/406 (13%)

Query: 181 LQSVENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPL 240
           L ++ + S  + F  S     L     G I   F I  +  G     + +++D I+++P 
Sbjct: 23  LVTLNDDSRSERFMNSVLSKDLKWFMGGKINKRFQIGEL-KGLTMNLSHDVLDKIKRHPF 81

Query: 241 VDFVERDSVVEATEFDT------------QNSAPWGLARISHRERLNLGSFNK------- 281
           V  V  + +V+A E D             Q  AP  LARIS R +L     NK       
Sbjct: 82  VKEVVPNIMVKAFEGDAVEDESWLPKMKRQRGAPRHLARISRRMQLPYDMNNKTRYRDSF 141

Query: 282 -YLYDDDA-GRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIA 339
            Y YD  A G    +Y++DTGV  +HK+FE R  +G       E  D NGHGTH AG + 
Sbjct: 142 NYYYDRWAQGATTRAYILDTGVMRDHKEFEDRVEFGTDCTGEGEG-DLNGHGTHVAGLVG 200

Query: 340 SKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSL 399
           SK +G            L + G+GT+  ++  +E+                     NMSL
Sbjct: 201 SKTFGVAKHVQLVDVKCLDALGAGTLVSILSALEFAVQDCQEHEDSQ------CVLNMSL 254

Query: 400 GGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR---- 455
           G  KS  L+ A+N   + GI   VAAGN N +AC TSP+SA  AITVGA    DDR    
Sbjct: 255 GSVKSNILNQAINEVEKKGIVVVVAAGNFNMNACWTSPSSATGAITVGA---FDDRFDTI 311

Query: 456 AYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSE 515
           A FSNWG CVD+FAPG+N+ S       +    SGTSMASP V G++   L         
Sbjct: 312 AKFSNWGPCVDIFAPGVNVASLVNRDWPSFVKYSGTSMASPIVCGMVALLLD-------- 363

Query: 516 FFELGQDSLTPQQLKKKLIHYSTKDIL----FDIPEDTPNFLIYNG 557
                 D + P+ ++  L   +T  +           TPN ++YNG
Sbjct: 364 ------DGVPPEDIRDYLQELATDGVFKKRTLVFKPGTPNSVLYNG 403

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  170 bits (431), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 123/320 (38%), Positives = 159/320 (49%), Gaps = 47/320 (14%)

Query: 258 QNSAPWGLARISHRERL-----NLGSF-NKYLYDDDA---GRGVTSYVIDTGVNINHKDF 308
           Q  AP  L+R+S R +L     N+  + N + Y  DA   G  V +Y+IDTG+   H +F
Sbjct: 115 QREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEF 174

Query: 309 EKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 367
           E R  +   I L  E   D NGHGTH AG + SK +G            L   G G +S 
Sbjct: 175 EGRVKFA--IDLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLST 232

Query: 368 VVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGN 427
           ++K +E+                K   AN+S G  ++  +D A+  A  AGI   VAAGN
Sbjct: 233 ILKALEFTIRHCKESVD------KKCVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGN 286

Query: 428 ENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNI--LSTYIGS 481
            N DAC  SPAS+   ITVGA    DDR    A FSNWG CVDVFAPG+ +  LS   GS
Sbjct: 287 SNIDACWNSPASSKDVITVGAF---DDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGS 343

Query: 482 DEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDI 541
           D     LSGTSMASP V+G+    L                 L P+ +K K+I  STK+I
Sbjct: 344 D--VLLLSGTSMASPSVSGIAAILL--------------DKGLNPKFVKSKIIESSTKNI 387

Query: 542 LFD----IPEDTPNFLIYNG 557
                  I  +TPN +++NG
Sbjct: 388 FHQGTIMIKPNTPNLIVFNG 407

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  168 bits (426), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 127/360 (35%), Positives = 176/360 (48%), Gaps = 55/360 (15%)

Query: 229 QEIIDLIRQNPLVDFVERDSVVEATEFD--------------TQNSAPWGLARISHRERL 274
           Q+I++ ++QNPLV  +  + + +A E D               Q+ AP  LARIS R++L
Sbjct: 76  QKIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDKL 135

Query: 275 -----NLGS----FNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL 325
                N+ S    FN Y   +  G  V +Y++D+GV+ N  DFE R  +G      D + 
Sbjct: 136 PYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDFT-GDGEG 194

Query: 326 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXX 385
           D NGHGTH AG + SK YG            L   G GT+  V+  +E+           
Sbjct: 195 DSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPE- 253

Query: 386 XXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAIT 445
                K   AN+SLG  K+  ++ A+ AA E G+   VAAGN N +AC TSPASA++AIT
Sbjct: 254 -----KRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAIT 308

Query: 446 VGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGL 501
           VGA    DDR    A FSNWG CVD++APG+ + S          + SGTSMASP V G 
Sbjct: 309 VGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCGQ 365

Query: 502 LTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDIL----FDIPEDTPNFLIYNG 557
           +   L     +D               +K  LI  +T D+          +TPN +++NG
Sbjct: 366 VAILLDKGIPND--------------DIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFNG 411

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  172 bits (435), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 116/306 (37%), Positives = 150/306 (49%), Gaps = 48/306 (15%)

Query: 253 TEFDTQNSAPWGLARISHRERL-----NLGSFNK---YLYDD-DAGRGVTSYVIDTGVNI 303
           ++F  Q  AP  LARIS R++L     N   F +   Y YDD D G GV +YVIDTG+  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 304 NHKDFEKRAIWGKTIPLNDEDLDG------NGHGTHCAGTIASKHYGXXXXXXXXXXXXL 357
            HKDFE R  +G        DL G      NGHGTH AG I SK YG            +
Sbjct: 342 EHKDFEDRVEFGT-------DLTGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAV 394

Query: 358 RSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEA 417
              GS  +S +++ +EY                K    NMSLG      ++ AV +A+  
Sbjct: 395 SLTGSTQLSHIIEAIEYTVNDCNSRVDK-----KACVVNMSLGSFYVKVINEAVESAIAE 449

Query: 418 GIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLN 473
           G+ F VAAGN N DAC +SP S+  AITVGA    DDR    A FSNWG+CVD+FA G+ 
Sbjct: 450 GVVFVVAAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVE 506

Query: 474 ILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKL 533
           + S            SGTSMASP V G ++  LS                + P  +++++
Sbjct: 507 VKSLSSQVPYKYIKYSGTSMASPIVCGFVSILLS--------------QGVKPNDVQEEM 552

Query: 534 IHYSTK 539
           +  STK
Sbjct: 553 VKLSTK 558

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  167 bits (424), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 121/340 (35%), Positives = 156/340 (45%), Gaps = 52/340 (15%)

Query: 257 TQNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGVNINHKD 307
           TQ+ AP  LAR+S R +L             FN Y Y    GR V +YV+D+GV I+H D
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 308 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 367
           FE RA +G     +    D NGHGTH AG I SK YG            L S GSGT+  
Sbjct: 219 FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDT 278

Query: 368 VVKGVEYXXXXXXXXXXXXXXGF------------------KGSTANMSLGGGKSPALDL 409
           V+ G+E+              G                   K    N+SLG  +S  ++ 
Sbjct: 279 VMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIINE 338

Query: 410 AVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCV 465
           A+   ++ GI   VAAGN N +AC TSPAS    ITVGA    DDR    A FSNWG CV
Sbjct: 339 AIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNCV 395

Query: 466 DVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLT 525
           D+FAPG+ + S            +GTSMA+P V GL+   L                 + 
Sbjct: 396 DIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL--------------DSGIK 441

Query: 526 PQQLKKKLIHYSTKDIL----FDIPEDTPNFLIYNGGGQD 561
           P Q+KK+L   +T +I           TPN + +NG  +D
Sbjct: 442 PTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRD 481

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  167 bits (423), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 117/316 (37%), Positives = 161/316 (50%), Gaps = 40/316 (12%)

Query: 258 QNSAPWGLARISHR-------ERLNLGSFN-KYLYDDD-AGRGVTSYVIDTGVNINHKDF 308
           Q  AP  LARIS R       E +++ + N  Y YDD+ +G  V +YVIDTG+   H   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 309 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDV 368
           E RA +G  + + +   D NGHGTH AG I S+ +G            L + G G ++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 369 VKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNE 428
           +  +E+                +G  AN+SLG  ++  L+ AV AA+EAG+   VAAGN 
Sbjct: 254 ISAIEFTVNHCRKSR-------RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 429 NQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSDEA 484
           N +AC +SPAS+  AITVGA    DDR    A FSNWG CVD+FAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 485 TATLSGTSMASPHVAGLLTYFL--SLQP-GSDSEFFELGQDSLTPQQLKKKLIHYSTKDI 541
               SGTSMASP V+G++   L   + P    +E  +L  DS+           +  + +
Sbjct: 364 PVAFSGTSMASPIVSGMVANLLDSGIHPFDIKTELIDLATDSV-----------FHKRTL 412

Query: 542 LFDIPEDTPNFLIYNG 557
           LF     TPN + + G
Sbjct: 413 LFK--PGTPNRVAFTG 426

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  164 bits (414), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 137/395 (34%), Positives = 190/395 (48%), Gaps = 72/395 (18%)

Query: 208 GGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFD----------- 256
           G I  +F+  + F G     T++++  I++NPLV  V  +  + A ++D           
Sbjct: 54  GKISKTFSFGS-FRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDI 112

Query: 257 ---------------TQNSAPWGLARISHRERLNLGSFNKYLYDDD---------AGRGV 292
                           QN AP  LAR+S R  L     +K  Y+D           G  V
Sbjct: 113 KQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDV 172

Query: 293 TSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXX 351
            +Y+ID+G++IN ++FE RA  G  + L  E   D NGHGTH AG + SK YG       
Sbjct: 173 NAYIIDSGIDINQEEFEGRATHG--LDLTGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTL 230

Query: 352 XXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAV 411
                L   GSG++  V+  +E+                K   AN+SLG    P L+ A+
Sbjct: 231 VEVKALDRQGSGSLITVISALEFVVNHCGKSKS------KKCVANLSLGAFMMPLLNEAI 284

Query: 412 NAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDV 467
            A V++G+   VAAGN N DAC  SPAS   AITVGA    DDR    A FSNWG CVD+
Sbjct: 285 KATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSCVDI 341

Query: 468 FAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSE-----FFELGQD 522
           FAPG+ I S  I  ++ +   SGTSMASP VAG+++  + L  G ++E      FEL  D
Sbjct: 342 FAPGVAISSLSIKDNQKSVEFSGTSMASPQVAGIVS--ILLDQGVENEDIRDYLFELATD 399

Query: 523 SLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNG 557
            +           +  + +LF  P  TPN + +NG
Sbjct: 400 DV-----------FQKRTLLFK-PR-TPNRITFNG 421

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  162 bits (409), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 115/322 (35%), Positives = 159/322 (49%), Gaps = 37/322 (11%)

Query: 258 QNSAPWGLARISHRERLNLGS-------FNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 310
           Q+ AP  LAR   R  L   +       FN Y   +  G  V  Y++D+G++ +H +FE 
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 311 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVK 370
           RA++G     N+   D NGHGTH AG + SK YG            +  +G G+ S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 371 GVEYXXXXXXXXXXXXXXGFKGSTANMSLGG---GKSPALDLAVNAAVEAGIHFAVAAGN 427
           GVE+                K   ANMSLGG   G S ALD AV AA+E G+ F VAAGN
Sbjct: 389 GVEFAVKHCQQSG-------KKCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 428 ENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATA 486
             + AC  SPA    AITVGA    SD  A FSN+GKCVD+FAPG+ + S          
Sbjct: 441 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVR 500

Query: 487 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFD-- 544
            L+GTSM++P  AG++   L                 +  + +K++LI  STK +     
Sbjct: 501 VLNGTSMSAPITAGVVAVLL--------------DQGVKHEDVKERLIDLSTKGVFHRRR 546

Query: 545 -IPEDTPNFLIYNGGGQDLSAF 565
            +   TP+  ++NG  Q+   F
Sbjct: 547 LVSSRTPDRTLFNGVPQEDDVF 568

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  159 bits (402), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 119/319 (37%), Positives = 153/319 (47%), Gaps = 38/319 (11%)

Query: 256 DTQNSAPWGLARISHRERL--------NLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHK 306
           D Q  AP  L ++S R +L            F  Y YD    G     Y+IDTGV   HK
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 307 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 366
           +F  R  +G    + +   D NGHGTH AG I SK +G            L   G G ++
Sbjct: 208 EFGNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 367 DVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAG 426
            V++G+E+                K    NMSLG  ++P ++ A+  A  +GI   VAAG
Sbjct: 267 SVLEGIEFAVNNCKLKQQPMG---KNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 427 NENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSD 482
           N N  AC TSPAS++ AITVGA    DDR    A FSNWG+CVD+FAPG+ I S      
Sbjct: 324 NNNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRML 380

Query: 483 EATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDIL 542
           E     SGTSMASP VAGL+   +      D              ++K+KLI  S+K I 
Sbjct: 381 ENGVIHSGTSMASPIVAGLVAILMEKGYKCD--------------EIKQKLIDDSSKSIF 426

Query: 543 FDI----PEDTPNFLIYNG 557
             +       TPN +IYNG
Sbjct: 427 SKLTLFFKYGTPNRVIYNG 445

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  157 bits (396), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 113/327 (34%), Positives = 159/327 (48%), Gaps = 39/327 (11%)

Query: 254 EFDTQNSAPWGLARISHRERLNLG-------SFNKYLYDDDAGRGVTSYVIDTGVNINHK 306
           ++  Q  AP  LAR   R  L          +FN Y  ++  G GV  YV+D+G+  +H 
Sbjct: 424 QYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHP 483

Query: 307 DFEKRAIWG-KTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTM 365
           +F+ RA +G  T      DL  NGHGTH AG + S+ +G            +  +G G+ 
Sbjct: 484 EFDGRAHFGIDTTKEGPGDL--NGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGST 541

Query: 366 SDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGG---GKSPALDLAVNAAVEAGIHFA 422
           S+++ GVE+                K   ANMSLGG   G S ALD AV AA+E G+ F 
Sbjct: 542 SNIIAGVEFAVKHCQQSG-------KRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFV 593

Query: 423 VAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS 481
           VAAGN  + AC  SPA    AITVGA    SD  A FSN+GKCVD+FAPG+ + S     
Sbjct: 594 VAAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSP 653

Query: 482 DEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDI 541
                 L+GTSM++P  AG++   L                 + P ++K  L+  STK +
Sbjct: 654 SNTMRVLNGTSMSAPITAGVVAVLL--------------DQGIEPHEVKDHLLSISTKGL 699

Query: 542 LFD---IPEDTPNFLIYNGGGQDLSAF 565
                 +   TP+  ++ G  ++  +F
Sbjct: 700 FHKRRLVSSRTPDRALFTGVKREDDSF 726

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  152 bits (384), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 135/411 (32%), Positives = 186/411 (45%), Gaps = 80/411 (19%)

Query: 199 DTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFV-----------ERD 247
           D +L+    G I  +F+    F G+   F   +I  +R NPLV  +           E D
Sbjct: 42  DEFLNIFSQGKILKTFSFGK-FEGFTVDFPLSLISKLRNNPLVAEIVPNVEFNVFDGEED 100

Query: 248 SVV----------------------EATEFDTQNSAPWGLARISHRERLNLGSFN----- 280
                                    E  +F  Q +AP  LARIS R  L     N     
Sbjct: 101 PSYWDDDNGDDEYDEDEDEDDEDNSEFPDFVAQKNAPRHLARISRRSALPYNPENIAPKT 160

Query: 281 ---KYLYDDD-AGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAG 336
               Y YDD   G  V +YVIDTG+   H+ F+ RA +G  + + +   D NGHGTH AG
Sbjct: 161 SNFSYYYDDSFPGTCVNAYVIDTGIFKEHRQFQGRAKFGADL-VGEGPGDLNGHGTHVAG 219

Query: 337 TIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTAN 396
            I S+ YG            L + G G ++ V+  +E+                +G  AN
Sbjct: 220 LIGSQKYGVAKDVSLIEVKALNAKGQGNLTSVISAIEFTVNHCRKSK-------RGCVAN 272

Query: 397 MSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR- 455
           +SLG  ++  L+ AV AA+EAG+   VAAGN N +AC +SPAS+  AI+VGA    DDR 
Sbjct: 273 LSLGSFRNSVLNQAVEAALEAGVVVVVAAGNSNANACWSSPASSLSAISVGA---FDDRT 329

Query: 456 ---AYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGS 512
              A FSNWG CVD+FAPG+ I S        +   SGTSMASP V G++   L      
Sbjct: 330 DTIARFSNWGNCVDLFAPGVKIASLSNIPPFKSVAYSGTSMASPLVTGMVAVLL------ 383

Query: 513 DSEFFELGQDSLTPQQLKKKLIHYST------KDILFDIPEDTPNFLIYNG 557
                      + P  +K++LI+ +T      + +LF     TPN + + G
Sbjct: 384 --------DSGIHPFDIKEELINTATDSVFHKRALLFK--PGTPNRVAFTG 424

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  151 bits (381), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 125/325 (38%), Positives = 163/325 (50%), Gaps = 36/325 (11%)

Query: 254 EFDTQNSAPWGLARISHRERLNL------GSFNKYLYDDD-AGRGVTSYVIDTGVNINHK 306
           +F +Q+ AP  LARIS R +L +       S  KY Y ++  G GV  YV+D+GVN +H 
Sbjct: 150 DFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHP 209

Query: 307 DFEKRAIWG-KTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTM 365
           DFE RA+ G  T      DL   GHGTH AG I SK YG            L S G GT+
Sbjct: 210 DFEGRAMKGIDTTGEGSGDL--VGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTV 267

Query: 366 SDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGG-GKSPALDLAVNAAVEAGIHFAVA 424
           +++++G+EY                +    NMSLG  G    LD AV+A +E G+   VA
Sbjct: 268 TNIIEGLEYVVNQCIGKK-------RKCVINMSLGAPGTHSILDKAVSAVIEEGVVVVVA 320

Query: 425 AGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIG 480
            GN   +AC  SPA   KAITV A    DDR    A FSNWG C+D++APG+N+ S    
Sbjct: 321 GGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-N 376

Query: 481 SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKD 540
               T  LSGTSMASP VAG    +L  Q    +E  ++   + T    KK+ I    + 
Sbjct: 377 KGRGTFVLSGTSMASPIVAGAAAIYLD-QGADPAEVRKILSKTATRGVFKKRAIAVRPR- 434

Query: 541 ILFDIPEDTPNFLIYNGGGQDLSAF 565
                   TPN ++Y G  Q+   F
Sbjct: 435 --------TPNKVLYTGNNQEDDEF 451

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  134 bits (337), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 98/334 (29%), Positives = 162/334 (48%), Gaps = 17/334 (5%)

Query: 181 LQSVENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPL 240
           +Q +  LS   +      + Y   S+ GG+  + ++ N F    G F Q +++ +  +  
Sbjct: 17  VQFIAELSDTSSVADILGERYAQMSDNGGV-GAISLGNSFRAIYGDFPQRLLENLYYDGR 75

Query: 241 VDFVERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG 300
           +  +  D ++   E+  Q  AP  LAR+S +  L  GS   Y+Y  + G GV  Y++DTG
Sbjct: 76  ITAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTG 134

Query: 301 VNINHKDFEKRAIWGKTIPLNDEDL---DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXL 357
           ++  H + E R    K   L    +   D +GHGT  AG I S  +G             
Sbjct: 135 IDDLHPELEGRV--QKIADLTSNPVSHGDPHGHGTAVAGVIGSATFGSAKKCNLFDVRVA 192

Query: 358 RSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAV-E 416
            S G+ T+  V++ +E+                + S   +     K+  L+ A+ A + +
Sbjct: 193 DSTGNATLIGVIRALEHASKLASVTQ-------RPSVVVIPFTMRKNVILNSAIEAVIRD 245

Query: 417 AGIHFAVAAGNENQDACNTSPASADKAITVGA--STLSDDRAYFSNWGKCVDVFAPGLNI 474
             +   VA GN NQ+AC++SPASA  A+T+G+   T  D  A F+N+G C+D FA G+NI
Sbjct: 246 QSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNI 305

Query: 475 LSTYIGSDEATATLSGTSMASPHVAGLLTYFLSL 508
            S   G  E+    SGTS+++   +G++ Y++SL
Sbjct: 306 TSLTTGDYESNTQYSGTSISAGIASGVVAYYMSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  122 bits (306), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 161/320 (50%), Gaps = 22/320 (6%)

Query: 199 DTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQ 258
           + Y +T   GG+  +  + N F    G F Q++++   ++  +  +  D  +   E+  Q
Sbjct: 35  EQYAATVAGGGV-GAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQ 93

Query: 259 NSAPWGLARISHRERLNLGSFN---KYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWG 315
             AP  LAR+S +  L  G+ +    Y+Y  +AG GV  Y++DTG++  H  FE R    
Sbjct: 94  QHAPNHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRV--Q 151

Query: 316 KTIPLNDEDL---DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGV 372
           K    + + +   D +GHGT  AG I S  +G              S G  ++  V++ +
Sbjct: 152 KAADFSSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRAL 211

Query: 373 EYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAV-EAGIHFAVAAGNENQD 431
           E+                + S   + L   ++  L+ AV A V +  I   VAAGNEN+ 
Sbjct: 212 EHASKLAAVTK-------RPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRS 264

Query: 432 ACNTSPASADKAITVGASTLS--DDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATA-TL 488
           AC+ SPA A  A+T+G+  ++  D  A F+N+ +CVD+F  G+++ +  +G D ++   L
Sbjct: 265 ACSVSPAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHL 322

Query: 489 SGTSMASPHVAGLLTYFLSL 508
           SGTS+++   +GL+ Y++S+
Sbjct: 323 SGTSISAGVASGLVAYYMSI 342

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  122 bits (305), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 123/259 (47%), Gaps = 13/259 (5%)

Query: 254 EFDTQNSAPWGLARISHRERLNLGS---FNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 310
           ++ TQ +AP  L+R S   +L   S   +N Y   D  G  VT YV+D+G+ ++H +FE 
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 311 RAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVV 369
           R +  +     D  + D  GHGT  AG I SK YG            L + G G +  ++
Sbjct: 201 RIL--EAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSIL 258

Query: 370 KGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNEN 429
           +G+++                     N SLG      L+ A      AGI    AAGN  
Sbjct: 259 QGLQFITKHCEENTNG------NCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNA 312

Query: 430 QDACNTSPASADKAITVGASTLSDDR-AYFSNWGKCVDVFAPGLNILSTYIGSDEATATL 488
            +AC  +PA +    TVG+    DD  A FSNWG+CVD+ APG+ + +    + + +   
Sbjct: 313 VNACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRES 372

Query: 489 SGTSMASPHVAGLLTYFLS 507
           SGTS+++P V GL    LS
Sbjct: 373 SGTSVSTPIVTGLAAILLS 391

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  119 bits (297), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 96/315 (30%), Positives = 153/315 (48%), Gaps = 30/315 (9%)

Query: 212 DSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISH- 270
           D   I + F G+ G F  E++  +  +P V  +  D ++   E+  QN AP  LAR+S+ 
Sbjct: 53  DKIVIGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNG 112

Query: 271 --RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL--- 325
               R++  + N +++   AG GV  Y++D+G++  H  F  R I  K I L D  +   
Sbjct: 113 VSNSRVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHI-SKLIDLTDNPIPVG 171

Query: 326 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGT-MSDVVKGVEYXXXXXXXXXX 384
           D +GHGT  AG + S  +G            + +  +G  +S ++K +E+          
Sbjct: 172 DPHGHGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFIENHSRAT-- 229

Query: 385 XXXXGFKGSTANMSLGGGKSPALDLAVNAAVEA---GIHFAVAAGNENQDACNTSPASAD 441
                 + S A +     K+  L    N+A+E+    I   V AGN++  ACN SPASA 
Sbjct: 230 -----MRPSVAVLPFSMSKNAIL----NSAIESMPNSIAIVVPAGNQHHMACNFSPASAR 280

Query: 442 KAITVGASTLSDDR-----AYFSNWGKCVDVFAPGLNI--LSTYIGSDE-ATATLSGTSM 493
            + ++ +    D R     A FSN+G+CVDVF  G+ +  L     SDE   + +SGTSM
Sbjct: 281 NSQSILSVGSLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSM 340

Query: 494 ASPHVAGLLTYFLSL 508
           +    AG + Y++SL
Sbjct: 341 SCAIAAGTVGYYMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  104 bits (260), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 91/329 (27%), Positives = 149/329 (45%), Gaps = 32/329 (9%)

Query: 199 DTYLSTSEAGG--IQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFD 256
           ++Y  +S+  G  I D F + + F  + G F+  I+  +  +P V  + RD  ++  E  
Sbjct: 32  NSYALSSDQQGPEITDIFELGS-FRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIV 90

Query: 257 TQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGK 316
            QN+AP  L  +S    L   S   ++Y  + G GV  Y++DTG++I H +  K  I   
Sbjct: 91  LQNNAPSHLVGLSSISPL---SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRM 147

Query: 317 T------IPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVK 370
                  +P   +  D  GHGT  AG IAS+ +G              SNG   +S +++
Sbjct: 148 ADLTQSPVP---QGTDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQ 204

Query: 371 GVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQ 430
            +                        + +  G +P L  A+ A+ +  +   + AGN  Q
Sbjct: 205 ALTLTQRHIEGTKRPSVVVIP-----LEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQ 258

Query: 431 DACNTSPASAD----KAITVGASTLSDDRAYFSNWGKCVDVFAPGLNI-------LSTYI 479
           DA N SPA+ +      I VG+  ++++   F+N+G  VDVF  G  I       L +  
Sbjct: 259 DALNFSPANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQG 318

Query: 480 GSDEATATLSGTSMASPHVAGLLTYFLSL 508
            S+  T  +SGTS +S   AG++ Y++SL
Sbjct: 319 LSNSLTRQVSGTSASSAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 94.4 bits (233), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 142/311 (45%), Gaps = 29/311 (9%)

Query: 216 IDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISHRERLN 275
           I N F  + G  ++E +  + ++     +  +  +E   +  Q  AP  L R++ ++ + 
Sbjct: 55  IGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDSIK 113

Query: 276 LGSF----NKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL---DGN 328
              +    N+Y++ D +G GV  Y++DTG++I H  + +  I  K I L    +   D N
Sbjct: 114 SSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNIH-KLIDLTTSPIPSGDFN 172

Query: 329 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGS-GTMSDVVKGVEYXXXXXXXXXXXXX 387
           GHGT  AG I S  +G            + +N    TMS V+  +               
Sbjct: 173 GHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALSLIEKHEQKT----- 227

Query: 388 XGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADK---AI 444
              + S   +     K+  L+ A+   +   I   + AGN++Q+AC  SP    K    +
Sbjct: 228 --MRPSIIVLPFQTEKNTILESAIE-NISKKIPVIIPAGNKHQNACKLSPMGIKKLSNVL 284

Query: 445 TVGASTLSDDRAY-----FSNWGKCVDVFAPGLNILSTYIGSD---EATATLSGTSMASP 496
            VG+   S+++ Y     FSN+G CVD++  G++I +    S+   E    ++GTS +  
Sbjct: 285 VVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSYSCG 344

Query: 497 HVAGLLTYFLS 507
            VAG++ Y++S
Sbjct: 345 IVAGVVGYYMS 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 90.1 bits (222), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 146/334 (43%), Gaps = 27/334 (8%)

Query: 184 VENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDF 243
           V  L+++ +    +RD   S        +   + + F    G F+ E ++ +  +  V  
Sbjct: 17  VVQLASDTSLVELSRDCSFSIGVGKNFIEMITVGDQFKALAGEFSVEDLEYLYHDERVVA 76

Query: 244 VERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI 303
           + RD  ++  E+  Q  +P  L+++S     + GSF    +D  +G  V  YV DTG++ 
Sbjct: 77  ISRDRDLKLQEYKVQYGSPRHLSQLS-----SGGSFT---FDPVSGNLVDVYVFDTGIDF 128

Query: 304 NHKDFE-----KRAIWGKT-IPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXL 357
            H   +     K A +  + +P      D +GHGT  AG IAS+ +G             
Sbjct: 129 KHPGLQNVNPHKLADFTSSPVP---RGADPHGHGTMMAGLIASETFGVLKSCSLVDVRVA 185

Query: 358 RSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEA 417
             +G   +S ++KG+                  + S   + +  GK   +      A+  
Sbjct: 186 DKDGEVKLSTLMKGISASVAHARFTK-------RPSVFVLPMTIGKKNHILDNFLQAIPK 238

Query: 418 GIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNIL-- 475
            I   + AGN+  DAC+ SP +    + +G+    +  A FSN+G CVDV+  G +IL  
Sbjct: 239 DIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFSNYGNCVDVYTSGTDILTL 298

Query: 476 -STYIGSDEATATLSGTSMASPHVAGLLTYFLSL 508
            ST  G++    + +GTS +    AG++ Y +S+
Sbjct: 299 RSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 118/280 (42%), Gaps = 30/280 (10%)

Query: 244 VERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI 303
           +  D  +E  E   Q  AP  L ++   E  +    N+++YD  AG GV  Y+ DTG+  
Sbjct: 83  ISIDRQLEPQEMIVQKDAPRHLTKLLETEAGD----NEFVYDSTAGNGVDIYIFDTGIAR 138

Query: 304 NHKDFEKRAIWGKT----IPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRS 359
           N        I         P+ D+++    HGT  +G I S  +G               
Sbjct: 139 NSPGLSASRIHDMPGMPGPPIRDQEIL--EHGTAMSGLIGSPAFGVLKKCNLIDVNVGDE 196

Query: 360 NGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEAGI 419
           NG   MS V+KG+                  + S  N S    K+  L+ A +      +
Sbjct: 197 NGKVFMSKVLKGLNLVQQHVKHTN-------RPSVINFSYCTLKNAILNSAFD-NFPRDV 248

Query: 420 HFAVAAGNENQDACNTSPASADK---AITVGASTLSDD---RAYFSNWGKCVDVFAPGLN 473
             AVAAGN  Q  C+ SP    +    +  G+  ++DD    + FSN+G CV  +APG  
Sbjct: 249 PIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEG 308

Query: 474 ILSTYI------GSDEATATLSGTSMASPHVAGLLTYFLS 507
           +L+  I       S +    +SGTS +S   AG++ Y+++
Sbjct: 309 LLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON}
           YGL257C (REAL)
          Length = 566

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 10/112 (8%)

Query: 474 ILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKL 533
           +L  Y   D +      +S  S      L+Y+ +L+PG  ++F+++ Q SL P +   KL
Sbjct: 24  LLMVYYSVDLSVPVQHSSSDRSNSCDRCLSYYETLEPGWSNDFYDVNQKSLAPAEDVIKL 83

Query: 534 IHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDE 585
           +   T+ I+F          +  GG +++    N  K+  P  +   L  DE
Sbjct: 84  V---TRIIIFSK-------CLQQGGRRNVQRLRNVEKRLFPYINFERLETDE 125

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 284 YDDDAGRGVTSYVIDTGVNINHKD----FEKRAIW--GKTIPLNDEDLDGNGHGTHCAGT 337
           Y++  G GV + ++D G++  ++D    F     W      PL    L  + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 338 IAS 340
           IA+
Sbjct: 245 IAA 247

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 281 KYLYDDDAGRGVTSYVIDTGV---NINHKD-FEKRAIW--GKTIPLNDEDLDGNGHGTHC 334
           +  Y++  G G+ + ++D GV   N N KD F +   W      PL    L  + HGT C
Sbjct: 183 QLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHGTRC 242

Query: 335 AGTIAS 340
           AG IA+
Sbjct: 243 AGEIAA 248

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 284 YDDDAGRGVTSYVIDTGVNINHKD----FEKRAIW--GKTIPLNDEDLDGNGHGTHCAGT 337
           Y++  G GV + ++D G++   +D    F K   W       L    LD + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 338 IAS 340
           IA+
Sbjct: 214 IAA 216

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 281 KYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED------LDGNGHGTHC 334
           K  Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT C
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRC 217

Query: 335 AGTIASK 341
           AG IA+K
Sbjct: 218 AGEIAAK 224

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 288 AGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDE------DLDGNGHGTHCAGTIAS 340
            G+ VT  ++D GV+  ++D + +  +  +   ND        L  + HGT CAG IA+
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAA 224

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 10/60 (16%)

Query: 289 GRGVTSYVIDTGVNINHKD----FEKRAIW----GKTIPLNDEDLDGNGHGTHCAGTIAS 340
           G+GV + +ID GV+    D    F K   W     + +P+    L  + HGT CAG IA+
Sbjct: 170 GKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPM--PLLSDDNHGTRCAGEIAA 227

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 284 YDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGT 337
           Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 338 IASK 341
           IA+K
Sbjct: 221 IAAK 224

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 284 YDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGT 337
           Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 338 IASK 341
           IA+K
Sbjct: 221 IAAK 224

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 284 YDDDAGRGVTSYVIDTGVNINHKD----FEKRAIW--GKTIPLNDEDLDGNGHGTHCAGT 337
           Y +  G+GV + V+D G++  + D    F K   W       L    L  + HGT CAG 
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDYHGTRCAGE 211

Query: 338 IAS 340
           IA+
Sbjct: 212 IAA 214

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 284 YDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGT 337
           Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDYHGTRCAGE 220

Query: 338 IASK 341
           IA+K
Sbjct: 221 IAAK 224

>KNAG0A04180 Chr1 (567264..569834) [2571 bp, 856 aa] {ON} Anc_8.463
           YDR239C
          Length = 856

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 285 DDDAGRGVTSYVIDTGVNINH-KDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKH 342
           D+++     S ++ +GVN++H K+F +   + K +PL  +D + N H T+  G + S +
Sbjct: 690 DENSNPDFNSKLLQSGVNVDHTKEFHR--FFNKDLPLGSDDDEFNEHDTNADGDLRSDY 746

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,566,313
Number of extensions: 2473302
Number of successful extensions: 5223
Number of sequences better than 10.0: 88
Number of HSP's gapped: 5107
Number of HSP's successfully gapped: 96
Length of query: 608
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 493
Effective length of database: 40,294,809
Effective search space: 19865340837
Effective search space used: 19865340837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)