Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_5.266.16ON1002100245710.0
YEL061C (CIN8)6.16ON1000100241560.0
Suva_5.66.16ON999100240190.0
Skud_5.286.16ON998100439850.0
TDEL0G045306.16ON95865516890.0
ZYRO0C07898g6.16ON97465816440.0
CAGL0B03641g6.16ON98858515830.0
NCAS0H008806.16ON100462615550.0
SAKL0E01078g6.16ON94859015050.0
Kpol_1032.66.16ON100458814860.0
NDAI0D008706.16ON106959614890.0
KLLA0D01045g6.16ON96568414770.0
KAFR0L003706.16ON96356214420.0
Kwal_56.224036.16ON94367814021e-178
KNAG0M011306.16ON95059613421e-169
Ecym_30206.16ON94458713241e-166
KLTH0C11330g6.16ON94167113211e-166
TBLA0A072306.16ON109760313251e-165
ACR010C6.16ON94559113131e-165
TPHA0M002406.16ON93961913101e-164
Kpol_1045.736.16ON96258910391e-124
TPHA0J003006.16ON9826538035e-91
ACR228C7.387ON11294986721e-72
SAKL0F12298g7.387ON11122166491e-69
Smik_2.537.387ON11132206472e-69
YBL063W (KIP1)7.387ON11112216472e-69
Suva_2.547.387ON11102206463e-69
Skud_2.417.387ON11102216463e-69
Ecym_46887.387ON11342256393e-68
TPHA0E008907.387ON12322246361e-67
TDEL0C016007.387ON11052146279e-67
ZYRO0B03234g7.387ON11382136199e-66
NDAI0E043007.387ON11862186172e-65
NCAS0E026407.387ON11022166135e-65
KAFR0L017107.387ON11512196048e-64
TBLA0D006407.387ON11421994605e-46
KLTH0G03850g5.531ON4731733549e-35
SAKL0G18920g2.633ON6491863556e-34
SAKL0G05016g5.531ON5041733425e-33
KLLA0B00759g5.531ON4561743396e-33
Kwal_47.186085.531ON4791753416e-33
Ecym_34152.633ON6621833182e-29
Ecym_40665.531ON4781723097e-29
ADR145C2.633ON6351693139e-29
KAFR0F042103.528ON6721783032e-27
SAKL0F01760g3.528ON8091783033e-27
NCAS0E005503.528ON7841803023e-27
CAGL0I07029g3.528ON7051803013e-27
Skud_7.533.528ON8051783023e-27
TDEL0D059603.528ON7331813014e-27
TBLA0C039403.479ON7391833014e-27
Kwal_47.190933.528ON8191793015e-27
Suva_7.443.528ON8051782997e-27
KLLA0A01606g3.528ON7691822997e-27
ZYRO0E08668g3.528ON7781812971e-26
Smik_7.483.528ON8051782971e-26
YGL216W (KIP3)3.528ON8051782962e-26
KNAG0B005203.528ON7231832943e-26
TBLA0C049603.528ON8011882943e-26
KLTH0G01606g3.528ON8191792943e-26
CAGL0D04994g3.479ON6921492924e-26
ZYRO0D12650g5.531ON4781852866e-26
Kpol_423.83.528ON8061812918e-26
Kpol_1004.255.531ON5061912859e-26
Kpol_1050.1033.479ON6971522881e-25
NDAI0I029603.528ON8682382882e-25
TPHA0D034803.528ON8471792872e-25
KAFR0B065903.479ON7061832853e-25
KNAG0A078803.479ON7641442844e-25
AGR253W3.479ON7091822827e-25
Ecym_12003.528ON8331782811e-24
TPHA0D032003.479ON7241502782e-24
NCAS0C013508.678ON6551832772e-24
AER441C3.528ON8181812782e-24
ZYRO0F07414g8.678ON6541962736e-24
NCAS0F034703.479ON6981502702e-23
Kpol_505.393.479ON6921502702e-23
YPR141C (KAR3)3.479ON7291442674e-23
NDAI0B057703.479ON7631552676e-23
ZYRO0B04290g3.479ON7311482657e-23
Skud_16.4353.479ON7291442658e-23
KLLA0D05951g8.678ON6682482631e-22
Smik_16.3883.479ON7291442641e-22
SAKL0F03168g3.479ON7061452631e-22
TDEL0F036403.479ON7041492631e-22
Ecym_44073.479ON7111822622e-22
TBLA0C053103.479ON6761832622e-22
Suva_16.4693.479ON7311452622e-22
KAFR0H024108.678ON6582282603e-22
Kpol_1013.78.678ON6201792585e-22
NDAI0E02090singletonON6851962551e-21
KLLA0B10956g3.479ON6901512532e-21
KLTH0F14498g3.479ON7021742514e-21
SAKL0H06490g8.678ON6571782496e-21
Kwal_26.88068.678ON7152522496e-21
TDEL0A062408.678ON6373812471e-20
TPHA0D012708.678ON6961882471e-20
ACR145W8.678ON6852112424e-20
CAGL0M02189g8.678ON6721942424e-20
KLTH0D11286g8.678ON6781882408e-20
YPL155C (KIP2)8.678ON7062002408e-20
Ecym_23958.678ON6872152391e-19
Smik_6.3528.678ON7152062363e-19
Skud_16.1278.678ON7062002344e-19
TDEL0B072702.633ON6442222254e-18
KNAG0J017208.678ON6251842237e-18
TBLA0C018808.678ON4681512191e-17
TPHA0D041903.479ON6721532141e-16
Suva_16.1558.678ON7042002103e-16
Kpol_1019.112.633ON6472072085e-16
Kwal_55.21164singletonOFF5881731872e-13
Kwal_YGOB_55.211643.479ON6571731862e-13
Suva_11.1452.633ON6571781862e-13
TPHA0N016502.633ON6822151755e-12
Smik_11.1602.633ON6561281665e-11
YKL079W (SMY1)2.633ON6561081612e-10
Skud_11.1482.633ON6561081602e-10
NCAS0H031802.633ON6602471495e-09
TBLA0A008202.633ON8031761487e-09
ZYRO0E01078g2.633ON6681091381e-07
KNAG0M025402.633ON5221081334e-07
NDAI0C004802.633ON5981901291e-06
TBLA0C008002.633ON6931341272e-06
CAGL0L05104g2.633ON6752061192e-05
KNAG0H003602.633ON6811251112e-04
KAFR0C040202.633ON667911075e-04
NCAS0C052002.633ON572153830.39
ABR218C7.384ON70769810.57
KNAG0C050405.416ON58783781.3
ZYRO0F09570g5.414ON835302753.3
NDAI0B055405.416ON58573753.3
TPHA0A031507.305ON96196744.0
TPHA0E023205.267ON191554744.6
NCAS0C028308.401ON874135745.0
Kwal_23.41874.261ON1258145745.2
Ecym_46917.384ON70382727.8
NCAS0D019505.170ON93936719.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_5.26
         (1002 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...  1765   0.0  
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...  1605   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...  1552   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...  1539   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   655   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   637   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   614   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   603   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   584   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   577   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   578   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   573   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   560   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   544   e-178
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   521   e-169
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   514   e-166
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   513   e-166
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   514   e-165
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   510   e-165
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   509   e-164
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   404   e-124
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   313   5e-91
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   263   1e-72
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   254   1e-69
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   253   2e-69
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   253   2e-69
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   253   3e-69
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   253   3e-69
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   250   3e-68
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   249   1e-67
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   246   9e-67
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   243   9e-66
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   242   2e-65
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   240   5e-65
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   237   8e-64
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   181   5e-46
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   140   9e-35
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   141   6e-34
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   136   5e-33
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   135   6e-33
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   135   6e-33
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   127   2e-29
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   123   7e-29
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   125   9e-29
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   121   2e-27
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   121   3e-27
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   120   3e-27
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   120   3e-27
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   120   3e-27
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   120   4e-27
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   120   4e-27
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   120   5e-27
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   119   7e-27
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   119   7e-27
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   119   1e-26
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   119   1e-26
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   118   2e-26
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   117   3e-26
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   117   3e-26
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   117   3e-26
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   117   4e-26
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   114   6e-26
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   116   8e-26
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   114   9e-26
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   115   1e-25
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   115   2e-25
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   115   2e-25
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   114   3e-25
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   114   4e-25
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   113   7e-25
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   112   1e-24
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   111   2e-24
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   111   2e-24
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   111   2e-24
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   109   6e-24
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   108   2e-23
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   108   2e-23
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   107   4e-23
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   107   6e-23
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   106   7e-23
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   106   8e-23
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   105   1e-22
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   106   1e-22
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   105   1e-22
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   105   1e-22
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   105   2e-22
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   105   2e-22
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   105   2e-22
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   104   3e-22
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   103   5e-22
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   102   1e-21
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   102   2e-21
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   101   4e-21
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   100   6e-21
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   100   6e-21
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   100   1e-20
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   100   1e-20
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    98   4e-20
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    98   4e-20
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    97   8e-20
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    97   8e-20
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    97   1e-19
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    96   3e-19
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    95   4e-19
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    91   4e-18
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    91   7e-18
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    89   1e-17
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    87   1e-16
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    86   3e-16
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    85   5e-16
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    77   2e-13
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    76   2e-13
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    76   2e-13
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    72   5e-12
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    69   5e-11
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    67   2e-10
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    66   2e-10
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     62   5e-09
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    62   7e-09
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    58   1e-07
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    56   4e-07
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    54   1e-06
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    54   2e-06
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    50   2e-05
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    47   2e-04
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    46   5e-04
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    37   0.39 
ABR218C Chr2 complement(812375..814498) [2124 bp, 707 aa] {ON} S...    36   0.57 
KNAG0C05040 Chr3 complement(969572..971335) [1764 bp, 587 aa] {O...    35   1.3  
ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} simila...    33   3.3  
NDAI0B05540 Chr2 (1355086..1356843) [1758 bp, 585 aa] {ON} Anc_5...    33   3.3  
TPHA0A03150 Chr1 complement(690935..693820) [2886 bp, 961 aa] {O...    33   4.0  
TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {...    33   4.6  
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     33   5.0  
Kwal_23.4187 s23 (607525..611301) [3777 bp, 1258 aa] {ON} YLR398...    33   5.2  
Ecym_4691 Chr4 (1353076..1355187) [2112 bp, 703 aa] {ON} similar...    32   7.8  
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     32   9.3  

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
            YEL061C (REAL)
          Length = 1002

 Score = 1765 bits (4571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 885/1002 (88%), Positives = 885/1002 (88%)

Query: 1    MPVENQNSSQERTSNNISKNGNSQIGCHTVHNEELNITVAVRCRGRNEREISMKSSVVVN 60
            MPVENQNSSQERTSNNISKNGNSQIGCHTVHNEELNITVAVRCRGRNEREISMKSSVVVN
Sbjct: 1    MPVENQNSSQERTSNNISKNGNSQIGCHTVHNEELNITVAVRCRGRNEREISMKSSVVVN 60

Query: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGY 120
            VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGY
Sbjct: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGY 120

Query: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSF 180
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 181  IELYNEELKDLLDXXXXXXXXXGFDGQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXX 240
            IELYNEELKDLLD         GFDGQFMKKLRIFD                        
Sbjct: 181  IELYNEELKDLLDNNSNSSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSSSRNSSP 240

Query: 241  XXLNDXXXXXXXXXXXXXXXXXXNTIKXXXXXXXXXTMXXXXXXXXXXXXXXXXXXXXXX 300
              LND                  NTIK         TM                      
Sbjct: 241  RSLNDLTPKAALLRRRLRTKSLPNTIKQQQQHQQQQTMNSRNNSSSNSGSATNNISSDTN 300

Query: 301  XXXGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSH 360
               GQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSH
Sbjct: 301  NNNGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSH 360

Query: 361  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 420
            TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN
Sbjct: 361  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 420

Query: 421  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 480
            ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK
Sbjct: 421  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 480

Query: 481  NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQ 540
            NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQ
Sbjct: 481  NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQ 540

Query: 541  ECKREIESLTXXXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISG 600
            ECKREIESLT              ETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISG
Sbjct: 541  ECKREIESLTSKNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISG 600

Query: 601  FNSKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQE 660
            FNSKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQE
Sbjct: 601  FNSKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQE 660

Query: 661  TDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFER 720
            TDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFER
Sbjct: 661  TDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFER 720

Query: 721  FYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKK 780
            FYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKK
Sbjct: 721  FYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKK 780

Query: 781  ALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSM 840
            ALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSM
Sbjct: 781  ALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSM 840

Query: 841  ATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILK 900
            ATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILK
Sbjct: 841  ATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILK 900

Query: 901  DXXXXXXXXXXXXXXXXDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLSKRMPLR 960
            D                DDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLSKRMPLR
Sbjct: 901  DNIESSITSTNSHITNIDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLSKRMPLR 960

Query: 961  ISNTNSNSMQNIISPKKHAIEDENSSNGNPDSESSRKILKTE 1002
            ISNTNSNSMQNIISPKKHAIEDENSSNGNPDSESSRKILKTE
Sbjct: 961  ISNTNSNSMQNIISPKKHAIEDENSSNGNPDSESSRKILKTE 1002

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
            CIN8Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 1000

 Score = 1605 bits (4156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 799/1002 (79%), Positives = 847/1002 (84%), Gaps = 2/1002 (0%)

Query: 1    MPVENQNSSQERTSNNISKNGNSQIGCHTVHNEELNITVAVRCRGRNEREISMKSSVVVN 60
            MP ENQN+ Q+R+SN+ISKNGNSQ+GCHTV NEELNITVAVRCRGRNEREISMKSSVVVN
Sbjct: 1    MPAENQNTGQDRSSNSISKNGNSQVGCHTVPNEELNITVAVRCRGRNEREISMKSSVVVN 60

Query: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGY 120
            VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVA PLFQDFIKGY
Sbjct: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120

Query: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSF 180
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSD+AGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 181  IELYNEELKDLLDXXXXXXXXXGFDGQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXX 240
            IELYNEELKDLLD         GFDGQFMKKLRIFD                        
Sbjct: 181  IELYNEELKDLLDSNSNGSSNTGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNSSP 240

Query: 241  XXLNDXXXXXXXXXXXXXXXXXXNTIKXXXXXXXXXTMXXXXXXXXXXXXXXXXXXXXXX 300
              LND                  NTIK          +                      
Sbjct: 241  RSLNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQ--AVNSRNNSSSNSGSTTNNASSNTN 298

Query: 301  XXXGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSH 360
               GQR+S+APNDQ+NGIYIQNLQEFHITNAMEGL LLQKGLKHRQVASTKMNDFSSRSH
Sbjct: 299  TNNGQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSH 358

Query: 361  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 420
            TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN
Sbjct: 359  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 418

Query: 421  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 480
            ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK
Sbjct: 419  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478

Query: 481  NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQ 540
            NKPQLG+FIMKDILVKNITMELAKIKSDLLSTKSKEGIYM+QDHYKNLNSDLESYKNEVQ
Sbjct: 479  NKPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 538

Query: 541  ECKREIESLTXXXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISG 600
            ECKREIESLT              ETIQSQN QIESLK TIDHLR QLDKQHKTE+EIS 
Sbjct: 539  ECKREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISD 598

Query: 601  FNSKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQE 660
            FN+KLQKLTEVMQMAL DYK+RELDLN+KFE HIT EIK +K+TLF QL+T+QQ +ILQE
Sbjct: 599  FNNKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQE 658

Query: 661  TDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFER 720
            T+IQPNLD+IKNEVLTLM TMQEKAELMYKDCVKKILNESPKFFN ++EKIDII VDF++
Sbjct: 659  TNIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQK 718

Query: 721  FYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKK 780
            FYKNIAENLSDISEENNN+KQY  NHFF+NNHQELL+ HVDSTYE IEK+TN+FVENFKK
Sbjct: 719  FYKNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKK 778

Query: 781  ALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSM 840
             LNDHL+ENKKLIM+NLTT TSAVIDQEM LFEPKRVKWE+SFDLIN+CDSMNNEFYNSM
Sbjct: 779  VLNDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSM 838

Query: 841  ATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILK 900
            A TLSQIKSTVDTSSNSMN+SISVMKGQVEESENAISLLKNN KFNDQF+QLINKH +LK
Sbjct: 839  AATLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLK 898

Query: 901  DXXXXXXXXXXXXXXXXDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLSKRMPLR 960
            D                DDIYNTIE IM NYGNKENATKDEMIEN+L EIPNLSK+MPLR
Sbjct: 899  DNIKNSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLSKKMPLR 958

Query: 961  ISNTNSNSMQNIISPKKHAIEDENSSNGNPDSESSRKILKTE 1002
            +SN NSNS+Q++ISPKKHAIEDEN S+ N D+E SRK+LK E
Sbjct: 959  LSNINSNSVQSVISPKKHAIEDENKSSENVDNEGSRKMLKIE 1000

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YEL061C
            (REAL)
          Length = 999

 Score = 1552 bits (4019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 790/1002 (78%), Positives = 840/1002 (83%), Gaps = 3/1002 (0%)

Query: 1    MPVENQNSSQERTSNNISKNGNSQIGCHTVHNEELNITVAVRCRGRNEREISMKSSVVVN 60
            MP ENQN+ QER+SNNIS N N+QIGCH V NEELNITVAVRCRGRNEREI MKSSVVVN
Sbjct: 1    MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 60

Query: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGY 120
            VPDITGS+E+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVA PLFQDFIKGY
Sbjct: 61   VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120

Query: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSF 180
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSD+AGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 181  IELYNEELKDLLDXXXXXXXXXGFDGQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXX 240
            IELYNEELKDLLD         GF+G FMKKLRIFD                        
Sbjct: 181  IELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSP 240

Query: 241  XXLNDXXXXXXXXXXXXXXXXXXNTIKXXXXXXXXXTMXXXXXXXXXXXXXXXXXXXXXX 300
              LND                  NTIK         +                       
Sbjct: 241  RSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNN 300

Query: 301  XXXGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSH 360
                QR+S+APNDQSNGIYIQNLQEFHITNAMEGL LLQ+GLKHRQVASTKMNDFSSRSH
Sbjct: 301  ---SQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSH 357

Query: 361  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 420
            TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN
Sbjct: 358  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 417

Query: 421  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 480
            AL DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK
Sbjct: 418  ALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 477

Query: 481  NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQ 540
            NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYM+QDHYKNLNSDLESYKNEVQ
Sbjct: 478  NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 537

Query: 541  ECKREIESLTXXXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISG 600
            ECKR+IESL+              +TIQSQNSQ+ESLK TI+ L+ QLDKQHKTELEISG
Sbjct: 538  ECKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISG 597

Query: 601  FNSKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQE 660
            FN+KLQKLTE+MQ+ALQDYKRRELDLNKKFETHI+ EIK++KTTLFSQLS ++Q NI QE
Sbjct: 598  FNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQE 657

Query: 661  TDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFER 720
            T+IQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFN IVEKIDII VDF+R
Sbjct: 658  TNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQR 717

Query: 721  FYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKK 780
            FY NIAENLSDISEENNNLKQY  NHFF+NNHQELL+HH+DSTYE IEKKT++FVENFK 
Sbjct: 718  FYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKN 777

Query: 781  ALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSM 840
             LNDHLEENKKLIM+NLT  TSAVI+QEM LFEPKRVKWE+SFDLIN+CDSMNNEFYN+M
Sbjct: 778  TLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNM 837

Query: 841  ATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILK 900
            ATTLSQIK+TVDTSSNSMNKSISVMKGQVEESENA+SLLKNN KFNDQFKQL+NKHTILK
Sbjct: 838  ATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILK 897

Query: 901  DXXXXXXXXXXXXXXXXDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLSKRMPLR 960
            D                DDIY+TIE IM NYGNKENA K+EMI+N+L EIP+LSKR+PLR
Sbjct: 898  DNIENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLR 957

Query: 961  ISNTNSNSMQNIISPKKHAIEDENSSNGNPDSESSRKILKTE 1002
            +SNTN NS QNI+SPKKHAI+DEN SN   D E SRKI KTE
Sbjct: 958  LSNTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
            YEL061C (REAL)
          Length = 998

 Score = 1539 bits (3985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 780/1004 (77%), Positives = 835/1004 (83%), Gaps = 8/1004 (0%)

Query: 1    MPVENQNSSQERTSNNISKNGNS--QIGCHTVHNEELNITVAVRCRGRNEREISMKSSVV 58
            MP E+QN+ QER+SN+IS NGN   Q+GCH+V NEELNITVAVRCRGRNEREI MKSSVV
Sbjct: 1    MPAESQNTIQERSSNSISSNGNGNNQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 60

Query: 59   VNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIK 118
            VNVPDITGSKE+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIF+EVA PLFQDFIK
Sbjct: 61   VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 120

Query: 119  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKC 178
            GYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+D+AGIIPRVLLKLFDTLELQQ+DYVVKC
Sbjct: 121  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 180

Query: 179  SFIELYNEELKDLLDXXXXXXXXXGFDGQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXX 238
            SFIELYNEELKDLLD         GFDGQFMKKLRIFD                      
Sbjct: 181  SFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNS 240

Query: 239  XXXXLNDXXXXXXXXXXXXXXXXXXNTIKXXXXXXXXXTMXXXXXXXXXXXXXXXXXXXX 298
                LND                  NTIK         +                     
Sbjct: 241  SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQQQQQAMNSRNNSSSNSGSAANNSSSNTNG 300

Query: 299  XXXXXGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSR 358
                  QR+ +  NDQSNGIYIQNLQEFHITNA+EGL LLQ+GLKHRQVASTKMNDFSSR
Sbjct: 301  ------QRSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSR 354

Query: 359  SHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 418
            SHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV
Sbjct: 355  SHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 414

Query: 419  INALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 478
            INALVD+SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN
Sbjct: 415  INALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 474

Query: 479  IKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNE 538
            IKNKPQLGAF+MKDILVKNITMELAKIKSDLLSTKSKEGIYM+QDHYKNLNSDLES+KNE
Sbjct: 475  IKNKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNE 534

Query: 539  VQECKREIESLTXXXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEI 598
            VQECKREIESL               ETIQSQNSQ+ESLKATI+HL+ QLDKQHK ELEI
Sbjct: 535  VQECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEI 594

Query: 599  SGFNSKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNIL 658
            SGFN+KLQK+TEVMQ+ALQDYK+RELDLNKKFETHI+ EIK++KT LF QL  +QQ+NI 
Sbjct: 595  SGFNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIF 654

Query: 659  QETDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDF 718
            QETDIQPNLD++KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFN IVEKIDII ++F
Sbjct: 655  QETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEF 714

Query: 719  ERFYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENF 778
            + FYKNIAENLSDISEENNNLKQY  NHFF+NNHQELL+HH+DSTYE IEKKTNQFVENF
Sbjct: 715  QNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENF 774

Query: 779  KKALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYN 838
            K  LNDHLEENKKLIM+N+T  TSAVIDQEM LFEP+R KWE+SFDLIN+CDSMNNEFYN
Sbjct: 775  KMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYN 834

Query: 839  SMATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTI 898
            +MA TLSQIK TVDTSSNSMN+SISVMKGQVEESENAISLLKNN KFNDQFKQLI+KH I
Sbjct: 835  NMAATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHII 894

Query: 899  LKDXXXXXXXXXXXXXXXXDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLSKRMP 958
            LKD                DDIYNTIE IM N+GNKENATKDEMI+N+L EIPNLSKR+P
Sbjct: 895  LKDNIESSITSTHSHITNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLP 954

Query: 959  LRISNTNSNSMQNIISPKKHAIEDENSSNGNPDSESSRKILKTE 1002
            LRISN N  S+Q+IISPKKH IEDEN S+ N DSE SRKI KTE
Sbjct: 955  LRISNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 998

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/655 (51%), Positives = 458/655 (69%), Gaps = 4/655 (0%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           DQ+ GIYIQNLQ+FHITNA EG+KLLQKGLKHRQVA+TKMNDFSSRSHTIFTITLYK++ 
Sbjct: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303

Query: 373 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 432
            E+FR+SKMNLVDLAGSENI+RSGA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFR
Sbjct: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363

Query: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 492
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YA+KAKNIKNKPQLG+ IMKD
Sbjct: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423

Query: 493 ILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTXX 552
           ILVKNIT ELAKIK+DLLSTKSKEGIYM+QD+YK L +DLESYK EV+ECKR IE+LT  
Sbjct: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483

Query: 553 XXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVM 612
                       E    Q  ++++++  +  L ++ +KQ+K E  +    S L+     M
Sbjct: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTM 543

Query: 613 QMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKN 672
           Q  +++++RRE D+  K       E   +K T+ S +  ++Q+   +   +Q N+D I+ 
Sbjct: 544 QSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRG 603

Query: 673 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDI 732
           E+  L+E  Q++ + MYKDCV+KIL+E+P  F    EK+  +       ++++ ENLSD+
Sbjct: 604 EISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDV 663

Query: 733 SEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKL 792
           SEE NNL+QY  +HFF+NNH+E+L  H+D TY  I+   +   + FK+ +++HLE+NK L
Sbjct: 664 SEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDL 723

Query: 793 IMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVD 852
           ++++L T T  VI +EM LFEP++ KWE SF  IN+CDS+N  F N + + L  IKST+ 
Sbjct: 724 MLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLG 783

Query: 853 TSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDXXXXXXXXXXX 912
           +S  ++NK+I+ +K Q++E E+  S+L N+  F++QF  ++NK ++L +           
Sbjct: 784 SSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSD 843

Query: 913 XXXXXDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLS----KRMPLRISN 963
                D +   I+ +++  G+     + E ++ +L  +   +     R PLR +N
Sbjct: 844 HADAVDKLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQNLLYLDRSPLRPAN 898

 Score =  285 bits (728), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 155/184 (84%), Gaps = 8/184 (4%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNEREI  KSSVVV+VPD+TGS E+SINTTGD GITAQ+N+K YTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152
           +VFGP A+Q L+F ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELS+S
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMKKL 212
           AGIIPR+L KLF+TLELQ+ DYVVKCSF+ELYNEELKDLL                 +KL
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASS--------RKL 184

Query: 213 RIFD 216
           RIFD
Sbjct: 185 RIFD 188

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/658 (50%), Positives = 463/658 (70%), Gaps = 17/658 (2%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D  +G+YIQNLQ+FHIT+A +GL+LLQKGL++RQVA+TKMNDFSSRSHTIFTITLY++HQ
Sbjct: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331

Query: 373 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 432
            E+F++SKMNLVDLAGSENI+RSGA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFR
Sbjct: 332 GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391

Query: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 492
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTL+YASKAKNIKN+PQL +FIMKD
Sbjct: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451

Query: 493 ILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTXX 552
           ILVKNIT ELAK+KSDLLSTK +EG+YM+QD+YK + +DLESYK E+QE KR IE L+  
Sbjct: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511

Query: 553 XXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVM 612
                       E  + Q  +++++K  +  L  +L+ QHK E E+      L+    + 
Sbjct: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571

Query: 613 QMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQ----RNILQETD---IQP 665
           Q  +++Y +RE  ++++ +  +  E    +  L + +  ++      +IL E +   IQ 
Sbjct: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQ 631

Query: 666 NLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNI 725
           NL++++ EV+ L+   Q++AE MYKD ++KIL E+P  F AI  K+D + V    +++ +
Sbjct: 632 NLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRL 691

Query: 726 AENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDH 785
            ENLSDISE  NNLKQYF +HFF+NNH+E+L+ H+D TY++++   +  ++ FK+ ++DH
Sbjct: 692 TENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDH 751

Query: 786 LEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLS 845
           L++NK L+MK+L + T+  ID+EM LFEP+R KWE SFDLIN CDS++N F   M + LS
Sbjct: 752 LKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALS 811

Query: 846 QIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDXXXX 905
            IKST  +S++ +++S+S +K +V+  E+A ++L  N     Q   +INK + L++    
Sbjct: 812 DIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYK 871

Query: 906 XXXXXXXXXXXXDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNL---SKRMPLR 960
                       D++    E+I N   + EN+T   + +N +   P L   S+R PL+
Sbjct: 872 SIKSSQGHISAFDELK---ERIRNTIAS-ENST---LHQNKIATTPPLGQNSERSPLK 922

 Score =  278 bits (710), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 136/184 (73%), Positives = 152/184 (82%), Gaps = 8/184 (4%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS E++INTT D GITAQMN+K Y VD
Sbjct: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72

Query: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152
           KVFGP A+Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN ELSDS
Sbjct: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMKKL 212
           AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEELKDLLD           +   M+KL
Sbjct: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLD--------DSVENSSMRKL 184

Query: 213 RIFD 216
           RI+D
Sbjct: 185 RIYD 188

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/585 (54%), Positives = 422/585 (72%), Gaps = 4/585 (0%)

Query: 311 PNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKK 370
           P DQS  IYIQNL+EFHIT+AMEGL+LLQKGLK RQVASTKMNDFSSRSH+IFTITLYK+
Sbjct: 302 PIDQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKE 361

Query: 371 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIP 430
              ELFR+SKMNLVDLAGSENI+RSGA+NQRAKEAGSINQSLLTLGRVIN+L DKS HIP
Sbjct: 362 QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIP 421

Query: 431 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIM 490
           FRESKLTRLLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLGAFIM
Sbjct: 422 FRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIM 481

Query: 491 KDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLT 550
           KDILV++IT ELAKIKSDLLSTKSKEG+YM+ +HYK+L+ D+E YK E++E KR IESLT
Sbjct: 482 KDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLT 541

Query: 551 XXXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTE 610
                         +      + I SLK  +  L++ L +Q   E  I      +Q   E
Sbjct: 542 AQNAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANE 601

Query: 611 VMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDII 670
            M+  +  ++ ++ +L +   T I+ EI N++ TL   +  LQ    L++T+I  NL  +
Sbjct: 602 EMKKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRL 661

Query: 671 KNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLS 730
           + EV+ +++  +E+A   Y +CVK +L E+P+ F ++  ++D I    E  +  IAE LS
Sbjct: 662 EKEVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLS 721

Query: 731 DISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENK 790
           D+SEE NNLKQY TN+FF+NNH+ELLSHHV +TY ++E+ + Q ++NF   L+ H++ENK
Sbjct: 722 DVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENK 781

Query: 791 KLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKST 850
           + +++N+   T  VI+ E+ +F  +R KWE S  LIN+CDS+N+ F+ ++ + L +I+  
Sbjct: 782 RHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDV 841

Query: 851 VDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINK 895
           V +S +++  +IS ++ +    ++    ++  I+ ND  +Q I +
Sbjct: 842 VSSSRDNIGATISSIQSRTRNRQS----IEEMIQGNDVIRQQITR 882

 Score =  286 bits (732), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 150/184 (81%), Gaps = 6/184 (3%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           EELNI VAVRCRGRNEREI  KSSVVV+VPD   + E+SINTT D GI A+MN+K YTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152
           KVFGP ASQ L+++E+A PLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+NGEL D+
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMKKL 212
           AGIIPRVL +LFDTLE  ++DY+VKCSF+ELYNEELKDLLD                KKL
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDN------KKL 203

Query: 213 RIFD 216
           RIFD
Sbjct: 204 RIFD 207

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/626 (51%), Positives = 435/626 (69%), Gaps = 7/626 (1%)

Query: 310 APNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK 369
            P++ +NGIYIQNLQEFHITNA EGL LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK
Sbjct: 293 GPDENTNGIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK 352

Query: 370 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHI 429
           +H+D LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+L DKS H+
Sbjct: 353 EHKDNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHV 412

Query: 430 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 489
           PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ I
Sbjct: 413 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVI 472

Query: 490 MKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESL 549
           +KDIL+KNIT ELAK+KSDL+STKSK+GIYM+ +HY+ L  +LES K EVQE KR IE L
Sbjct: 473 LKDILLKNITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKL 532

Query: 550 TXXXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLT 609
           +              E  + Q  ++ +LK ++ +L  +L+ Q+  E ++     +L+K  
Sbjct: 533 SSQNSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSR 592

Query: 610 EVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDI 669
           E +   +++Y+ ++  L  +    +   +  +K  L S    ++Q       D++ NL +
Sbjct: 593 EKLNSLVKNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQSE--GNFDVEMNLKV 650

Query: 670 IKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENL 729
           IK+E+ +++E  Q K E+MYK+ +++ L ++P     I E +  +      +Y  I ENL
Sbjct: 651 IKDEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENL 710

Query: 730 SDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEEN 789
           SDISEE NNLKQY  N FF+NNH++LL+ H+++T + + + + +    FK  ++ HL EN
Sbjct: 711 SDISEEYNNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMEN 770

Query: 790 KKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKS 849
           KKL++ N  T T+ VI +EM LF+PKR KWE S +LIN CDS+NN F+++M   +S+IK+
Sbjct: 771 KKLMIDNFRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKT 830

Query: 850 TVDTSSNSMNKSISVMKGQVEE-----SENAISLLKNNIKFNDQFKQLINKHTILKDXXX 904
            + +SS+S++ +I+ +K QV E       +  + L+N+  FN  F ++I K+ IL+    
Sbjct: 831 NLASSSSSIHNAIASIKSQVLEQLSNDDSDVKTALENDPMFNKHFNEIIEKNMILQKNRK 890

Query: 905 XXXXXXXXXXXXXDDIYNTIEKIMNN 930
                        D++  T++  +NN
Sbjct: 891 NAINYTDKSLLNIDELSETVKIALNN 916

 Score =  279 bits (713), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 139/194 (71%), Positives = 156/194 (80%), Gaps = 13/194 (6%)

Query: 34  ELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDK 93
           ELNITVAVRCRGRNEREI+ KS VVV VPDITG++EISINTTG+TGITAQMN+K YTVDK
Sbjct: 28  ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYTVDK 87

Query: 94  VFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-NGE-LSD 151
           VFGP A QDLIF EVA PLF+DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY NG  LSD
Sbjct: 88  VFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTMLSD 147

Query: 152 SAGIIPRVLLKLFDTLELQQN--------DYVVKCSFIELYNEELKDLLDXXXXXXXXXG 203
           +AGIIPR+L KLFDTL+  ++        D+VVKCSF+ELYNE+LKDLL+          
Sbjct: 148 AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDEQQQQ 207

Query: 204 FD-GQFMKKLRIFD 216
              G   +KLRIFD
Sbjct: 208 QQLGS--RKLRIFD 219

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/590 (51%), Positives = 404/590 (68%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           ++QS+ IYIQNLQEFHITNA +G+ LLQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK H
Sbjct: 255 SEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH 314

Query: 372 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 431
             E+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPF
Sbjct: 315 NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 374

Query: 432 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 491
           RESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG  +MK
Sbjct: 375 RESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMK 434

Query: 492 DILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTX 551
           DILVKNIT ELAKIKSD LSTKSK+GIYM QDHYK L SDLE+YK EVQECKREIE +  
Sbjct: 435 DILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNS 494

Query: 552 XXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEV 611
                        E  + Q  +I+ L   I HL  ++DKQHK E ++      L+     
Sbjct: 495 QNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYT 554

Query: 612 MQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIK 671
           +Q +L++ +  +L    + E  +   + + K ++  QL+ ++  +  +   I  N+DII+
Sbjct: 555 VQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQ 614

Query: 672 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSD 731
            E+  ++E++   +  + + CV+KIL  +PK F +I   +  I    + +   + +NL D
Sbjct: 615 EELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGD 674

Query: 732 ISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKK 791
           ISEE NN ++Y   H F+NNH+E LS HVD TY  ++K   +    FK+ ++ HLEENK 
Sbjct: 675 ISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKS 734

Query: 792 LIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTV 851
           L++K+L T +  V+ +E+ LF P + KWE S + IN+CDS+NN F +++   L +++  +
Sbjct: 735 LMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNI 794

Query: 852 DTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKD 901
           + S      +   +K  +++ +    +LKNN K  +   ++  KHT L+D
Sbjct: 795 EGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRD 844

 Score =  293 bits (750), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 153/184 (83%), Gaps = 8/184 (4%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           +ELNITV+VRCRGRNEREI  KSSVVV VPD+TGS E+SINTT + GITAQMN+K YTVD
Sbjct: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74

Query: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152
           KVFGP A Q LIF ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELSD+
Sbjct: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMKKL 212
           AGIIPR+L KLFDTLE Q  DY+VKCSFIELYNEELKDLL+           +   +KKL
Sbjct: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQ--------ESGVIKKL 186

Query: 213 RIFD 216
           RIFD
Sbjct: 187 RIFD 190

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/588 (49%), Positives = 422/588 (71%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D+  GIYIQNL+EFHIT+A EG++LLQ+GL++RQVASTKMNDFSSRSHTIFTI LYK+H 
Sbjct: 298 DKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHD 357

Query: 373 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 432
            ++FRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPFR
Sbjct: 358 GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR 417

Query: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 492
           ESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLG+ I KD
Sbjct: 418 ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD 477

Query: 493 ILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTXX 552
           ILVKNI  ELAK+K+DLLSTKS++G+YM+Q HYK L +DLESYK EVQECKR I+ LT  
Sbjct: 478 ILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQ 537

Query: 553 XXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVM 612
                       E    Q  +++S+K +I HL   ++KQH+ E  +     KL+  +  M
Sbjct: 538 NGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEM 597

Query: 613 QMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKN 672
           Q  ++ +  RE     K +     E+  +K+ L   L  + ++ ++  TD+  N++ IK+
Sbjct: 598 QATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKD 657

Query: 673 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDI 732
           EV ++++T Q +A  +YKDC+++++ ESP    ++ + I  +    + + + ++ ++S++
Sbjct: 658 EVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISEL 717

Query: 733 SEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKL 792
           + E+N+LKQY    FF+++H+E+L+ H++ TY+ I + +   VE  K  L  +LEE++ +
Sbjct: 718 NIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNI 777

Query: 793 IMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVD 852
           I+ +L  TTS ++  EM LF PK+ KWE SF++IN+CDS+NN+++  ++  LS +K++V 
Sbjct: 778 IIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVT 837

Query: 853 TSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILK 900
           ++S+ ++  +S M+   + +  +  L +N+ +   QF +++ K++ L+
Sbjct: 838 STSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLE 885

 Score =  283 bits (723), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 150/184 (81%), Gaps = 7/184 (3%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           +ELNI VAVRCRGRNEREI  KSSVVV+VPD+ GS EI+INTT D GI  QMN+K YTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152
           KVFGP A+Q LIF+EVA PLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LYNGELSDS
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMKKL 212
           AGIIPRVL KLFD +E Q +DY++KCSFIELYNEELKDLLD                KKL
Sbjct: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTA-------KKL 183

Query: 213 RIFD 216
           RIFD
Sbjct: 184 RIFD 187

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/596 (51%), Positives = 416/596 (69%), Gaps = 6/596 (1%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D +NGIYIQNLQEFHI+NA EGL LLQKGLK+RQVASTKMNDFSSRSHTIFTITLYK+H
Sbjct: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEH 400

Query: 372 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 431
           Q  LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+L D++ HIPF
Sbjct: 401 QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPF 460

Query: 432 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 491
           RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG+ I K
Sbjct: 461 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISK 520

Query: 492 DILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTX 551
           DIL+KNIT EL+++KSDLLSTKSKEGIYM+Q+HY+ L ++L+++K E  E KR IE L+ 
Sbjct: 521 DILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSS 580

Query: 552 XXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEV 611
                        E  + Q  ++   + +I+ L+ +++ Q+  E  +    SKLQ   + 
Sbjct: 581 QNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDT 640

Query: 612 MQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIK 671
            +  +++Y+ +++D+  K E  +  ++ +++  L    + ++  N   + DI  NLD+I+
Sbjct: 641 FKKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQ 700

Query: 672 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSD 731
           NEV+ ++ T QEKAE  YK  ++  L ++P+ F  I E I+ I +  +  +  +A+NLSD
Sbjct: 701 NEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSD 760

Query: 732 ISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKK 791
           ISEE NNLKQY   + F+NNH++L++ H++ST + +    +     FK  +N HLE N+ 
Sbjct: 761 ISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRN 820

Query: 792 LIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTV 851
           L++ +    T  VI++EM LF P++ KWE S DLIN+CDS+NN F   +   LS  +S +
Sbjct: 821 LMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKI 880

Query: 852 DTSSNSMNKSISVMKGQVEE------SENAISLLKNNIKFNDQFKQLINKHTILKD 901
             S N M  + + +K ++        S N  +++++N     QF +L  K++I +D
Sbjct: 881 TASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQD 936

 Score =  296 bits (758), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 135/159 (84%), Positives = 145/159 (91%)

Query: 35  LNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKV 94
           LNITVAVRCRGRNEREI +KSSV+V VPDI GS E+SINTT D GITAQMN+K YTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 95  FGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAG 154
           FGP A+Q LIFDEVA PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS+SAG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 155 IIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD 193
           IIPR+L KLFDTLE+ Q DYVVKCSFIELYNE+LKDLL+
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLN 210

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/684 (46%), Positives = 449/684 (65%), Gaps = 22/684 (3%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           N+QS+ IYIQ+LQEFHIT+A EGL+LLQKGL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322

Query: 372 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 431
             E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPF
Sbjct: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382

Query: 432 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 491
           RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLG+F+MK
Sbjct: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442

Query: 492 DILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTX 551
           DILVKNI+ ELAK+KSD LSTKSKEGIYM+  HY  + +D+E+YK E+QE +REIE L+ 
Sbjct: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502

Query: 552 XXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEV 611
                        +TI+SQ  QI +L++++D+L  ++D +HK E+E++    KL+     
Sbjct: 503 QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562

Query: 612 MQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIK 671
           MQ AL+ ++  E  L    +  +   I   +  + ++L  L+Q+ + Q   I  +++ +K
Sbjct: 563 MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622

Query: 672 NEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSD 731
           + + TL+ET+++ A +M ++  +K++ + PKFFN+++ +++ +    +     + E LS 
Sbjct: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682

Query: 732 ISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKK 791
           I+ ENNNLK Y   HFFRNNHQE+L+ H D TY ++   +   +      ++DH+E+N+ 
Sbjct: 683 ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742

Query: 792 LIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTV 851
           L+M  L T T+ VI QEMS FEP R  WE SF+ IN CDS++N+F +    +L+ +KS +
Sbjct: 743 LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802

Query: 852 DTSSNSMNKSISVMKGQVEES------ENAISLLKNNIKFNDQFKQLINKHTILKDXXXX 905
           +++     +  S++  +++++       N I+ +  NI  N     + NKH++L+D    
Sbjct: 803 ESTV----RESSLIADKIKDNLCHFQDRNDIANMTTNI--NGTVDDIKNKHSVLRDELEK 856

Query: 906 XXXXXXXXXXXXDDIYNTIEKIMN---NYGNKENATKD--EMIENLLNEIPNLSKRMPLR 960
                         I +++++IMN     G  E    D  + I++        S + PLR
Sbjct: 857 NVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHIDSSSVAPVASSGKTPLR 916

Query: 961 I---SNTNSNSMQNIISPKK--HA 979
               S T   S+   +SP K  HA
Sbjct: 917 PLLKSETKQRSLSKSVSPAKSSHA 940

 Score =  294 bits (753), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 157/186 (84%), Gaps = 10/186 (5%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           +ELNITVAVRCRGRNE+EI  KSSVVVN PD+ G+ E+SINT+GD GITA+MN+K YTVD
Sbjct: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70

Query: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152
           KVFGP A Q L+F E+A P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELS++
Sbjct: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFD--GQFMK 210
           AGIIPRVL KLFDTLE+Q++DY+VKCSFIELYNEELKDLLD         G D  G   +
Sbjct: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLD--------DGQDSGGNNSR 182

Query: 211 KLRIFD 216
           KLRI+D
Sbjct: 183 KLRIYD 188

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/562 (53%), Positives = 394/562 (70%), Gaps = 21/562 (3%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           DQ+ GIYIQNLQEFHIT A EG+KLLQKGLK+RQVASTKMNDFSSRSHTIFTITL+K+ +
Sbjct: 285 DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK 344

Query: 373 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 432
            E+FR+SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN+L DK+ H+PFR
Sbjct: 345 GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404

Query: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 492
           ESKLTRLLQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLG+FIMKD
Sbjct: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464

Query: 493 ILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTXX 552
           IL+KNIT EL KIKSDLLSTKSK+GIYM+Q HYK L +DL++YK E+QECKR IESLT  
Sbjct: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524

Query: 553 XXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISG-------FNSKL 605
                       E  + Q  +I+++  ++  L  ++++Q   E E+ G        NSKL
Sbjct: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL 584

Query: 606 QKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQP 665
            K+ + M       K RE  +N KF+T +   +  +   L  Q+   + + I Q   +  
Sbjct: 585 TKIIDEM-------KNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDE 637

Query: 666 NLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNI 725
           NL +IK+E+  L+ T ++  E  Y++C+ K L+++P  F+ I + +  +      +Y  I
Sbjct: 638 NLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQI 697

Query: 726 AENLSDISEENNNLKQYFTNHFF---RNNHQELLSHHVDSTYEKIEKKTNQFVENFKKAL 782
           AENLSD+SEE NN KQ+ T+ F+   + +  ELL+ ++++T   IE  +N  +   +  L
Sbjct: 698 AENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLL 757

Query: 783 NDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYN---- 838
           N+HL  NK+LI+ +L+  T+ ++  E+   +PK  KWE S +LIN  D++NNEF +    
Sbjct: 758 NEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVES 817

Query: 839 SMATTLSQIKSTVDTSSNSMNK 860
           SM T   +IK T D+ +N++ K
Sbjct: 818 SMTTMTDKIKQTNDSINNNIKK 839

 Score =  290 bits (742), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 152/184 (82%), Gaps = 6/184 (3%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRN+REI  KSSVVV VPDI GSKE++INT+ D G TAQMN+K YTVD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152
           KVFGP A+Q LIFDE+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN ELSDS
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMKKL 212
           AGIIPR+L KLF+TLE    D++VKCSF+ELYNEELKDLL            +G F KKL
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNND-----NGNF-KKL 188

Query: 213 RIFD 216
           RIFD
Sbjct: 189 RIFD 192

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  544 bits (1402), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 299/678 (44%), Positives = 427/678 (62%), Gaps = 8/678 (1%)

Query: 309 LAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLY 368
           ++P + S+ I+IQNLQEFHI +A EG++LLQ+GL+HRQVASTKMND SSRSHTIFTI LY
Sbjct: 229 VSPCEPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY 288

Query: 369 KKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGH 428
           KK   E FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DKS H
Sbjct: 289 KKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLH 348

Query: 429 IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAF 488
           IPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+F
Sbjct: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSF 408

Query: 489 IMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIES 548
           IMKD+L+K++T EL KIKSDLLSTKSK+GIYM+Q++YK L ++LE+YK EV+ECKR +E 
Sbjct: 409 IMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEK 468

Query: 549 LTXXXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKL 608
           ++              E  +SQ  ++  L   I+ L  ++D+QHK E E+S    +L + 
Sbjct: 469 VSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRA 528

Query: 609 TEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLD 668
              MQ +L+ Y+ +    + + E  +   I + K +L  ++  L+        D++ N+D
Sbjct: 529 LHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVD 588

Query: 669 IIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAEN 728
            +  E+  + + M      ++++ +KK+ +++P +F  I  +++ I      +  N+  +
Sbjct: 589 AVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIH 648

Query: 729 LSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEE 788
           LS ISEE NNLK Y   HFF+NN QE L  HVD TY +++   N      ++ LN+ L+ 
Sbjct: 649 LSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDT 708

Query: 789 NKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIK 848
           NK+ +M++L    S V+ +EM L +P +  WE+S + INECD +NN F N +  T+++I 
Sbjct: 709 NKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIF 768

Query: 849 STVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDXXXXXXX 908
            T+D    +   +    K ++     A S L+NN         +  KH +LK        
Sbjct: 769 KTIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSAN 828

Query: 909 XXXXXXXXXDDIYNTIEKIMNNYGNKENATKDEMIENLLNEI------P-NLSKRMPLRI 961
                     +I N+I+ ++N     +  +++  I+ LL ++      P   S + P+R 
Sbjct: 829 YMQAATQKFGEIDNSIQDLLNAQTIPQPQSENP-IDGLLEQLNDKSLKPLGPSGKTPMRT 887

Query: 962 SNTNSNSMQNIISPKKHA 979
              +  +   ++ P+K +
Sbjct: 888 VQRSVTNTDQLLPPQKSS 905

 Score =  295 bits (755), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 153/185 (82%), Gaps = 8/185 (4%)

Query: 32  NEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91
           +EELNITVAVRCRGRNE+E+  +SSVVV VPD+TG+ E+SINTTGDTGITAQ+N+K YTV
Sbjct: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63

Query: 92  DKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           DKVFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+
Sbjct: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123

Query: 152 SAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMKK 211
            AGIIPRVL KLFD L  Q +DY++KCSFIELYNEELKDLLD           D    KK
Sbjct: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETP--------DSSMPKK 175

Query: 212 LRIFD 216
           LRIFD
Sbjct: 176 LRIFD 180

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  521 bits (1342), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 280/596 (46%), Positives = 402/596 (67%), Gaps = 26/596 (4%)

Query: 304 GQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIF 363
           G +  + P     GIYIQNL++FHI+ A EGL+LLQ+GL+ RQVA+TK+ND SSRSHTIF
Sbjct: 258 GGKTHVPPT--QTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIF 315

Query: 364 TITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 423
           TITLYKK +D+L+R+SK+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGRVIN+L 
Sbjct: 316 TITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLA 375

Query: 424 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 483
           DKS HIPFRESKLTRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKP
Sbjct: 376 DKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKP 435

Query: 484 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECK 543
           QLG+FI+KDIL+K+++ EL K+++DL  TKSKEGIY++Q +YK +  DL+++K E+ E K
Sbjct: 436 QLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELK 495

Query: 544 REIESLTXXXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNS 603
           R  +SL               E       + +SLK+ +D+LR+QL        + +  N+
Sbjct: 496 RTNDSLVQENELLGKEKKSGAE-------RADSLKSELDNLRSQLKSVTNKLAQTNTQNT 548

Query: 604 KL-QKLTEV------MQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRN 656
           KL +++T++      ++  ++ Y+++      KF+  +  E+  +   + SQ  TL+  N
Sbjct: 549 KLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVN 608

Query: 657 ILQETDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKI-DIIG 715
                 I  ++D I+ EV+ L+ET +E AE +YK C+  +L E+PK F  I + + DI G
Sbjct: 609 S-GNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRG 667

Query: 716 VDFERFYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFV 775
           +  E  Y  +A N SD+SEE N  KQY    FF+NNH E++  H D     ++K ++  +
Sbjct: 668 M-TEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLL 726

Query: 776 ENFKKALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNE 835
           ++ + ++ ++L  N +++  ++      VI++EM LF PK+ KWE S DLIN+ DS++N+
Sbjct: 727 QSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNK 786

Query: 836 FYNSMATTLSQIKSTVDTSSNSMNKSISVMKGQVEESE-------NAISLLKNNIK 884
           F N+M  ++  I S +  S+ SM++SIS +K  + E++       N+  LL N+ K
Sbjct: 787 FRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFK 842

 Score =  218 bits (555), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 107/171 (62%), Positives = 138/171 (80%), Gaps = 5/171 (2%)

Query: 24  QIG-CHTVHNEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITA 82
           +IG    +  +++NITVAVRCRGRN+REI  KS +VV VPD+T + E+SINT+G +GI A
Sbjct: 13  EIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEA 72

Query: 83  QMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD- 141
           Q+ AK YTVDKV+GP +SQ L+F++ A PLF DF++GYNCT+LVYGMTSTGKTYTMTGD 
Sbjct: 73  QLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDV 132

Query: 142 EKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
           E    G+++  AGI PR+L+KLF+ L   Q+DYVVKCSF+ELYNE+L+DLL
Sbjct: 133 EMGAEGDVNGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLL 180

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  514 bits (1324), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 267/587 (45%), Positives = 395/587 (67%), Gaps = 7/587 (1%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           +QS+ IYIQNLQEFHITNA EG+ +LQKGLKHRQVASTKMNDFSSRSHTIFTI LYK ++
Sbjct: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301

Query: 373 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 432
            ELFRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DKS HIPFR
Sbjct: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361

Query: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 492
           ESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLG+F+MKD
Sbjct: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421

Query: 493 ILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTXX 552
           ILVK+I+ EL+K+KSD LSTK+KEGIYM+ +HY+ + +DLE+Y+ E+QE KR++ES +  
Sbjct: 422 ILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481

Query: 553 XXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVM 612
                       +  + Q+ +I  L+ TI++L  ++++QH+ E+++     KL++    M
Sbjct: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541

Query: 613 QMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKN 672
           + +LQ+Y+  EL L    +  +   I + + ++   L T++ R + +   I  N+D I+ 
Sbjct: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601

Query: 673 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDI 732
                +++++     M  + VK + ++    +    E +  +    + +   +   L+++
Sbjct: 602 IFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEM 661

Query: 733 SEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKL 792
           +EENNN+K+Y   HF +NN+QE+L   ++  Y K +  ++  + +    +  H+EE++ L
Sbjct: 662 TEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNL 721

Query: 793 IMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVD 852
           ++ ++    S +ID+E+ +F+P + +W  SF+ INECD+ + +F N     L+ +K   D
Sbjct: 722 MLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELAD 781

Query: 853 TS-------SNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQL 892
            S       +  + ++++  +G V ++    S++K     ND+ K L
Sbjct: 782 NSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKML 828

 Score =  293 bits (750), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 135/185 (72%), Positives = 152/185 (82%), Gaps = 10/185 (5%)

Query: 32  NEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91
           NEELNITVAVRCRGRNEREI  KS+VVV VPD+TGS E+SINTTGD GI  +MN++ YTV
Sbjct: 18  NEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTV 77

Query: 92  DKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           D+VFGP A Q LIF  +A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELSD
Sbjct: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137

Query: 152 SAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMKK 211
           SAGIIPRVL +LFDTLE  ++D++VKCS+IELYNEELKDLLD              + K+
Sbjct: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDT----------PDYSKR 187

Query: 212 LRIFD 216
           LRIFD
Sbjct: 188 LRIFD 192

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  513 bits (1321), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 287/671 (42%), Positives = 414/671 (61%), Gaps = 9/671 (1%)

Query: 316 NGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 375
           + I+IQNLQEFHI +A EG++LLQ+GL+HRQVASTKMND SSRSHTIFTI LY+K   E 
Sbjct: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGES 294

Query: 376 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESK 435
           FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPFRESK
Sbjct: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 354

Query: 436 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILV 495
           LTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMKD+LV
Sbjct: 355 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLV 414

Query: 496 KNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTXXXXX 555
           KN+T EL KI+SDLL+TKSK+GIYM+Q++YK L ++LE+YK EVQECKR IE L+     
Sbjct: 415 KNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGL 474

Query: 556 XXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVMQMA 615
                    E  +SQ  +I+ L   ID L  ++D+QHK E E+S    +L +    MQ +
Sbjct: 475 LTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNS 534

Query: 616 LQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKNEVL 675
           L+ Y+ +      + E  +   I + K +L +++  L+        D+  N+D +  E+ 
Sbjct: 535 LKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTE-EDGFDVDANIDTLTKELN 593

Query: 676 TLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDISEE 735
            + + +      + +  + KI  ++P +   I  +++ I      +  ++  +LS ISEE
Sbjct: 594 RIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEE 653

Query: 736 NNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKLIMK 795
            N+LK Y   HFF+NN Q+ L  HVD TY +++   N      ++ +N+ LE NK+++M+
Sbjct: 654 YNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQ 713

Query: 796 NLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVDTSS 855
           +L    S V+ +EM L +P +  WE S + INECD +N+ F   + + +  +   ++   
Sbjct: 714 SLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGL 773

Query: 856 NSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDXXXXXXXXXXXXXX 915
                ++      +   ++A   L+ +       +++  KH +LK               
Sbjct: 774 QFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQ 833

Query: 916 XXDDIYNTIEKIMNNYGNKENATKDEMIENLLNEI---P----NLSKRMPLRISNTNSNS 968
              +I ++I+ ++N+    +  +++  IE LL ++   P      S + P+RI+     S
Sbjct: 834 KFGEIDDSIQGLLNSQAVSQPHSENR-IEGLLEQLNGKPLKPLGPSGKTPMRITQGCIAS 892

Query: 969 MQNIISPKKHA 979
              +  P+K +
Sbjct: 893 SDQLSLPRKRS 903

 Score =  292 bits (748), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 152/184 (82%), Gaps = 8/184 (4%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNE+E+  KSSVVV VPD+TG+ E+SINTTGDTGITAQ+N+K YTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152
           +VFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+ 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMKKL 212
           AGIIPRVL KLFD L+   +DY++KCSFIELYNEELKDLLD           D    +KL
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETP--------DSSMPRKL 176

Query: 213 RIFD 216
           RIFD
Sbjct: 177 RIFD 180

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  514 bits (1325), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 292/603 (48%), Positives = 396/603 (65%), Gaps = 24/603 (3%)

Query: 310 APNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK 369
           AP D +N IYIQNLQEF+I NA +G+KLLQKGL+HR+VASTKMND SSRSHTIFTITLYK
Sbjct: 327 AP-DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK 385

Query: 370 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHI 429
           +H   L+R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVIN+L DKS HI
Sbjct: 386 EHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHI 445

Query: 430 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 489
           PFRESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG+FI
Sbjct: 446 PFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFI 505

Query: 490 MKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESL 549
           MKD+L+KNIT EL KIKSDL+ST+ K+G+YM+Q HYK LN+DLESYK EVQE KR  E L
Sbjct: 506 MKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERL 565

Query: 550 TXXXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLT 609
                          E  + Q  QIE     I  L   LD+ +K E  +     +L+ + 
Sbjct: 566 ISQNGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVG 625

Query: 610 EVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNI------------ 657
             MQ  +++Y+ R+L++ +  +  +  E K +K  L   LS +    I            
Sbjct: 626 TSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNS 685

Query: 658 ----LQETDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDI 713
               +  ++ Q N+DII+N  L +++ +QEK++ +Y  C+++IL++ P   N    KI+I
Sbjct: 686 SIEAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKF--KIEI 743

Query: 714 IGVDFE---RFYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKK 770
             +DF+   +F K I ENLSD+SEE NN K+Y  N F +NN++ +L +H++S   +IE  
Sbjct: 744 NSIDFQYNDQFNK-ITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESF 802

Query: 771 TNQFVENFKKALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECD 830
           +N  + N  K +N+    N KL  + L    + ++ +E    +P + KW  S ++IN  D
Sbjct: 803 SNNLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTD 862

Query: 831 SMNNEFYNSMATTLSQIKSTVDTSSNSMNKSISVMK-GQVEESENAISLLKNNIKFNDQF 889
            +NN F+N M   + QI + +  S N +N SI+ +K  ++ E+E    +L +N ++ +  
Sbjct: 863 KINNTFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYVNNI 922

Query: 890 KQL 892
            +L
Sbjct: 923 NEL 925

 Score =  291 bits (746), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 134/184 (72%), Positives = 154/184 (83%), Gaps = 9/184 (4%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNERE+  KSSVVV+VPDI GS E+SINT+ + GI A MN+K YTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152
           KVFGP ASQDL+F E+A PLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELSDS
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMKKL 212
           AGIIPRVL KLF++ E+  +DY++KCSF+ELYNE+LKDLLD           D  + KKL
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLD--------DSVDNTY-KKL 179

Query: 213 RIFD 216
           RIFD
Sbjct: 180 RIFD 183

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  510 bits (1313), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 273/591 (46%), Positives = 392/591 (66%), Gaps = 2/591 (0%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           ++  +GIY+QN+QEFHI NA EG+ +LQKGLKHRQVASTKMNDFSSRSHTIFTI LYK  
Sbjct: 242 SESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNC 301

Query: 372 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 431
             ELFR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DKS HIPF
Sbjct: 302 DGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 361

Query: 432 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 491
           RESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLGA +MK
Sbjct: 362 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMK 421

Query: 492 DILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTX 551
           DILVKNI+ ELAKIKSD LSTKSK+GIYM+ +HY+ + +DLE+ + E+QE KR+IESLT 
Sbjct: 422 DILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTS 481

Query: 552 XXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEV 611
                        E  + QNS+I+ L++TI++L  ++++QH  E E++    KL++    
Sbjct: 482 QNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHT 541

Query: 612 MQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIK 671
           MQ +L+ Y+  EL L    +  +   I + + ++   L  ++   + +   I+ N++ I 
Sbjct: 542 MQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNIT 601

Query: 672 NEVLTLMETMQEKAELMYKDCVKKILNESPK-FFNAIVEKIDIIGVDFERFYKNIAENLS 730
                 +++++     M  D + K++ E+P  +     E +  +  +   +   +   L+
Sbjct: 602 TIFDDTLKSVEANGSDMC-DTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLT 660

Query: 731 DISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENK 790
           +ISEENN+L++Y   H F+N+ QE+L   ++S Y+K++  ++Q +      +  H+EE++
Sbjct: 661 EISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESR 720

Query: 791 KLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKST 850
            L++ ++  T + +ID E SLF+P R +W  S D IN+CD+ +  F     + L ++K  
Sbjct: 721 TLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKEL 780

Query: 851 VDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKD 901
            D S  S   +++  K + +   + +  L  +     Q   + +KH +L+D
Sbjct: 781 SDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLED 831

 Score =  286 bits (733), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 132/184 (71%), Positives = 149/184 (80%), Gaps = 10/184 (5%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNEREI  KSSVVV VPD+TGS E+SINTT + GI A+MN++ YTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152
           KVFGP A Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+LSDS
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMKKL 212
           AGIIPR++ KLFD LE   +D++VKCS+IELYNEELKDLLD                K+L
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS----------KRL 188

Query: 213 RIFD 216
           RIFD
Sbjct: 189 RIFD 192

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  509 bits (1310), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 276/619 (44%), Positives = 410/619 (66%), Gaps = 6/619 (0%)

Query: 317 GIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 376
            IYIQNL+EFHI NA EG++LLQKGLK+RQVASTKMND SSRSHTIFTI LYK+H+ E+F
Sbjct: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296

Query: 377 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKL 436
           +ISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN++ DK+ HIPFRESKL
Sbjct: 297 KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKL 356

Query: 437 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVK 496
           TRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLG+ IMKD+ +K
Sbjct: 357 TRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLK 416

Query: 497 NITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTXXXXXX 556
           ++  ELAKIK DL STK K+G+YM Q+HYK+L +DLESYK E+QEC R ++SL       
Sbjct: 417 DLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALL 476

Query: 557 XXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVMQMAL 616
                   E  + Q   +  +  T+ +++T L+ QHK E  +    +  ++ +  M+  +
Sbjct: 477 LKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVI 536

Query: 617 QDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKNEVLT 676
           ++Y  +E  +    ++    E+  +K  L   L+ + + N++ +T+++ N+ +IK++V++
Sbjct: 537 KEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDVIS 596

Query: 677 LMETMQEKAELMYKDCVKKILNESP---KFFNAIVEKIDIIGVDFERFYKNIAENLSDIS 733
           ++   QE ++ ++ +  ++I+ E+P   + F++ V+K   +    E ++ N+ ENL  I 
Sbjct: 597 IVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELN---ETYFANLFENLESIK 653

Query: 734 EENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKLI 793
           ++ + L +YF+N FF++NH  +++ HV++T   IEK  +   + F++ +    E+N+KLI
Sbjct: 654 QQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLI 713

Query: 794 MKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVDT 853
           ++NL T +S +I  EM+ F+  + +W+ SF  IN CD +NN +++ M T L  +K  + +
Sbjct: 714 LENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQS 773

Query: 854 SSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDXXXXXXXXXXXX 913
           S   + K ++ +K  V+   +   LL  +    D + Q+I+K   L D            
Sbjct: 774 SDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNS 833

Query: 914 XXXXDDIYNTIEKIMNNYG 932
               D+I  +I+    NY 
Sbjct: 834 LLVFDEICKSIQFAFANYS 852

 Score =  279 bits (713), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 130/186 (69%), Positives = 154/186 (82%), Gaps = 11/186 (5%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGD--TGITAQMNAKRYT 90
           +E+NI VAVRCRGRN+REI  KSSV+V+VPD+ GS EISINT+ D  +G+TAQ+N+K YT
Sbjct: 13  DEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72

Query: 91  VDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150
           VDKVFGP A+Q LIF+E+A PLF DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY G+LS
Sbjct: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132

Query: 151 DSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMK 210
           DSAGIIPRVL KLF+T+E Q ++YV+KCSFIELYNEELKDLL            +   +K
Sbjct: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLL---------IDSNNTKLK 183

Query: 211 KLRIFD 216
           KLRIFD
Sbjct: 184 KLRIFD 189

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  404 bits (1039), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 216/589 (36%), Positives = 367/589 (62%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           +++   YIQNL+EFHITNA EG++LL +GLK+RQ+AS+K   +SSR+ TIFTI LYK+ +
Sbjct: 252 EKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEE 311

Query: 373 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 432
            E+FR+SK N VDLAG+E+ ++    NQR K+   INQ +  L +++N+L +K   IPF+
Sbjct: 312 GEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFK 371

Query: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 492
           +SKLT L++D+L GN+K+  I T+   K + +E   TLE+ +K +++K  P LG  I K+
Sbjct: 372 DSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKE 431

Query: 493 ILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTXX 552
            L+K+I+ ELAK+KSDLLSTKSKEG+YM+ +HY  L  DL+ +K E+ + K+ I+ L   
Sbjct: 432 TLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQ 491

Query: 553 XXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVM 612
                       E  + Q  +++S++ ++  + T ++KQ + E ++     KL++    M
Sbjct: 492 STTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNM 551

Query: 613 QMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKN 672
            + +  Y  RE  +  + +T    E+  +K+ L   L   ++  ++   +I+ NL+    
Sbjct: 552 NVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKAHE 611

Query: 673 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDI 732
           E+  +++  + + + ++ DC+KK+  ESPK F++ ++ +  +       Y N+AE LSD+
Sbjct: 612 EIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDV 671

Query: 733 SEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKL 792
           SEE NNLKQY    FF+NNH+ELL  +V+ TY +++K ++ F+  F   L  +LE NK +
Sbjct: 672 SEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSV 731

Query: 793 IMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVD 852
           +++N+ + TS VI+ EM+ F P++ KWE S +LI +    +NEF       + +++ T+ 
Sbjct: 732 LLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLK 791

Query: 853 TSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKD 901
            +S S+  ++S MK ++ E + A ++++NN    ++F  ++ K+ ILKD
Sbjct: 792 GTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKKNGILKD 840

 Score =  127 bits (318), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 104/187 (55%), Gaps = 20/187 (10%)

Query: 34  ELNITVAVRCRGR--NEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91
           E NI V  R +G+  NE+   ++  +++  P +   K        D  +      + + +
Sbjct: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFK------GKDDAV-----KREFGM 60

Query: 92  DKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLYNGELS 150
           D +F     Q+ ++ +   P+FQDFI GYNC+ LVYG T +GKTYT++G+E  L + E S
Sbjct: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120

Query: 151 D-SAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFM 209
             S G+IPRVL +LFD L     D+VVKCS++E+YNEELKDLL                +
Sbjct: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLL-----VDQHNSLLSASI 175

Query: 210 KKLRIFD 216
           KKLRI D
Sbjct: 176 KKLRIVD 182

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  313 bits (803), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 226/653 (34%), Positives = 368/653 (56%), Gaps = 39/653 (5%)

Query: 316 NGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVAST----KMNDFSSRSHTIFTITLYKKH 371
           N IYIQNLQE  IT   EG+ +++KGLK+R++AST      N+FS RSH+IF ITLYK+ 
Sbjct: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329

Query: 372 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIP 430
           + +E+FR+SK++ V+ AGSE  + + + N      G+ N +L +  ++IN +V+ S +  
Sbjct: 330 EVNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYAS 383

Query: 431 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIM 490
           F +SKLT+LLQ++  G T+T  IA I+P K   + TCS L  A+K K IKN+P+ G+ I 
Sbjct: 384 FLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVIT 443

Query: 491 KDILVKNITMELAKIKSDLLSTKSKE-GIYMNQDHYKNLNSDLESYKNEVQECKREIESL 549
           K+ L+K ++ EL K KSDLLS KS + GIYM++ HY  L   LESYK ++Q  K  I  L
Sbjct: 444 KESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINEL 503

Query: 550 TXXXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLT 609
           T              E  + Q  ++++L+ TI +L   L+KQ K E E+     KL  + 
Sbjct: 504 TKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSIL 563

Query: 610 EVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDI 669
             MQ +++ Y  +E+ L  K +     E+  +K +L S  + ++ R      ++  N+D 
Sbjct: 564 GNMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDN 623

Query: 670 IKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENL 729
           IK E+L +    Q K + +  +   ++L+ SPK+F  +   +  +    E  +   +E L
Sbjct: 624 IKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELL 683

Query: 730 SDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEEN 789
           SDISEE NNL  Y  ++F +++H+EL+  +++ TY +++  + +F ENFKK L+ ++E+N
Sbjct: 684 SDISEEFNNLNNYINDNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKN 743

Query: 790 KKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLI----NECDSMN-NEFYNSMATTL 844
            K + K++T+ TS +++ E++ F P++ KWE + + I    NE  + N N+    +A  L
Sbjct: 744 TKSLSKSITSLTSEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSEILAKLL 803

Query: 845 SQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDXXX 904
           S+  ST +   N+M    S +K  VE  E    +  +N     +F ++INK+  LKD   
Sbjct: 804 SESTSTSELFINNM----SSIKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLIT 859

Query: 905 XXXXXXXXXXXXXDDIYNTIEKIMNNYGN----KENATKDEMIENLLNEIPNL 953
                         D +N+ E  ++++ N     +N  K+EM E+  N+  NL
Sbjct: 860 --------------DNFNSSENSIDSFDNLKEAMQNVFKNEMKESYSNDTLNL 898

 Score =  121 bits (304), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 102/189 (53%), Gaps = 14/189 (7%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPD-ITGSKEISINTTGDTGITAQMNAKRYTVDKV 94
           NITVAVRCR   + E    S  ++++ D   G+    I     TG       K YT+D V
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63

Query: 95  FGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYNGELS 150
           +G    Q  +FDE   P ++ F  GYN +++ YG   +GK YT+ G+    +   N E S
Sbjct: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-S 122

Query: 151 DSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL---DXXXXXXXXXGFDGQ 207
           ++ G++PRVL +LF  LE   ND+++KCSF+E+YN+EL+DLL             G  G 
Sbjct: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATGS 182

Query: 208 FMKKLRIFD 216
             KKLRI D
Sbjct: 183 TGKKLRIVD 191

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  263 bits (672), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 182/498 (36%), Positives = 278/498 (55%), Gaps = 52/498 (10%)

Query: 310 APNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTIT--- 366
           +PN  S  I+++ ++E +I +A EGLKLL  G   R+VA+TK ND SSRSHTIFTIT   
Sbjct: 245 SPNGYS--IFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNV 302

Query: 367 --LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 424
             ++    ++  ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD
Sbjct: 303 TKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 362

Query: 425 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 484
            S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN PQ
Sbjct: 363 HSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQ 422

Query: 485 LGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKR 544
           +   + K+  +     E+ +++ +L ++ SKEGIY+ Q+ ++      ES    V+E + 
Sbjct: 423 VNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFET----YESNSILVEEQQA 478

Query: 545 EIESLTXXXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSK 604
           +I++L               + I+ ++ QI+ L       R  L++     + I+G +SK
Sbjct: 479 KIDNLQEQLRRLKEKFLEQTKLIKEKDGQIKELDVAN---RKYLEQSKDLTIYINGIHSK 535

Query: 605 LQKLTEVMQMALQDYKRRELDL---NKKFETHITTEIKNMKTTLFSQLSTLQQRNILQET 661
                      L+DY+   + +   N K    I     N+   L +++  ++  N++   
Sbjct: 536 -----------LEDYEHTMIGIHNNNMKLLEDINDNRGNIHEDLLAKVDHIETCNLIISR 584

Query: 662 DI----------QPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKI 711
           +I          Q   D  K  +  + E +QEK   + +   +  L+    F +   E++
Sbjct: 585 EITSLISIRNVLQAYSDRFKTVLGGVFEELQEKLTQVGRTTEESQLDVDLSFVDEKFEEV 644

Query: 712 -DIIGVDFERFYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKK 770
            DII    E   + + E++S++  E  +L     +         LL     + + K++K 
Sbjct: 645 TDIIKATCENLVRTMDEHVSNMKLETTDLTSSCAS---------LLEKECQALHGKLQK- 694

Query: 771 TNQFVENFKKALNDHLEE 788
              +VE+ K+ LN  L+E
Sbjct: 695 ---YVESMKQELNSTLQE 709

 Score =  149 bits (376), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 114/193 (59%), Gaps = 17/193 (8%)

Query: 34  ELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDK 93
           E NI V VRCR RNEREI  KSSVV++     G +E+ +   G TG     + K YT D+
Sbjct: 52  EYNIKVYVRCRSRNEREIREKSSVVISTLGNNG-REVILTNPG-TG-----SNKTYTFDR 104

Query: 94  VFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE----- 148
           VFG  + Q+ +F++VA     + I+GYNCTV  YG T TGKTYTM+GD  +         
Sbjct: 105 VFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSEDDPN 164

Query: 149 ---LSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL-DXXXXXXXXXGF 204
              LS+ AGIIPRVL++LF  L     DY VK SF+ELYNE+L+DLL D          F
Sbjct: 165 FVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKDVSLEDHNF 224

Query: 205 DGQFMKK-LRIFD 216
           +G    + +RI+D
Sbjct: 225 NGMAPPESIRIYD 237

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  254 bits (649), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 164/216 (75%), Gaps = 5/216 (2%)

Query: 315 SNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD- 373
           S+ I ++ ++E +I +A EGLKLL +G   RQVASTK ND SSRSHT+FTIT      D 
Sbjct: 249 SHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDP 308

Query: 374 ----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHI 429
               E  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S HI
Sbjct: 309 LSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHI 368

Query: 430 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 489
           P+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+   +
Sbjct: 369 PYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSM 428

Query: 490 MKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHY 525
            KD  +     E+ +++ +L +T++K+GIY+ Q+ Y
Sbjct: 429 TKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY 464

 Score =  146 bits (369), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 82/192 (42%), Positives = 111/192 (57%), Gaps = 18/192 (9%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKR-YTVDKV 94
           NI V VRCR RN+REI  KSSVV++     G +++ ++    +   +  N K+ YT D+V
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQG-RDVILSNPSSSSSGSLTNVKKTYTFDRV 112

Query: 95  FGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------ 148
           FG  + Q+++F+ VA     + ++GYNCTV  YG T TGKTYTM+GD  +          
Sbjct: 113 FGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQ 172

Query: 149 ----LSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGF 204
               LS+ AGIIPRVL+ LF  L+ +  DY VK SF+ELYNE LKDLL            
Sbjct: 173 SSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKE------ 226

Query: 205 DGQFMKKLRIFD 216
           D    + +RIFD
Sbjct: 227 DDNNAESIRIFD 238

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  253 bits (647), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/220 (58%), Positives = 167/220 (75%), Gaps = 8/220 (3%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           N+ ++ I ++ +QE  I +A EGL LL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 372 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 423
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 424 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 483
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTP 414

Query: 484 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQD 523
           Q+   + KD  +K+   E+ K+K+DL ++++K+GI++ QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQD 454

 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 96/164 (58%), Gaps = 16/164 (9%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G KEI ++       ++  + K Y  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 108

Query: 96  GPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 145
           G  + Q+ +F+  A    ++ + GYNCT+  YG T TGKTYTM+GD          +KL 
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 146 NGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELK 189
            GE    AGIIPRVL+ LF  L     +Y VK SF+ELYNE LK
Sbjct: 169 LGE---HAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLK 209

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  253 bits (647), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 167/221 (75%), Gaps = 8/221 (3%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           N+ ++ I ++ +QE  I +A EGL LL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 372 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 423
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 424 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 483
           D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 414

Query: 484 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDH 524
           Q+   + KD  +K+   E+ K+++DL ++++K+GI++ QD 
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQ 455

 Score =  131 bits (330), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 95/161 (59%), Gaps = 10/161 (6%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G KEI ++       ++  + K Y  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIEEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 108

Query: 96  GPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------NGE 148
           G  + Q+ +F+  A    ++ + GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 109 GAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 168

Query: 149 LSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELK 189
           L + AGIIPRVL+ LF  L     +Y VK SF+ELYNE LK
Sbjct: 169 LGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLK 209

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  253 bits (646), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 167/220 (75%), Gaps = 8/220 (3%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           N+ ++ I ++ +QE  I +A EGL LL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIE 294

Query: 372 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 423
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 295 QDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 424 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 483
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSP 414

Query: 484 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQD 523
           Q+   + KD  +K+   E+ K+++DL ++++K+GI++ QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  140 bits (352), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 107/190 (56%), Gaps = 13/190 (6%)

Query: 34  ELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDK 93
           E NI V VRCR RN REI  KSSVV++     G KEI ++       ++  + K Y  D+
Sbjct: 50  ESNIHVYVRCRSRNRREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQ 106

Query: 94  VFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------N 146
           VFG  + Q+++F   A    ++ + GYNCT+  YG T TGKTYTM+GD  +        N
Sbjct: 107 VFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDN 166

Query: 147 GELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDG 206
             L + AGIIPRVL+ LF  L     +Y VK SF+ELYNE LKDLL            D 
Sbjct: 167 LLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDDDPTAN-DS 225

Query: 207 QFMKKLRIFD 216
           +  K++RIFD
Sbjct: 226 K--KQIRIFD 233

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  253 bits (646), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 167/221 (75%), Gaps = 8/221 (3%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           N+ ++ I ++ +QE  I +A EGL LL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 234 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 293

Query: 372 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 423
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 294 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 353

Query: 424 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 483
           D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 354 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 413

Query: 484 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDH 524
           Q+   + KD  +K+   E+ K+++DL ++++K+GI++ QD 
Sbjct: 414 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQ 454

 Score =  135 bits (341), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 98/164 (59%), Gaps = 10/164 (6%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G KEI ++       ++  + K Y  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 107

Query: 96  GPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------NGE 148
           G  + Q+ +F+  A    ++ + GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 167

Query: 149 LSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
           L + AGIIPRVL+ LF  L     +Y VK +F+ELYNE LKDLL
Sbjct: 168 LGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLL 211

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  250 bits (639), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 125/225 (55%), Positives = 167/225 (74%), Gaps = 5/225 (2%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTIT----- 366
           N   + I ++ ++E +I +A EGLKLL +G   R+VA+T+ ND SSRSHTIFTIT     
Sbjct: 249 NSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTK 308

Query: 367 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 426
           ++    ++  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S
Sbjct: 309 IHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 368

Query: 427 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 486
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET STLEYA++AK+IKN PQ+ 
Sbjct: 369 QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQIN 428

Query: 487 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSD 531
             + K+  +     E+ K++ +L +  +KEGIY+ ++ Y+   S+
Sbjct: 429 QLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYETYESN 473

 Score =  149 bits (376), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 82/165 (49%), Positives = 102/165 (61%), Gaps = 15/165 (9%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN REI  KSSVVV+     G + I  N +  TG     N K YT D+VF
Sbjct: 56  NIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQS--TG-----NNKTYTFDQVF 108

Query: 96  GPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS--- 152
           G  + Q+ +FD+VA     + ++GYNCTV  YG T TGKTYTM+GD  +    L D    
Sbjct: 109 GVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLEDPNYV 168

Query: 153 -----AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
                AGIIPRVL++LF  L+ +  DY VK SF+ELYNE+L+DLL
Sbjct: 169 LLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLL 213

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  249 bits (636), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 127/224 (56%), Positives = 166/224 (74%), Gaps = 5/224 (2%)

Query: 306 RNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTI 365
           +N  A N   + I ++ ++E +I +A EGL+LL +G   R+VASTK+ND SSRSHTIFTI
Sbjct: 328 QNKSASNCNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTI 387

Query: 366 TLYKKHQDEL-----FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 420
                  D +      +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN
Sbjct: 388 ITNVTKVDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVIN 447

Query: 421 ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 480
           ALVD+S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IK
Sbjct: 448 ALVDRSHHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIK 507

Query: 481 NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDH 524
           N PQ+   + KD  +     E+ +++++L   ++KEGIY+ QD 
Sbjct: 508 NTPQINQSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQ 551

 Score =  124 bits (310), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 82/228 (35%), Positives = 105/228 (46%), Gaps = 69/228 (30%)

Query: 31  HNEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEI----------SINTTGDTGI 80
           H ++ NI V VRCR R +REI  KSSVV++     G+K I          + N  G T  
Sbjct: 46  HTKDDNIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRT 105

Query: 81  TAQM-----------------NAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCT 123
                                N + YT DKVFG  + Q+ +F+ VA     + ++GYNCT
Sbjct: 106 KNNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCT 165

Query: 124 VLVYGMTSTGKTYTMTGD----------EKLYNGELSDSAGIIPRVLLKLFDTLE----- 168
           V  YG T TGKTYTM+GD          +K+  GE    AGIIPRVL+ LF  L      
Sbjct: 166 VFAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGE---HAGIIPRVLVYLFKELSKNDTI 222

Query: 169 ------------------------LQQNDYVVKCSFIELYNEELKDLL 192
                                   L+  +Y VK SF+ELYNE+L DLL
Sbjct: 223 TNTKVNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLL 270

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  246 bits (627), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 163/214 (76%), Gaps = 5/214 (2%)

Query: 318 IYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD---- 373
           I ++ ++EF+I +A EGL+LL  G   R+VA+TK ND SSRSHT+FTIT      D    
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 374 -ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 432
            +  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S HIP+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 492
           ESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   + K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 493 ILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYK 526
             +     E+ +++ +L +++ KEG+Y+ +D ++
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ 461

 Score =  149 bits (376), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 80/167 (47%), Positives = 103/167 (61%), Gaps = 17/167 (10%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           N+ V VRCR RNE+EI  KSSVV++     G + I  N  G    +   + + YT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAG----SLSHSKRTYTFDQVF 96

Query: 96  GPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 145
           G  + Q+ +FDEVA     + ++GYNCTV  YG T TGKTYTM+GD          +K+ 
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 146 NGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
            GE S   GIIPRVL+ LF  L  + N+Y VK SF+ELYNE+LKDLL
Sbjct: 157 LGEHS---GIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLL 200

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  243 bits (619), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 160/213 (75%), Gaps = 5/213 (2%)

Query: 318 IYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD---- 373
           I ++ ++E +I +A EGL+LL KG   R+VA+TK ND SSRSHTIFTI  +    D    
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 374 -ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 432
            +  +I K+NLVDLAGSENINRSGA N RA+EAG IN+SLLTLGRVINALV+ S HIP+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 492
            SKLTRLLQDSLGG TKT +IATISPA+++ +ET STLEYA++AK+IKN PQ+   + KD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 493 ILVKNITMELAKIKSDLLSTKSKEGIYMNQDHY 525
             +     E+ +++ +L +++ +EG+Y+ Q+ Y
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQY 480

 Score =  145 bits (365), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 100/173 (57%), Gaps = 13/173 (7%)

Query: 28  HTVHNEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAK 87
           H  H    NI V VRCR RN+REI  KSSVVV+     G   I  N +           K
Sbjct: 36  HQRHQIGSNIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLS----HPKK 91

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
            Y  D+VFG  + Q+ IF EVA    Q+ ++GYNCTV  YG T TGKTYTM+GD  ++ G
Sbjct: 92  TYMFDEVFGADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIW-G 150

Query: 148 E--------LSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
           +        L + AGIIPRVL+ LF  L  +  ++ VK SF+ELYNE LKDLL
Sbjct: 151 DLDSQDKILLGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLL 203

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  242 bits (617), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/218 (56%), Positives = 160/218 (73%), Gaps = 5/218 (2%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           N+ S+ I ++ ++E +I +A EGL+LL  G   R+VASTK ND SSRSHT+FTI      
Sbjct: 283 NNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITK 342

Query: 372 QDEL-----FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 426
            D +      +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S
Sbjct: 343 IDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 402

Query: 427 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 486
            HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AK+IKN PQ+ 
Sbjct: 403 QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQIN 462

Query: 487 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDH 524
             + KD  +     E+ +++ +L +++ K+GI + QD 
Sbjct: 463 QSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQDQ 500

 Score =  143 bits (360), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 99/164 (60%), Gaps = 12/164 (7%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR R+EREI  KSSVV++     G++ I  N +           K Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 96  GPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYNGE------ 148
           G  + Q+ +F++ A     + + GYNCTV  YG T TGKTYTM+GD   L N E      
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 149 LSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
           L + AGIIPRVL+ LF  L L +NDY VK SF+ELYNE LKDL 
Sbjct: 224 LGEHAGIIPRVLVNLFKMLAL-ENDYSVKISFLELYNERLKDLF 266

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  240 bits (613), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 120/216 (55%), Positives = 162/216 (75%), Gaps = 5/216 (2%)

Query: 315 SNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTIT-----LYK 369
           S+ I ++ ++E +I +A +GL+LL  G   R+VA+TK ND SSRSHT+FTIT     L  
Sbjct: 239 SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 370 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHI 429
              ++  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD + HI
Sbjct: 299 VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 430 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 489
           P+RESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   +
Sbjct: 359 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 490 MKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHY 525
            KD  +     E+ +++ +L +++ K+GI + QD +
Sbjct: 419 SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQF 454

 Score =  139 bits (350), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/165 (46%), Positives = 100/165 (60%), Gaps = 14/165 (8%)

Query: 37  ITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKR-YTVDKVF 95
           I V VRCR RNEREI  KSSVV++     G+ + S        +     AKR YT D+VF
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVIST---LGAPQ-STQLLLSNPLLPLAYAKRTYTFDRVF 116

Query: 96  GPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------- 148
           G  + Q+ +F++ A     + ++GYNCTV  YG T TGKTYTM+GD  +  G+       
Sbjct: 117 GAESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMV 176

Query: 149 -LSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
            L + AGIIPRVL++LF  L+  +  Y VK SF+ELYNE LKDLL
Sbjct: 177 LLGEHAGIIPRVLVELFRWLDGNEG-YSVKVSFLELYNERLKDLL 220

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  237 bits (604), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 165/219 (75%), Gaps = 5/219 (2%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           N+  + I ++ ++E +I +A EGL+LL +G   R+VASTK ND SSRSHTIFTIT     
Sbjct: 248 NNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITK 307

Query: 372 QD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 426
            D     +  +I K+NLVDLAGSENI+RSGA N RA+EAG IN+SLLTLGRVINALVD S
Sbjct: 308 IDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHS 367

Query: 427 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 486
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN PQ+ 
Sbjct: 368 QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQIN 427

Query: 487 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHY 525
             + KD+ +     E+ +++ +L +++ K+G+Y+ Q+ +
Sbjct: 428 QSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQF 466

 Score =  141 bits (355), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 99/167 (59%), Gaps = 17/167 (10%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G KE+ ++   D         K Y  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQG-KEVVLS---DPSSVLSHTKKTYIFDQVF 114

Query: 96  GPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 145
           G  + Q+++F+  A     + ++GYNCT+  YG T TGKTYTM+GD          +K+ 
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 146 NGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
            GE    AGIIPRVL+ LF  L  +  +Y VK SF+ELYNE LKDLL
Sbjct: 175 LGE---HAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLL 218

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  181 bits (460), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 109/199 (54%), Positives = 131/199 (65%), Gaps = 31/199 (15%)

Query: 317 GIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD--- 373
            I ++ +QE  I NAMEGL LL KG   R+V STK+ND SSRSHTIFTIT      D   
Sbjct: 207 SIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQT 266

Query: 374 --ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGH--- 428
             E  +I K+NLVDLAGSENI +SG   +R++E G IN+SLLTLGRVINAL DK+ +   
Sbjct: 267 NKEYIKIGKLNLVDLAGSENITKSGL--KRSQETGLINKSLLTLGRVINALSDKTNNTHG 324

Query: 429 ---------------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETC 467
                                IP+RESKLTRLLQDSLGG TKT +IATISPAK   +ET 
Sbjct: 325 SNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDETI 384

Query: 468 STLEYASKAKNIKNKPQLG 486
           STLEYA++A +IKN P++ 
Sbjct: 385 STLEYATRAMSIKNNPKIN 403

 Score =  140 bits (353), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 87/200 (43%), Positives = 109/200 (54%), Gaps = 28/200 (14%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN++EI  KSSVVV+     G++ I  N+T         N  +Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 96  GPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------NGE 148
           G  + Q+ IF+ VA    Q+ I GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNIL 119

Query: 149 LSDSAGIIPRVLLKLFDTLEL----QQN----DYVVKCSFIELYNEELKDLLDXXXXXXX 200
           L + AGIIPRVL++LF +LE     Q+N     Y VK SF+ELYNE LKDLL        
Sbjct: 120 LGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLLSADADLPP 179

Query: 201 XXGF----DGQFMKKLRIFD 216
             G     D      ++IFD
Sbjct: 180 NSGSSSANDPSVSSNIKIFD 199

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  140 bits (354), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 112/173 (64%), Gaps = 8/173 (4%)

Query: 319 YIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF-- 376
           +++ LQEF + +  E L  L++G + + V +T +N+ SSRSHTIFTI + +K    L   
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 377 --RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGH--IPFR 432
             R S + L+DLAGSE  N SGA  +R KE  +IN+SL TLGRVI  L  K     IP+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 485
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 57/99 (57%), Gaps = 15/99 (15%)

Query: 101 QDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVL 160
           Q  +++++A       + GYN  +  YG T +GK++TMTG  +L         GI+PR+ 
Sbjct: 63  QAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRMC 114

Query: 161 LKLFDTLELQQND-------YVVKCSFIELYNEELKDLL 192
            +LF+  E+ ++        + ++CS++E+YNE ++DLL
Sbjct: 115 QELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL 153

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  141 bits (355), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 118/186 (63%), Gaps = 9/186 (4%)

Query: 305 QRNSLAPND-QSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIF 363
           +R SL+ +D + +GIY++ L   ++T+  E L  +++G   R V+ST MN  SSRSH+I 
Sbjct: 183 KRISLSLHDTKDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIV 242

Query: 364 TITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 422
            I L K++  +E  + S + LVDLAGSE + ++ A     +EA  IN SL  LG VINAL
Sbjct: 243 RINLEKRNALEENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINAL 302

Query: 423 VD-------KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 475
                     S HIP+R+SKLTRLLQDSLGGN+KT LI   S ++   +ET STL + S+
Sbjct: 303 TQVESKSKRTSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSR 362

Query: 476 AKNIKN 481
           AK IKN
Sbjct: 363 AKKIKN 368

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 69/115 (60%), Gaps = 11/115 (9%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           + Q N + +T D+VF  G++Q+ +++ VA  + + F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 141 DEKLYNGELSDSAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLL 192
            +        ++ G+IPR+   +F  +E    +   + V  SF+E+Y E++ DLL
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLL 173

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  136 bits (342), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 111/173 (64%), Gaps = 8/173 (4%)

Query: 319 YIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ----DE 374
           +++ L EF +    E L+ +++G + R V  T MN+ SSRSH IFTI++ +       D 
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 375 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGH--IPFR 432
             R S + LVDLAGSE ++ +GA   R KE  +IN+SL TLGRV++ L  K+    IP+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 485
           +S LT +L+++LGGN+KT +IA +SP     EET STL YA+ AK +KN  ++
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPCDY--EETISTLRYATTAKEVKNTARV 368

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/178 (30%), Positives = 83/178 (46%), Gaps = 22/178 (12%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI VAVR R    RE        V  P  +   +  I+T+           K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSP-TSFVIQQHISTSSLLATEEFTQGKIFTFDHCF 62

Query: 96  ----GPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE---KLYNGE 148
                    Q++I+D +        + GYN  +L YG T +GK++TM G E     +N +
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 149 ------LSDSA-GIIPRVLLKLFDTLELQQND-------YVVKCSFIELYNEELKDLL 192
                 + DSA GIIPRV   LFD   +  ++       + + CS++E+YNE+++DLL
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLL 180

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  135 bits (339), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 111/174 (63%), Gaps = 5/174 (2%)

Query: 319 YIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 378
           ++Q++  F +    E L+ L  G   R VAST+MN  SSRSH IFT+++ ++  D   R 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 379 SKMNLVDLAGSENINRSGALN--QRAKEAGSINQSLLTLGRVINALVDKSGH-IPFRESK 435
           S + LVDLAGSE  N +  ++  +R KE  +IN+SL TLGR I+ L   S H IP+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 436 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 489
           LT +L+++LGGN+KT +IA ISP  +  EE+ STL YA+ AK IK +  +   +
Sbjct: 269 LTWVLKENLGGNSKTCMIACISPIDL--EESLSTLRYATTAKEIKLRATMNEIV 320

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 58/113 (51%), Gaps = 9/113 (7%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           T +   + +  D +F   +SQ  I  E+ S      ++GYN  +  YG T +GKTYTM G
Sbjct: 29  TVEPPLRSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRG 88

Query: 141 DEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDY-VVKCSFIELYNEELKDLL 192
                    + + GIIP +   LFD LEL +     V  ++ E+YNE+L DLL
Sbjct: 89  T--------NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLL 133

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  135 bits (341), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 114/175 (65%), Gaps = 8/175 (4%)

Query: 319 YIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 378
           +++ L+EF +++  + L  +++G + R + ST +N++SSRSHTIFTI++ +K +  L  +
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 379 ----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGH--IPFR 432
               S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ L  +     IP+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 433 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 487
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+N+K   QL A
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDY--EETLSTLRYATLARNVKTCAQLNA 341

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 89/192 (46%), Gaps = 29/192 (15%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI VAVR R   ERE+    S++  V D    +    N   +T        + +  D+ F
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVEDGNVIQVKDRNQKNET--------RSFHFDQCF 53

Query: 96  GPG----ASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
                  A Q  ++++++       + GY+  V  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 152 SAGIIPRVLLKLFDTLELQQND-------YVVKCSFIELYNEELKDLLDXXXXXXXXXGF 204
           S GI+ R+  +LF+  E+ ++        + ++CS++E+YNE ++DLL            
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLGTGRCRIRERAD 165

Query: 205 DGQFMKKLRIFD 216
              F++ LR FD
Sbjct: 166 KTTFVEGLREFD 177

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 111/183 (60%), Gaps = 5/183 (2%)

Query: 305 QRNSLAPNDQSN-GIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIF 363
           +R SL  ++ S  G+Y+Q+     +++  E L  +  G   R  +ST MN  SSRSH I 
Sbjct: 202 KRTSLTIHESSTFGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIV 261

Query: 364 TITLYKKHQDE-LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 422
            I L K+   E   + S + LVDLAGSE ++++ A+    +EA  IN SL +LG VINAL
Sbjct: 262 KINLLKRDNLEGSIQKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINAL 321

Query: 423 VDKS---GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 479
             K     HIP+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK I
Sbjct: 322 TQKDKKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQI 381

Query: 480 KNK 482
           +NK
Sbjct: 382 ENK 384

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 70/118 (59%), Gaps = 12/118 (10%)

Query: 79  GITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTM 138
           G+  +  ++ +  D VFG  ++QD ++D VA  +   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 139 TGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQN----DYVVKCSFIELYNEELKDLL 192
            G          D+ G+IPR+  ++F+ + L ++    +YVV  SF+E+Y E++ DLL
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLL 186

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  123 bits (309), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 107/172 (62%), Gaps = 7/172 (4%)

Query: 319 YIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH----QDE 374
           YI+ L +  + +  E LK +++G   R VA T +N+ SSRSH I TI + +       D 
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 375 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV-DKSGHIPFRE 433
           + R+S + LVDLAGSE    S   ++R KE  +IN+SL+TL RV+  L  +K   +P+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 434 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 485
           S LTR+L+D+L GN+ T ++A ISP     EE+ STL YAS AK+++ +  L
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPCDY--EESISTLRYASTAKHVRTEAHL 342

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 80/166 (48%), Gaps = 23/166 (13%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI VA+R R +  RE S  S +         S EI++       +   +    Y  D+VF
Sbjct: 4   NIKVAIRIRDKISRETSRPSVIKRKT-----SNEITLQKDNTANVITTVEHTFY-FDQVF 57

Query: 96  GPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGI 155
              ++Q  I+ E+A       ++GY+  V+ YG T  GKTYTM G E+          GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPGI 109

Query: 156 IPRVLLKLFDTLELQQND---------YVVKCSFIELYNEELKDLL 192
           IP V  +LF  +++ Q++         + V  S+ ++YNE++ D+L
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML 155

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  125 bits (313), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 103/169 (60%), Gaps = 3/169 (1%)

Query: 317 GIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL- 375
           G+Y++      +++  E L  +  G   R   ST MN  SSRSH I  I L K+   E  
Sbjct: 188 GVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLLKRDNLEGN 247

Query: 376 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--DKSGHIPFRE 433
            + S + LVDLAGSE + ++ A+    +EA  IN SL +LG VINAL   +K  HIP+R+
Sbjct: 248 IQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKRTHIPYRD 307

Query: 434 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
           S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK+IKNK
Sbjct: 308 SQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNK 356

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 64/111 (57%), Gaps = 12/111 (10%)

Query: 86  AKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 145
           A+ +  D VFG  A Q+ +FD VA  +   F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP---- 112

Query: 146 NGELSDSAGIIPRVLLKLFDTLELQQN----DYVVKCSFIELYNEELKDLL 192
                   G+IPR+  ++F+ + L +N    +YVV  SF+E+Y E++ DLL
Sbjct: 113 ----PGHRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEKVYDLL 159

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 110/178 (61%), Gaps = 8/178 (4%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK--K 370
           DQ++ I + NL      N  + + L+ +G  +R  + T+ N+ SSRSH++  I + +  K
Sbjct: 206 DQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLK 265

Query: 371 HQDELFRI----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--D 424
           + D++       S ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 266 NFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINK 325

Query: 425 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
           KS HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ +  +ET +TL+YA++AK IK K
Sbjct: 326 KSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 60/110 (54%), Gaps = 13/110 (11%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   ++Q+ IF++   PL    + G+N TV  YG T  GKTYT+ G       
Sbjct: 91  KFIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING------- 143

Query: 148 ELSDSAGIIPRVLLKLFDTLELQQND-----YVVKCSFIELYNEELKDLL 192
             S+  GII R + +LF  +E+   D       +  S++E+YNE ++DLL
Sbjct: 144 -TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  121 bits (303), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 104/178 (58%), Gaps = 8/178 (4%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D   GI + NL         + + L+ +G  +R  + T  N+ SSRSH +  I + +K++
Sbjct: 247 DSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNR 306

Query: 373 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----D 424
                E    + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL      
Sbjct: 307 TAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRR 366

Query: 425 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
            + H+P+R+SKLTRLL+ SLGGN KT +I  I+P+    +ET +TL+YA++AK IK K
Sbjct: 367 STCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 59/108 (54%), Gaps = 10/108 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  DK+F   A+Q  +++    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 134 QKFVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG------ 187

Query: 147 GELSDSAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLL 192
               +  G+I   + +LF  +E  ++   + +  S++E+YNE ++DLL
Sbjct: 188 --TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL 233

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 106/180 (58%), Gaps = 10/180 (5%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D +N I + NL   +     E + L+ KG  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 262 DGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNR 321

Query: 373 DELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----- 423
                     + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL      
Sbjct: 322 TADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGG 381

Query: 424 -DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
            ++S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382 TNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 61/107 (57%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   ASQ+ ++    S L    + G+N TV  YG T  GKTYT++G       
Sbjct: 150 KFVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------ 203

Query: 148 ELSDSAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLL 192
              +  GII RV+ +LF+ +E  ++   + +  S++E+YNE ++DLL
Sbjct: 204 --PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 103/180 (57%), Gaps = 10/180 (5%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D  N I + NL +   T   E + L+ +G  +R  + T+ N+ SSRSH +  I + +K++
Sbjct: 267 DTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNR 326

Query: 373 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----- 423
                E      ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 327 TPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGND 386

Query: 424 -DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
                H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 387 ERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   A+Q  ++    S L    + G+N TV  YG T  GKTYT++G       
Sbjct: 155 KFVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG------- 207

Query: 148 ELSDSAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLL 192
              ++ GI+ + + +LF  +E  ++   + +  SF+E+YNE ++DLL
Sbjct: 208 -TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 106/178 (59%), Gaps = 8/178 (4%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D  N I + NL   H T   + + L+ +G  +R  + T+ N+ SSRSH++  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNK 323

Query: 373 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----D 424
                     + ++++DLAGSE  + +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 425 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
           ++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 60/107 (56%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   +SQ  ++ E  SPL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------ 205

Query: 148 ELSDSAGIIPRVLLKLFDTL-ELQ-QNDYVVKCSFIELYNEELKDLL 192
                 GII   + +LF+ + +L+ + ++ +  S++E+YNE + DLL
Sbjct: 206 --PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 104/181 (57%), Gaps = 13/181 (7%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D  N I + NL         + + L+  G  +R  ++T  N+ SSRSH +  I + +  +
Sbjct: 240 DSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSR 299

Query: 373 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 426
                 D  F  +K++++DLAGSE    +    +R +E  +IN+SLL LG  INAL    
Sbjct: 300 TAEITSDHTF--AKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISD 357

Query: 427 G-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 481
           G     H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK 
Sbjct: 358 GTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 417

Query: 482 K 482
           K
Sbjct: 418 K 418

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 58/107 (54%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   A+Q+ ++    S L    + G+N TV  YG T  GKTYT++G       
Sbjct: 128 KFVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------ 181

Query: 148 ELSDSAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLL 192
              +  G+I   + +LF  +E  ++   + +  S++E+YNE ++DLL
Sbjct: 182 --PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL 226

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 104/183 (56%), Gaps = 15/183 (8%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITL--YK 369
           +DQS   Y+ N++ F I N  + + L+ K    R  +ST +N  SSRSH IF I L  Y 
Sbjct: 556 DDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYN 615

Query: 370 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL------- 422
              +E   ISK+NLVDLAGSE IN S     R KE  SIN+SL  LG VI+AL       
Sbjct: 616 HKTNEKC-ISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNH 674

Query: 423 -----VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 477
                + K+ HIPFR SKLT LL+ SL G++KT +   +S  +    ET ++L +A+K  
Sbjct: 675 LNSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVN 734

Query: 478 NIK 480
           N K
Sbjct: 735 NTK 737

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 58/107 (54%), Gaps = 14/107 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF        +F+E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 444 FEFDHVFKQDEGNSEVFNEIEQ-LIQSALDGYNVCIFAYGQTGSGKTYTM---------- 492

Query: 149 LSDSAGIIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNEELKDLL 192
           L+ + G+IP  +  +F++++ L++N  +Y V C FIELYNE + DL 
Sbjct: 493 LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLF 539

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  120 bits (301), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 108/179 (60%), Gaps = 9/179 (5%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D    I + NL    ++   + + L+ KG  +R  ++T  N+ SSRSH +  + + ++++
Sbjct: 236 DSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNR 295

Query: 373 D----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV---DK 425
                E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL     K
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRK 355

Query: 426 SG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
            G  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 356 RGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 10/109 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  D+VF   +SQ  +++    PL    + G+N TV  YG T  GKTYT++G      
Sbjct: 123 QKFVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG------ 176

Query: 147 GELSDSAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLLD 193
               ++ GII   + +LF  +E  Q+   + +  S++E+YNE ++DLL+
Sbjct: 177 --TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE 223

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 104/178 (58%), Gaps = 8/178 (4%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D  N I + NL   H T   + + L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 373 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----D 424
                     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 425 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
           ++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 67/129 (51%), Gaps = 16/129 (12%)

Query: 71  SINTTGDTGITAQMNAK----RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLV 126
           SIN+ G     +Q        ++  DK+F   +SQ  ++ E  SPL    + GYN TV  
Sbjct: 131 SINSNGTNKFASQRRRHGGEIKFVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFA 190

Query: 127 YGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLF---DTLELQQNDYVVKCSFIEL 183
           YG T  GKTYT++G             G+I   + +LF   D L+ ++N + +  S++E+
Sbjct: 191 YGATGCGKTYTVSGT--------PSQPGVIFLAMEELFNKIDDLKDEKN-FEISLSYLEI 241

Query: 184 YNEELKDLL 192
           YNE ++DLL
Sbjct: 242 YNERIRDLL 250

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 106/182 (58%), Gaps = 14/182 (7%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH- 371
           D  N  ++ NL +    N  E + L+ KG  +R  + T  N+ SSRSH +  I + + + 
Sbjct: 235 DSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNR 294

Query: 372 -----QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 426
                QD+ F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL   S
Sbjct: 295 TADIKQDQTF--ATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSS 352

Query: 427 ------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 480
                  H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK
Sbjct: 353 TRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIK 412

Query: 481 NK 482
            K
Sbjct: 413 TK 414

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 61/110 (55%), Gaps = 12/110 (10%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  D++F    +Q  +++    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 122 QKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT----- 176

Query: 147 GELSDSAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLLD 193
              S+  GII   + +LF  +E Q  D   + ++ SF+E+YNE++ DLLD
Sbjct: 177 ---SEQPGIIFLTMQELFIRME-QLKDTKKFQLQLSFLEIYNEQIHDLLD 222

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 106/181 (58%), Gaps = 13/181 (7%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D +  I + NL  ++     + + L+ KG  +R  ++T  N+ SSRSH +  I + + ++
Sbjct: 239 DSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNR 298

Query: 373 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 423
                 D  F  + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 299 TADLKSDHTF--ATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLND 356

Query: 424 --DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 481
              +S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 357 GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKT 416

Query: 482 K 482
           K
Sbjct: 417 K 417

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 61/107 (57%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           R+  D++F   ++Q  +++    PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 127 RFVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------ 180

Query: 148 ELSDSAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLL 192
              ++ GII + + +LF+ +E  ++   + +  SF+E+YNE ++DLL
Sbjct: 181 --PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL 225

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 104/178 (58%), Gaps = 8/178 (4%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D  + I + NL   H T   + + L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 373 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----D 424
                     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 425 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
           +S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 58/107 (54%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   +SQ  ++ E  SPL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------ 205

Query: 148 ELSDSAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLL 192
                 GII   + +LF+ +     + ++ +  S++E+YNE ++DLL
Sbjct: 206 --PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 103/178 (57%), Gaps = 8/178 (4%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D  N I + NL   H     + + L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 373 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----D 424
                     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 425 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
           +S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 61/107 (57%), Gaps = 10/107 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   +SQ  ++ E  SPL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------ 205

Query: 148 ELSDSAGIIPRVLLKLFDTL-ELQ-QNDYVVKCSFIELYNEELKDLL 192
                 GII   + +LF+ + +L+ + D+ +  S++E+YNE ++DLL
Sbjct: 206 --PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 102/183 (55%), Gaps = 17/183 (9%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITL----- 367
           D +  I + NL      +  + L L+ +G  +R  + T+ N  SSRSH +  I +     
Sbjct: 254 DSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNK 313

Query: 368 ---YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 424
               K+HQ        ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL  
Sbjct: 314 LVDLKEHQT----FGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCS 369

Query: 425 KSG-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 479
             G     H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK I
Sbjct: 370 NDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEI 429

Query: 480 KNK 482
           K K
Sbjct: 430 KTK 432

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 59/114 (51%), Gaps = 10/114 (8%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           T   +  ++  DK+F    SQ+ ++    S L    + G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 141 DEKLYNGELSDSAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLL 192
                     ++ GII R + +LF  ++      D+ +  SF+E+YNE + DLL
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL 240

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 111/188 (59%), Gaps = 23/188 (12%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D +N I + NL  +      E + L+ +G  +R  +ST  N+ SSRSH +  I L ++++
Sbjct: 221 DANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNK 280

Query: 373 --------DELFRISKMNLVDLAGSENINRSGALNQRAK---EAGSINQSLLTLGRVINA 421
                   ++LF  S ++++DLAGSE   R+ +   R +   E  +IN+SLL LG  INA
Sbjct: 281 LNNDINSTEQLF--STLSIIDLAGSE---RAASTKNRGETLLEGANINKSLLALGNCINA 335

Query: 422 LVDKSG-------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 474
           L   +        HIP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA+
Sbjct: 336 LCINTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYAN 395

Query: 475 KAKNIKNK 482
           +AK IK K
Sbjct: 396 RAKEIKTK 403

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 58/108 (53%), Gaps = 10/108 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           R+  DK+    ++Q  +F     PL    + GYN TV  YG T  GKTYT++G       
Sbjct: 109 RFIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------ 162

Query: 148 ELSDSAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLD 193
              ++ GII   L  LF+ +E  ++  +  +  S++E+YNE +KDLLD
Sbjct: 163 --PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLD 208

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 106/179 (59%), Gaps = 9/179 (5%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D    I + NL    +    + + L+ KG  +R  ++T  N+ SSRSH +  + + +K++
Sbjct: 236 DVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNR 295

Query: 373 D----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--DKS 426
                E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL    K 
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKR 355

Query: 427 G---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
           G   H+P+R+SKLTRLL+ SLGGN KT +I  ISP     +ET +TL+YA++AK IK K
Sbjct: 356 GGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 74.7 bits (182), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 70/131 (53%), Gaps = 17/131 (12%)

Query: 71  SINTTGDTGITAQMNAKR-----YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVL 125
           SI T   +     MN++R     +  D+VF   ASQ+ +++    PL    + G+N TV 
Sbjct: 102 SITTPPPSHGPRSMNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVF 161

Query: 126 VYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQND---YVVKCSFIE 182
            YG T  GKTYT++G         +++ GII   + +LF  +E Q  D   + +  S++E
Sbjct: 162 AYGATGCGKTYTVSGT--------AENPGIIFLTMQELFAKME-QLKDTKKFELTASYLE 212

Query: 183 LYNEELKDLLD 193
           +YNE ++DLL+
Sbjct: 213 IYNESIRDLLE 223

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  117 bits (292), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 94/149 (63%), Gaps = 4/149 (2%)

Query: 336 KLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENINR 394
           K+L++  K R  AST  N+ SSRSH+IF I L  K++    +    +NLVDLAGSE +N 
Sbjct: 539 KVLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNS 598

Query: 395 SGALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTA 451
           S  + +R +E  SIN+SL  LG VI+AL    G   HIPFR SKLT LLQ SL G++KT 
Sbjct: 599 SMVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTL 658

Query: 452 LIATISPAKVTSEETCSTLEYASKAKNIK 480
           +   ISPA +   ET ++L +ASK  N K
Sbjct: 659 MFVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/172 (32%), Positives = 81/172 (47%), Gaps = 26/172 (15%)

Query: 29  TVHNE--ELNITVAVRCRGRN---EREISMKSSVVVNVPDITGSKEISINTTGDTGITAQ 83
            +HNE  EL   + V CR R      + +++   V    D  G + ++IN  G++ +   
Sbjct: 339 ALHNELQELRGNIRVYCRIRPPLPHEDDNIEHIKVQPFDDDNGDQGMTINR-GNSQVIP- 396

Query: 84  MNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEK 143
                +  DK+F    + D IF EV   L Q  + GYN  +  YG T +GKTYTM     
Sbjct: 397 -----FKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM----- 445

Query: 144 LYNGELSDSAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 192
                L+   GI+P  +  +F   D L  +   Y V C FIE+YNE + DLL
Sbjct: 446 -----LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLL 492

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  114 bits (286), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 105/185 (56%), Gaps = 11/185 (5%)

Query: 305 QRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFT 364
           QR         +  +++ L+E  + N  E +  + KG ++R V ST MN  SSRSH IF 
Sbjct: 165 QRKCKIRERHDHSTFVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFH 224

Query: 365 ITL-----YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVI 419
           I++     +KK    +   S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI
Sbjct: 225 ISVNQKETHKKTGTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVI 284

Query: 420 NALVD----KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 475
           + L +    +S  IP+RES LT +L+++LGGN+ T L+A +SP      E+ STL YAS 
Sbjct: 285 SLLAEGDRQRSQMIPYRESALTWILKENLGGNSNTCLVACVSPENYY--ESLSTLRYASL 342

Query: 476 AKNIK 480
            K +K
Sbjct: 343 TKKVK 347

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 74/162 (45%), Gaps = 34/162 (20%)

Query: 57  VVVNVPDITGSKEISINTTGDT------------GITAQMNA-KRYTVDKVFGPGAS--- 100
           VVV V    G+  I     GDT              + Q NA K +  D  FG   S   
Sbjct: 7   VVVRVKKPQGNLPIVCKVHGDTISLINDDKKAFRLSSPQKNAAKEFRYDHCFGSTDSVDR 66

Query: 101 -QDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRV 159
            Q +I++ +        ++GYN  +L YG T +GKT+TM G++         + GI+PR 
Sbjct: 67  DQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGEK--------GNEGIVPRF 118

Query: 160 LLKLFDTLELQQN---------DYVVKCSFIELYNEELKDLL 192
             +LF+   +            D+ VKCSF E+YNE++ DLL
Sbjct: 119 CRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  116 bits (291), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 105/181 (58%), Gaps = 13/181 (7%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D  + I + NL         + + L+ KG  +R  ++T  N+ SSRSH +  I + + ++
Sbjct: 257 DNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNR 316

Query: 373 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 423
                   +F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    
Sbjct: 317 TVDLTSSHVF--ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLND 374

Query: 424 --DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 481
              +S H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK 
Sbjct: 375 GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 434

Query: 482 K 482
           K
Sbjct: 435 K 435

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 58/108 (53%), Gaps = 10/108 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F  G+SQ  ++    S L    + G+N TV  YG T  GKTYT++G       
Sbjct: 145 KFIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------ 198

Query: 148 ELSDSAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLLD 193
              +  GII   + +LF  +E      ++ +  S++E+YNE ++DLL+
Sbjct: 199 --PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLN 244

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  114 bits (285), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 107/191 (56%), Gaps = 28/191 (14%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           ++   +YI+N+ E  ++N  + +K ++ G ++R   ST MN  SSRSH I +IT+ +   
Sbjct: 184 NRDRSMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDI 243

Query: 373 D-----ELFRISKMNLVDLAGSENINRSGAL----NQRAKEAGSINQSLLTLGRVINALV 423
           D      +   S    VDLAGSE   RS A     N R KE  SIN+SL TL RV+ +L 
Sbjct: 244 DLNTNSSIISDSICRFVDLAGSE---RSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLK 300

Query: 424 DK-----------SGH---IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCST 469
            +           S H   +PFRES LT +L+D+LGGN+KT +IA ISP     EE+ ST
Sbjct: 301 KREELKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPTNF--EESAST 358

Query: 470 LEYASKAKNIK 480
           L YA  A+ IK
Sbjct: 359 LRYADIAQTIK 369

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 78/171 (45%), Gaps = 20/171 (11%)

Query: 37  ITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFG 96
           ++V VR   R+E         V+N   I  S      TT           K +  DK F 
Sbjct: 5   VSVYVRVAPRDESRRHRAICKVINTDSILLSSNPKRQTTFIRSSFENKEEKIFKFDKCFD 64

Query: 97  PGA----SQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152
            G     SQ   +    +   +D + GYNC +L YG T +GKTYTM G+ K      +D+
Sbjct: 65  EGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------NDT 118

Query: 153 AGIIPRVLLKLFDTLE----------LQQNDYVVKCSFIELYNEELKDLLD 193
            G+IPR    LF  +E           Q+++Y V CS  E+YNE++ DLL+
Sbjct: 119 RGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLE 169

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  115 bits (288), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 102/152 (67%), Gaps = 4/152 (2%)

Query: 329 TNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLA 387
           +N  E  +L+Q+  K R+ A T MN+ SSRSH++F + +   ++D   R    +NLVDLA
Sbjct: 543 SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLA 602

Query: 388 GSENINRSGALN-QRAKEAGSINQSLLTLGRVINALVDKSG--HIPFRESKLTRLLQDSL 444
           GSE +NRSG ++ +R +E   IN+SL ++G VI+AL   SG  HIPFR +KLT LL+ SL
Sbjct: 603 GSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSL 662

Query: 445 GGNTKTALIATISPAKVTSEETCSTLEYASKA 476
            G++KT ++ T+SP+  +  ET ++L +A+K 
Sbjct: 663 QGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (50%), Gaps = 14/108 (12%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DK+F    S   +F EV   L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 408 FQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM---------- 456

Query: 149 LSDSAGIIPRVLLKLFD---TLELQQNDYVVKCSFIELYNEELKDLLD 193
           L++  GIIP  L  + D   +++     Y +K  F+E+YN+ + DLL+
Sbjct: 457 LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLN 504

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 130/238 (54%), Gaps = 34/238 (14%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH- 371
           D+ + I + NL   +  +  + + L+ +G  +R  +ST+ N+ SSRSH +  I + + + 
Sbjct: 302 DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNT 361

Query: 372 -----QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 426
                 +  F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL   +
Sbjct: 362 KIDLTSEHTF--ATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPT 419

Query: 427 G---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 477
                     HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK
Sbjct: 420 NNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAK 479

Query: 478 NIKNK---------PQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYK 526
            IK K           +G+++      K IT +  +I++  L T+  + I +N + YK
Sbjct: 480 EIKTKIIRNQQSLNRHVGSYL------KMITEQKREIEN--LRTREAQMIELNLNRYK 529

 Score = 74.7 bits (182), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 66/113 (58%), Gaps = 10/113 (8%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A+ N  ++  DK+F   +SQD ++    S L    + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 142 EKLYNGELSDSAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLL 192
           +        ++ GII RV+ +LF+ +E  +++  + +  S++E+YNE + DLL
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL 288

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 98/179 (54%), Gaps = 9/179 (5%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D    I + NL         E +  + +G  +R  + T  N+ SSRSH +  I + +  +
Sbjct: 239 DSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDR 298

Query: 373 DELF----RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSG- 427
                     + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    G 
Sbjct: 299 TPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGT 358

Query: 428 ----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
               H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL YA++AK+IK K
Sbjct: 359 RRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 59/108 (54%), Gaps = 10/108 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   A+Q  +++   S L    + G+N TV  YG T  GKT+T++G       
Sbjct: 127 KFVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG------- 179

Query: 148 ELSDSAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLD 193
              +  GII   + +LF  +E  ++  +  +  S++E+YNE ++DLL+
Sbjct: 180 -TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLN 226

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/183 (41%), Positives = 105/183 (57%), Gaps = 8/183 (4%)

Query: 304 GQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIF 363
            Q++ +  +D+S    I N+    +       K+L +  K R  ASTK N+ SSRSH+IF
Sbjct: 522 SQKHDIRHDDESQTTSITNVMTVTLDREETVEKVLHRATKLRSTASTKSNEHSSRSHSIF 581

Query: 364 TITLYKKHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 420
            I L+ K+    ++ + I  +NLVDLAGSE IN S    +R +E   IN+SL  LG VI+
Sbjct: 582 IIHLHGKNSKTNEDSYGI--LNLVDLAGSERINSSQVSGERLRETQHINKSLSCLGDVIH 639

Query: 421 AL---VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 477
           AL     K  HIPFR SKLT LL+ SL GN+KT +   IS +     ET ++L +ASK  
Sbjct: 640 ALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTLMFVNISASLNHVNETINSLRFASKVN 699

Query: 478 NIK 480
           + K
Sbjct: 700 STK 702

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 83/171 (48%), Gaps = 26/171 (15%)

Query: 30  VHN--EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTG---ITAQM 84
           +HN  +EL   + V CR R      +KS   +  P+ +  K  S++    T    IT   
Sbjct: 364 LHNKLQELRGNIRVYCRLR----PPLKS---IEDPNTSHIKVYSLDNDHGTQTMEITKNN 416

Query: 85  NAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 144
           N  +Y  DK+F    S   IF EV   L Q  + GYN  +  YG T +GKT+TM      
Sbjct: 417 NTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGKTFTM------ 469

Query: 145 YNGELSDSAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 192
               L+ S GIIP  +  +F   D L+ +  +Y + C F+E+YNE + DLL
Sbjct: 470 ----LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLL 516

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 69/144 (47%), Positives = 91/144 (63%), Gaps = 3/144 (2%)

Query: 336 KLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK-KHQDELFRISKMNLVDLAGSENINR 394
           K+L++  K R  AST  N+ SSRSH+IF I L+   H+ +      +NLVDLAGSE ++ 
Sbjct: 611 KVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVDLAGSERVHS 670

Query: 395 SGALNQRAKEAGSINQSLLTLGRVINALVDKSG--HIPFRESKLTRLLQDSLGGNTKTAL 452
           S    +R +E  +IN+SL  LG VI AL DK+   HIPFR SKLT LLQ SL GN+KT +
Sbjct: 671 SQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLM 730

Query: 453 IATISPAKVTSEETCSTLEYASKA 476
              ISP+     ET ++L +ASK 
Sbjct: 731 FVNISPSSSHINETINSLRFASKV 754

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 59/107 (55%), Gaps = 14/107 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DK+F  G S D +F EV   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 472 FKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 520

Query: 149 LSDSAGIIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNEELKDLL 192
           L  + G+IP  +  +FD +E L++   +Y + C F+E+YNE + DLL
Sbjct: 521 LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 106/182 (58%), Gaps = 6/182 (3%)

Query: 304 GQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIF 363
            Q++ +  + +  G YI N+    +T+  +   +L+K  K R  A+T+ N+ SSRSH++F
Sbjct: 525 SQKHDIRHDHEKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVF 584

Query: 364 TITLYKK--HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 421
            + +  +  H  E  +  K+NLVDLAGSE IN S    +R +E  +IN+SL  LG VI A
Sbjct: 585 MVHINGRNLHTGETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYA 643

Query: 422 L-VDKSG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 478
           L    +G  +IPFR SKLT LLQ SL G++KT +   I P      ET ++L +ASK  +
Sbjct: 644 LNTPDAGKRYIPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNS 703

Query: 479 IK 480
            K
Sbjct: 704 TK 705

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 84/172 (48%), Gaps = 26/172 (15%)

Query: 30  VHNE--ELNITVAVRCRGR----NEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQ 83
           +HNE  EL   + V CR R    NE +  M   ++    +  G++ ++IN   + G    
Sbjct: 356 LHNELQELRGNIRVYCRVRPPLLNEPQ-DMSHILIEKFNEAKGAQSLTINR--NEGRILS 412

Query: 84  MNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEK 143
            N   +  D +F P  +   IF+E+   L Q  + GYN  +  YG T +GKTYTM     
Sbjct: 413 YN---FQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----- 463

Query: 144 LYNGELSDSAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
                L+   G+IP  L  +F     L+ +  +Y ++C +IE+YNE + DLL
Sbjct: 464 -----LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLL 510

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  112 bits (281), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 102/178 (57%), Gaps = 8/178 (4%)

Query: 313 DQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 372
           D  N   + NL      +  + + L+ KG  +R  + T  N+ SSRSH +  I + +  +
Sbjct: 241 DTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSR 300

Query: 373 DELFRISK----MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS-- 426
               +  K    ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL      
Sbjct: 301 SVDLKEDKTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRR 360

Query: 427 --GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 482
              H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+IK K
Sbjct: 361 TYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 10/109 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  DK+F   A+Q  +F     PL    I G+N TV  YG T  GKT+T++G      
Sbjct: 128 QKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG------ 181

Query: 147 GELSDSAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLD 193
               ++ GII   + +LF  +E  ++   + +  S++E+YNE ++DLL+
Sbjct: 182 --TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLE 228

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 93/150 (62%), Gaps = 8/150 (5%)

Query: 337 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK---MNLVDLAGSENIN 393
           +L+K  K R  A+T  N+ SSRSH++F I  Y K ++E+   S    +NLVDLAGSE +N
Sbjct: 571 VLKKATKLRATAATNSNERSSRSHSVFMI--YLKGKNEITGDSSEGILNLVDLAGSERLN 628

Query: 394 RSGALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKT 450
            S A+  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT
Sbjct: 629 SSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKT 688

Query: 451 ALIATISPAKVTSEETCSTLEYASKAKNIK 480
            +   ISP K    ET ++L +ASK  + K
Sbjct: 689 LMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 55/107 (51%), Gaps = 14/107 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           Y  D++F    S   +F E+   L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 430 YKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM---------- 478

Query: 149 LSDSAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLL 192
           L+D+ G+IP  +  +FD  E  +     Y + C FIE+YNE + DLL
Sbjct: 479 LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLL 525

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 103/183 (56%), Gaps = 18/183 (9%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D   G+ +  L+E    ++ E +K +++G  HR+ A T  N  SSRSH I  I L   +
Sbjct: 273 DDSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTN 332

Query: 372 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS---- 426
             +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  +S    
Sbjct: 333 VIDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAAS 389

Query: 427 ----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 476
                     GHIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +AS+A
Sbjct: 390 HGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRA 449

Query: 477 KNI 479
           KN+
Sbjct: 450 KNV 452

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 57/109 (52%), Gaps = 8/109 (7%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D V+ P  S   I++ +  P+     +G+N TV  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGG----D 190

Query: 149 LSDSAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNEELKDLLD 193
             D  G+IP  +  LF  +     + +  + V  S++E+YNE + DLLD
Sbjct: 191 GGDDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLD 239

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 107/181 (59%), Gaps = 14/181 (7%)

Query: 313 DQSNGIYIQNLQEFHITNAMEG-LKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           D  +   + NL  +H    +E  + L+ +G  +R  + T  N+ SSRSH +  + + +  
Sbjct: 239 DSDSTTTVANLS-YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSS 297

Query: 372 ------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV-- 423
                 +D+++  + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL   
Sbjct: 298 RTVDLKEDKMY--ATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMT 355

Query: 424 --DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 481
                 H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+IK 
Sbjct: 356 GRRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKT 415

Query: 482 K 482
           K
Sbjct: 416 K 416

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 10/109 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  DK+F   ASQ  +F     PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 126 QKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISG------ 179

Query: 147 GELSDSAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNEELKDLLD 193
               DS GII   + +LF  +   ++   + +  S++E+YNE ++DLL+
Sbjct: 180 --TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLE 226

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  109 bits (273), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 78/196 (39%), Positives = 102/196 (52%), Gaps = 23/196 (11%)

Query: 304 GQRNSLAP------NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSS 357
           G R+S  P       D   G+ I  L E    ++ E LK ++ G K R+   T  N  SS
Sbjct: 242 GTRSSKTPVELKLREDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSS 301

Query: 358 RSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLG 416
           RSH I  I L K    E   +S  ++L DLAGSE   ++   N+R KE   IN+SLL LG
Sbjct: 302 RSHAIVMIRLTKTDLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALG 358

Query: 417 RVINALVDKS-------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 463
            VI+ L  +S             GHIP+R+SKLTR+LQ +L GN     I TI      S
Sbjct: 359 TVISKLSAESTSHRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDAS 418

Query: 464 EETCSTLEYASKAKNI 479
            ET +TL +AS+AKN+
Sbjct: 419 SETLNTLRFASRAKNV 434

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 71/143 (49%), Gaps = 15/143 (10%)

Query: 56  SVVVNV-PDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQ 114
           SVV+ + P+  G +E+      D       +   +  D VF    +   ++ + + P+  
Sbjct: 90  SVVIRLKPN--GGRELDPWFVRDEHTMQHADYGEFKYDHVFKTACNNVEVYAQTSKPMID 147

Query: 115 DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTL--ELQQN 172
              +G N TV  YGMT +GKT+TM G E        ++ G+IP  +  L+  +  E  Q 
Sbjct: 148 RVFEGLNATVFAYGMTGSGKTFTMAGTE--------ETLGLIPLSVAYLYSRVMEESLQG 199

Query: 173 D--YVVKCSFIELYNEELKDLLD 193
           D  + +  S++E+YNE++ DLLD
Sbjct: 200 DSRFEIAVSYLEIYNEKIYDLLD 222

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 90/150 (60%), Gaps = 8/150 (5%)

Query: 337 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENIN 393
           +L++  K R  AST  N+ SSRSH+IF I L   +    +E + I  +NLVDLAGSE IN
Sbjct: 548 ILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGEESYGI--LNLVDLAGSERIN 605

Query: 394 RSGALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKT 450
            S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL GN+KT
Sbjct: 606 SSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKT 665

Query: 451 ALIATISPAKVTSEETCSTLEYASKAKNIK 480
            +   ISP+     ET ++L +ASK  + K
Sbjct: 666 LMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 79/179 (44%), Gaps = 31/179 (17%)

Query: 29  TVHNE--ELNITVAVRCRGRNE-REISMKSSVVVNVPDITGS---------KEISINTTG 76
           ++HNE  EL   + V CR R     I  K +  + V D             K I +N   
Sbjct: 337 SLHNELQELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQSMEVMKGIEVNNNN 396

Query: 77  DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTY 136
            T I      +R+  DK+F    +   +F EV   L Q  + GYN  +  YG T +GKTY
Sbjct: 397 ATQI-----PQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTY 450

Query: 137 TMTGDEKLYNGELSDSAGIIPRVLLKLFD---TLELQQNDYVVKCSFIELYNEELKDLL 192
           TM          L    GIIP  +  +F+    L+ +   Y + C F+E+YNE + DLL
Sbjct: 451 TM----------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLL 499

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 89/150 (59%), Gaps = 8/150 (5%)

Query: 337 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENIN 393
           L++K  K R  A+T  N+ SSRSH+IF I L   +    +  + I  +NLVDLAGSE +N
Sbjct: 539 LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGESSYGI--LNLVDLAGSERLN 596

Query: 394 RSGALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKT 450
            S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL GN+KT
Sbjct: 597 SSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKT 656

Query: 451 ALIATISPAKVTSEETCSTLEYASKAKNIK 480
            +   ISP +   +ET ++L +ASK    K
Sbjct: 657 LMFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 14/109 (12%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  D++F        +FDE+   L Q  + GYN  +  YG T +GKT+TM        
Sbjct: 395 QKFQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM-------- 445

Query: 147 GELSDSAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 192
             L+ + G+IP  +  +F   D+L+ +  +Y V C F+E+YNE + DLL
Sbjct: 446 --LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLL 492

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 337 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 395
           +L+K  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 396 GALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTAL 452
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 453 IATISPAKVTSEETCSTLEYASKA 476
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 86/173 (49%), Gaps = 25/173 (14%)

Query: 29  TVHNE--ELNITVAVRCRGRNE-REISMKSSVVVNV---PDITGSKEISINTTGDTGITA 82
           T+HNE  EL   + V CR R   + +    + ++NV    D +G + + +    +T   A
Sbjct: 375 TLHNELQELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNT---A 431

Query: 83  QMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 142
           Q++   +  DK+F    +   +F EV   L Q  + GYN  +  YG T +GKT+TM    
Sbjct: 432 QVH--EFKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---- 484

Query: 143 KLYNGELSDSAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
                 L+   GIIP  +  +F+    L+ +  DY V C FIE+YNE + DLL
Sbjct: 485 ------LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  107 bits (267), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 13/155 (8%)

Query: 337 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENIN 393
           +L++  K R  AST  N+ SSRSH+IF I L   ++   ++ + I  +NLVDLAGSE IN
Sbjct: 603 ILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEKSYGI--LNLVDLAGSERIN 660

Query: 394 RSGALNQRAKEAGSINQSLLTLGRVINALVD--------KSGHIPFRESKLTRLLQDSLG 445
            S    +R +E  +IN+SL  LG VI+AL          K  HIPFR SKLT LLQ SL 
Sbjct: 661 SSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLI 720

Query: 446 GNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 480
           GN+KT +   ISP+     ET ++L +ASK  + K
Sbjct: 721 GNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 83/173 (47%), Gaps = 20/173 (11%)

Query: 29  TVHN--EELNITVAVRCRGRNE---REISMKSSVVVN-VPDITGSKEISINTTGDTGITA 82
           ++HN  +EL   + V CR R     +E +  S + V+   D  G++ + I    +   + 
Sbjct: 387 SLHNTLQELRGNIRVYCRIRPPILPQESNNTSHLKVSEFDDNNGTQTLEIQKALNNNSSN 446

Query: 83  QMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 142
                ++  DK+F    + D +F EV   L Q  + GYN  +  YG T +GKTYTM    
Sbjct: 447 NSTTLKFKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---- 501

Query: 143 KLYNGELSDSAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 192
                 L    GIIP  +  +F   + L+ +   Y ++C F+E+YNE + DLL
Sbjct: 502 ------LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLL 548

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 68/148 (45%), Positives = 87/148 (58%), Gaps = 4/148 (2%)

Query: 337 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLY-KKHQDELFRISKMNLVDLAGSENINRS 395
           LL+K  + R  AST  N+ SSRSH++F I L    H         +NLVDLAGSE IN S
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGILNLVDLAGSERINSS 625

Query: 396 GALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTAL 452
             L +R +E  +IN+SL  LG V++AL        HIPFR SKLT LLQ SL GN+KT +
Sbjct: 626 QVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTLM 685

Query: 453 IATISPAKVTSEETCSTLEYASKAKNIK 480
              IS  +    ET ++L +ASK  + K
Sbjct: 686 FVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 86/172 (50%), Gaps = 22/172 (12%)

Query: 29  TVHNE--ELNITVAVRCRGRNEREISMKSSVVVNV---PDITGSKEISINTTGDTGITAQ 83
           ++HNE  EL   + V CR R   +    ++  + V    D  G + + I  + +TG +  
Sbjct: 366 SLHNELQELRGNIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIP 425

Query: 84  MNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEK 143
            N   +  D++F    + + +F+E+   L Q  + GYN  +  YG T +GKTYTM     
Sbjct: 426 QN---FKFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----- 476

Query: 144 LYNGELSDSAGIIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNEELKDLL 192
                L+   GIIP  +  +F  +E L++   +Y + C FIE+YNE + DLL
Sbjct: 477 -----LNPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLL 523

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  106 bits (265), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 337 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 395
           +L+K  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINIS 636

Query: 396 GALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTAL 452
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 453 IATISPAKVTSEETCSTLEYASKA 476
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 86/175 (49%), Gaps = 29/175 (16%)

Query: 29  TVHNE--ELNITVAVRCRGRNEREI--SMKSSVV-VN-VPDITGSKEISINTTGDTGITA 82
           T+HNE  EL   + V CR R   E   ++ +S++ VN   D  G + + +     T I +
Sbjct: 375 TLHNELQELRGNIRVYCRIRPPLETLENLDTSLIRVNEFDDNRGVQSMEV-----TKIQS 429

Query: 83  QMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTM--TG 140
                 +  DK+F    + + +F EV   L Q  + GYN  +  YG T +GKT+TM  TG
Sbjct: 430 TTQVHEFKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTG 488

Query: 141 DEKLYNGELSDSAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNEELKDLL 192
           D            GIIP  +  +F   + L+ +  DY V C FIE+YNE + DLL
Sbjct: 489 D------------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 128/248 (51%), Gaps = 36/248 (14%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D   G+ +  L E ++++  E +K +  G  +R+   T  N  SSRSH +  I ++   
Sbjct: 230 DDLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVF--C 287

Query: 372 QDELFR---ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS-- 426
            DE+     +S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  +S  
Sbjct: 288 TDEITGEQVMSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSG 344

Query: 427 -----GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK- 480
                GHIP+R+SKLTR+LQ +L G++  A I T+     TS E+ +T+ +AS+AKNI  
Sbjct: 345 LSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNISL 404

Query: 481 -----------NKPQLGAFIMKDILVKNITME---------LAKIKSDLLSTKSKEGIYM 520
                      +K QL   + K +  + IT++          + I SD    +  E + M
Sbjct: 405 AVKRNEADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDTSLLRENELLKM 464

Query: 521 NQDHYKNL 528
             +HY+ L
Sbjct: 465 KVEHYERL 472

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 62/107 (57%), Gaps = 10/107 (9%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF P  + D +++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 149 LSDSAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNEELKDLLD 193
                GIIP  +  +FD +   L +  + V+ S++E+YNE + DLL+
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLN 204

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 337 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 395
           +L+K  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 396 GALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTAL 452
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 453 IATISPAKVTSEETCSTLEYASKA 476
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 82/170 (48%), Gaps = 19/170 (11%)

Query: 29  TVHNE--ELNITVAVRCRGRNEREISMKS-SVVVNVPDITGSKEISINTTGDTGITAQMN 85
           T+HNE  EL   + V CR R   E    S + ++NV +   +  I          TAQ++
Sbjct: 375 TLHNELQELRGNIRVYCRIRPALETLEDSDTSLINVNEFDDNCGIQSMEVTKIHNTAQVH 434

Query: 86  AKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 145
              +  DK+F    +   +F EV   L Q  + GYN  +  YG T +GKT+TM       
Sbjct: 435 --EFKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM------- 484

Query: 146 NGELSDSAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
              L+   GIIP  +  +F+    L+ +  DY V C FIE+YNE + DLL
Sbjct: 485 ---LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 86/145 (59%), Gaps = 6/145 (4%)

Query: 337 LLQKGLKHRQVASTKMNDFSSRSHTIFTITL--YKKHQDELFRISKMNLVDLAGSENINR 394
           LL++  K R  A+T  N+ SSRSH++F I L  Y  +  E  +   +NLVDLAGSE IN 
Sbjct: 554 LLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQ-GTLNLVDLAGSERINA 612

Query: 395 SGALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTA 451
           S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT 
Sbjct: 613 SQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTL 672

Query: 452 LIATISPAKVTSEETCSTLEYASKA 476
           +   ISP      ET ++L +ASK 
Sbjct: 673 MFVNISPCLDHFNETLNSLRFASKV 697

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 78/178 (43%), Gaps = 41/178 (23%)

Query: 30  VHNE--ELNITVAVRCRGRNEREISMKSSVVVNVPDITG----SKEISINTTGDTGITAQ 83
           +HNE  EL   + V CR R               P + G    S  + IN   D   T  
Sbjct: 357 LHNELQELRGNIRVFCRIR---------------PLLQGEGSESCHVHINLFNDDEGTQS 401

Query: 84  MNAKR------YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYT 137
           MN  R      +  DK+F P  S D IF+E+   L Q  + GYN  +  YG T +GKTYT
Sbjct: 402 MNITRDSKKHEFKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYT 460

Query: 138 MTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 192
           M          L    G+IP  L  +F  + L +    +Y +   FIE+YNE + DLL
Sbjct: 461 M----------LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLL 508

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/149 (47%), Positives = 92/149 (61%), Gaps = 4/149 (2%)

Query: 336 KLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENINR 394
           +LL++  K R  AST  N+ SSRSH+IF + L  ++     R    +NLVDLAGSE IN 
Sbjct: 548 ELLKRANKLRSTASTACNERSSRSHSIFIVHLSGENVLTGERSHGILNLVDLAGSERINT 607

Query: 395 SGALNQRAKEAGSINQSLLTLGRVINAL--VDKSG-HIPFRESKLTRLLQDSLGGNTKTA 451
           S  + +R +E  SIN+SL  LG VI+AL   D S  HIPFR SKLT LLQ SL GN+KT 
Sbjct: 608 SQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTL 667

Query: 452 LIATISPAKVTSEETCSTLEYASKAKNIK 480
           +   IS     + ET ++L +ASK  + K
Sbjct: 668 MFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/172 (31%), Positives = 83/172 (48%), Gaps = 24/172 (13%)

Query: 29  TVHNE--ELNITVAVRCRGRNE--REISMKSSVVVN-VPDITGSKEISINTTGDTGITAQ 83
           T+HNE  EL   + V CR R    RE +  + + V    D  G++ I +   G  G   Q
Sbjct: 343 TLHNELQELRGNIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNG-YGSGPQ 401

Query: 84  MNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEK 143
           +    +  D++F    +   +F E+   L Q  + GYN  +  YG T +GKTYTM     
Sbjct: 402 I----FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----- 451

Query: 144 LYNGELSDSAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
                L+ + GIIP  +  +F+    L+ +   Y V C F+E+YNE + DLL
Sbjct: 452 -----LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 104/182 (57%), Gaps = 6/182 (3%)

Query: 304 GQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIF 363
            Q++ +  +  ++   I N+ +  +T+  +   +L++  + R  A T+ N+ SSRSH++F
Sbjct: 527 SQKHEIRHDHDNHATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVF 586

Query: 364 TITLYKKHQDELFRIS--KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 421
            + +   H D+   +S  K+NL+DLAGSE IN S     R +E  +IN+SL  LG VI A
Sbjct: 587 MVHI-NGHNDQTGEVSHGKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYA 645

Query: 422 LVDKSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 478
           L        HIPFR SKLT LLQ SL G++KT +   I   +  + ET ++L +ASK  +
Sbjct: 646 LNSPDAAKRHIPFRNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNS 705

Query: 479 IK 480
            K
Sbjct: 706 TK 707

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 77/169 (45%), Gaps = 20/169 (11%)

Query: 30  VHNE--ELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEI-SINTTGDTGITAQMNA 86
           +HNE  EL   + V CR R       + +   ++     SK   ++    + G     N 
Sbjct: 358 LHNELQELRGNIRVYCRIRPPLLAESQDTSHFHIEKFNESKGFQALTIKRENGRCFSYN- 416

Query: 87  KRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
             +  DK+F P  +   +F E+   L Q  + GYN  +  YG T +GKTYTM        
Sbjct: 417 --FHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM-------- 465

Query: 147 GELSDSAGIIPRVLLKLFDTLE-LQQND--YVVKCSFIELYNEELKDLL 192
             L+   G+IP  L  +F   E L ++   Y + C +IE+YNE + DLL
Sbjct: 466 --LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLL 512

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 105/183 (57%), Gaps = 8/183 (4%)

Query: 304 GQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIF 363
           G R+ +  +D S    ++NL+   +T+      +L+  +K R  AST  N+ SSRSH+IF
Sbjct: 490 GPRHKIHHDDASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIF 549

Query: 364 TITLYKKHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 420
            I ++  ++   +E  R   +NL+DLAGSE ++ S   ++R KE   IN+SL  LG V+N
Sbjct: 550 IIKIHGINEGLGEE--RNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMN 607

Query: 421 ALVDKSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 477
           +L        HI FR+SKLT LLQ SL GN+KT ++  IS +     ET  +L +A K  
Sbjct: 608 SLGSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVN 667

Query: 478 NIK 480
           + K
Sbjct: 668 STK 670

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 57/108 (52%), Gaps = 14/108 (12%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           +Y+ DKVF    +   IF EV S L Q  + G+N  +  YG T +GKT+TM         
Sbjct: 382 KYSFDKVFSQTDTNQEIFKEV-SELIQSSLDGFNVCIFAYGQTGSGKTFTM--------- 431

Query: 148 ELSDSAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEELKDLL 192
            L+   GIIP     +FD ++    +   Y V C F+E+YN+E+ DLL
Sbjct: 432 -LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLL 478

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 87/145 (60%), Gaps = 4/145 (2%)

Query: 336 KLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINR 394
           ++L++  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN 
Sbjct: 575 RVLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINI 634

Query: 395 SGALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTA 451
           S  +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT 
Sbjct: 635 SQVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTL 694

Query: 452 LIATISPAKVTSEETCSTLEYASKA 476
           +   ISP+     ET ++L +ASK 
Sbjct: 695 MFVNISPSSSHINETLNSLRFASKV 719

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 82/170 (48%), Gaps = 19/170 (11%)

Query: 29  TVHNE--ELNITVAVRCRGRNERE-ISMKSSVVVNVPDITGSKEISINTTGDTGITAQMN 85
           T+HNE  EL   + V CR R   E +    + ++NV +   ++   + +   T I     
Sbjct: 375 TLHNELQELRGNIRVYCRIRPPLESLENLDTSLINVNEFDDNR--GVQSMEVTKIQNTPQ 432

Query: 86  AKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 145
              +  DK+F    + + +F EV   L Q  + GYN  +  YG T +GKT+TM       
Sbjct: 433 VHEFKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM------- 484

Query: 146 NGELSDSAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNEELKDLL 192
              L+   GIIP  +  +F+    L+ +  DY V C FIE+YNE + DLL
Sbjct: 485 ---LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 112/228 (49%), Gaps = 36/228 (15%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D   G+ I  L E     + E +K ++ G  +R+ + T+ N  SSRSH +  + L   +
Sbjct: 261 DDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTHN 320

Query: 372 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS---- 426
             D     S + L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  +S    
Sbjct: 321 VIDGSKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNS 377

Query: 427 --------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEET 466
                                HIP+R+SKLTRLLQ +L GN+    I TI P   T  ET
Sbjct: 378 KHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAET 437

Query: 467 CSTLEYASKAKNI-------KNKPQLG-AFIMKDILVKNITMELAKIK 506
            +TL +AS+AKN+       KN   +  + + KD ++K +T  L K K
Sbjct: 438 INTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQK 485

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 60/115 (52%), Gaps = 9/115 (7%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           T   N   Y  D VF P      I+   A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 141 DEKLYNGELSDSAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEELKDLLD 193
           D +       +  GI+P  +  LF+ +   +ND  Y V  S++E+YNE++ DLLD
Sbjct: 185 DNE-------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLD 232

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 101/179 (56%), Gaps = 15/179 (8%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKK- 370
           +D + G+ +  L E    +  E L  ++ G KHR+ +ST  N  SSRSH I  I L    
Sbjct: 225 DDPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSD 284

Query: 371 -HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL---VDKS 426
               E+   S ++L DLAGSE   R  A ++R +E   IN+SLL LG VI+ L   V+ S
Sbjct: 285 LSSGEVV-TSTLSLCDLAGSE---RVTAQHERRQEGSFINKSLLALGTVISKLSAEVNNS 340

Query: 427 ------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 479
                  HIP+R+SKLTR+LQ +L GN+    I TI  +   + E+ +TL +AS+AKN+
Sbjct: 341 TESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           YT D VF P AS   ++     PL      G+N TV  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 149 LSDSAGIIPRVLL----KLFDTLELQQNDYVVKCSFIELYNEELKDLLD 193
           +  +AG+IP  +     K+FD+   +   Y    S++E+YNE++ DLL+
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLE 204

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 98/196 (50%), Gaps = 31/196 (15%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D   G+ +  L E    ++ E +  + KG K R+ A T  N  SSRSH I  I L    
Sbjct: 275 DDSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSD 334

Query: 372 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS---- 426
             +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  +S    
Sbjct: 335 MKDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNR 391

Query: 427 -----------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 463
                                  GHIP+R+SKLTRLLQ +L G++    I TI     +S
Sbjct: 392 SPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESS 451

Query: 464 EETCSTLEYASKAKNI 479
            ET +TL +AS+AKNI
Sbjct: 452 AETLNTLRFASRAKNI 467

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 75/161 (46%), Gaps = 27/161 (16%)

Query: 37  ITVAVRCRG-RNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           ITVA+R +   N  ++S  S +V      T  K I+ +  G+           +  D VF
Sbjct: 101 ITVAIRPKPTSNPSDVSTSSWLV------TDEKTIAHDDVGE-----------FKFDHVF 143

Query: 96  GPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGI 155
               S   I+  +  P+     +G+N T+  YGMT +GKTYTM G       E     G+
Sbjct: 144 NSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMG-----CPEREQKDGL 198

Query: 156 IPRVLLKLFDTLELQQND----YVVKCSFIELYNEELKDLL 192
           IP  +  LF  +  +  D    + +  S++E+YNE++ DLL
Sbjct: 199 IPLSVSYLFTKIMEETLDGDKKFEIVLSYLEIYNEKIYDLL 239

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 91/151 (60%), Gaps = 12/151 (7%)

Query: 337 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK------KHQDELFRISKMNLVDLAGSE 390
           +L+   K + +A+T  N+ SSRSH++FTI ++       +  D +     +NLVDLAGSE
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASDGV-----LNLVDLAGSE 595

Query: 391 NINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS-GHIPFRESKLTRLLQDSLGGNTK 449
            I+ S     R +E  +IN+SL  LG VI AL  K   HIPFR SKLT LLQ SL G++K
Sbjct: 596 RIDTSNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSK 655

Query: 450 TALIATISPAKVTSEETCSTLEYASKAKNIK 480
           T +   +SP+    +ET ++L +ASK  + K
Sbjct: 656 TLMFVNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 83/171 (48%), Gaps = 27/171 (15%)

Query: 30  VHNE--ELNITVAVRCRGRN--EREISMKSSV-VVNVPDITGSKEISINTTGDTGITAQM 84
           +HNE  EL   + V CR R   E E+   S + V N  +  GS+ I I+           
Sbjct: 348 LHNELQELRGNIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNEDRNS----- 402

Query: 85  NAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL 144
              R+  DKVF   AS   +F+EV   L Q  + GYN  +  YG T +GKTYTM      
Sbjct: 403 ---RFLFDKVFSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------ 452

Query: 145 YNGELSDSAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 192
               ++D  G+IP  L  +FD   L +    DY  +  FIE+YNE++ DLL
Sbjct: 453 ----MNDPDGVIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 101/174 (58%), Gaps = 6/174 (3%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITL--YK 369
           +++S   +I N+    +T+     ++L++ LK R  A+T  N  SSRSH++F I L  Y 
Sbjct: 525 DNESRTTHITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYN 584

Query: 370 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL--VDKSG 427
               E      +NLVDLAGSE I+      +R +E  +IN+SL  LG VI+AL   D S 
Sbjct: 585 TISGEK-STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASK 643

Query: 428 -HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 480
            HIPFR SKLT LLQ SL G++KT +   +SP   +  ET ++L +A+K  + K
Sbjct: 644 RHIPFRNSKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 83/170 (48%), Gaps = 25/170 (14%)

Query: 30  VHNE--ELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAK 87
           +HNE  EL   + V CR R   E    SS  + +   +       + TG   IT + ++K
Sbjct: 353 LHNELQELRGNIRVFCRLRPALENENYSSSSIEIEKFS-------DETGMQSITIKRDSK 405

Query: 88  --RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 145
             ++T D+ F    +   +F E+   L Q  + GYN  +  YG T +GKT+TM       
Sbjct: 406 QHKFTFDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM------- 457

Query: 146 NGELSDSAGIIPRVLLKLFDTLE-LQQNDYV--VKCSFIELYNEELKDLL 192
              L+ + GIIP  L  +F  +E L++  +V  +   F+E+YNE +KDL 
Sbjct: 458 ---LNPNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLF 504

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 95/178 (53%), Gaps = 13/178 (7%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITL-YKK 370
           +D   G+ +  L E  +  + + +K +  G  +R+   T  N  SSRSH I  I L    
Sbjct: 267 DDSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTD 326

Query: 371 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-------- 422
            +  L   S ++L DLAGSE   R+ A  +R KE   IN+SLL LG VI+ L        
Sbjct: 327 LKSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNM 383

Query: 423 -VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 479
            V    HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +AS+AKNI
Sbjct: 384 GVGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNI 441

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 61/108 (56%), Gaps = 11/108 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           ++ D VF P      +++E A P+ +   +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 149 LSDSAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEELKDLLD 193
            S+  G+IP  +  +F  +    L    + VK S++E+YNE++ DLL+
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLN 246

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 82/252 (32%), Positives = 129/252 (51%), Gaps = 28/252 (11%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D  +G+ +  L E  + ++ + LK +  G  +R+   T  N  SSRSH I T+ L    
Sbjct: 272 DDSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACT- 330

Query: 372 QDELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS- 426
             +L       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L   S 
Sbjct: 331 --DLVSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSM 385

Query: 427 --------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 478
                    HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +AS+AKN
Sbjct: 386 HTTPSFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKN 445

Query: 479 I-----KNKPQLGAFIMKDILVKNITMELAKIKSDLLSTK-SKEGIYMNQDHYKNLNSDL 532
           +     +N+ +L     KD L+ N+  +L + +  +   K ++E      D Y  L  + 
Sbjct: 446 VSMTVKRNEAELAH--EKDALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLYL-LRKES 502

Query: 533 ESYKNEVQECKR 544
           ++ K ++Q C+R
Sbjct: 503 DALKRKLQLCER 514

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 11/120 (9%)

Query: 77  DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTY 136
           D    A  +   +  D VF P ++   ++ ++  P+     +GYN  +  YGMT +GKT+
Sbjct: 127 DEQTIAHNDVGEFKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTF 186

Query: 137 TMTGDEKLYNGELSDSAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEELKDLLD 193
           TM+G          + AG+I   +  +F  +    L    + V  S++E+YNE++ DLL+
Sbjct: 187 TMSGT--------PEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLLN 238

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 107/381 (28%), Positives = 181/381 (47%), Gaps = 52/381 (13%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D   G+ I  L E    ++ E  + +Q G K+R+ + T  N  SSRSH I  + L    
Sbjct: 245 DDLKYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTD 304

Query: 372 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-------- 422
                 +S  ++L DLAGSE   ++ +  +R KE   IN+SLL LG VI+ L        
Sbjct: 305 LRSGETVSSTLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKN 361

Query: 423 ----------VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEY 472
                      + + HIP+R+SKLTR+LQ +L GN+    I TI      + ET +T+ +
Sbjct: 362 GPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRF 421

Query: 473 ASKAKN----IKNKPQL--GAFIMKDILVKNITMELAKIKSDLLSTKSKEGIY---MNQD 523
           AS+AKN    +  +P +  G++  KD  ++N+T +L K    ++  K +  +     N D
Sbjct: 422 ASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQRTSMTSSSHNDD 481

Query: 524 HYKNLNSDLESYKNEVQECK-REIESLTXXXXXXXXXXXXXXETIQSQNSQIESLKATID 582
              + NS L   +N V +CK    E L               +TI+ ++S+   + A ID
Sbjct: 482 STVDPNSTLLKAENRVLKCKLSNCEKL------------LDKDTIELEDSE---MVAIID 526

Query: 583 HLRTQLDKQHKTELEISGFNSKLQKLTEV---MQMALQDYKRRELDLNKKFETHITTEIK 639
            L   +D     E +  G  S+L++  E    ++  L ++ RRE    + F  H+ + I+
Sbjct: 527 ML--PIDVGSVLETKFQGLESQLRQYKEYTKQLEFKLMNFDRRENVSAEPFTAHVNSVIQ 584

Query: 640 NMKTTLFSQLSTLQQRNILQE 660
           +    +     +L++++ + E
Sbjct: 585 SKDVEILELRRSLERKDKMIE 605

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 64/113 (56%), Gaps = 14/113 (12%)

Query: 86  AKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 145
           A  +T D+VF    +   I++  + P+    ++G+N TV  YGMT +GKT+TMTG E   
Sbjct: 109 AGEFTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE--- 165

Query: 146 NGELSDSAGIIPRVLLKLFDTLELQQ-----NDYVVKCSFIELYNEELKDLLD 193
                D AG+IP  +  LF  + L+      + Y V  S++E+YNE++ DLLD
Sbjct: 166 -----DEAGLIPLSVTYLFSKI-LEHSMRGTSKYEVVVSYLEIYNEKIYDLLD 212

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/188 (34%), Positives = 101/188 (53%), Gaps = 23/188 (12%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D   GI +  L E   ++  + +K ++ G K+++++ T+ N  SSRSH+I  + L    
Sbjct: 243 DDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIATD 302

Query: 372 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS---- 426
            +  +   S ++L DLAGSE   ++ +  +R KE   IN+SLL LG VI  L  +S    
Sbjct: 303 LETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHR 359

Query: 427 ---------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 471
                           HIP+R+SKLTR+LQ +L GN+    I T+      S ET +TL 
Sbjct: 360 NADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTLR 419

Query: 472 YASKAKNI 479
           +AS+AKN+
Sbjct: 420 FASRAKNV 427

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 87/181 (48%), Gaps = 33/181 (18%)

Query: 17  ISKNGNSQIGCHTVHNEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTG 76
           I  N NS    H  +  +  I VA+R      + IS     V N+ D   +K I+ +  G
Sbjct: 58  IRNNPNSNQQTHEAYTGK--IIVAIR-----PKPISNNEKKVWNIVD---NKRIAHDDVG 107

Query: 77  DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTY 136
           +           + +D++F    S   I+ E+  PL      GYN T+  YGMT +GKT+
Sbjct: 108 E-----------FRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTF 156

Query: 137 TMTGDEKLYNGELSDSAGIIPRVLLKLFDTLE----LQQNDYVVKCSFIELYNEELKDLL 192
           TM+G +        +  G+IP  +  LF+T+     L +  Y +  S++E+YNE+L DLL
Sbjct: 157 TMSGTQ--------EDTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDLL 208

Query: 193 D 193
           D
Sbjct: 209 D 209

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 112/211 (53%), Gaps = 27/211 (12%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK-- 369
           +D   G+ + +L E  +++  + +K +  G ++R+   T  N  SSRSH I  + L +  
Sbjct: 269 DDSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYD 328

Query: 370 -KHQDELFRISKMNLVDLAGSENINRSGALNQ--RAKEAGSINQSLLTLGRVINALV--- 423
            K   E    S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L    
Sbjct: 329 LKTGSEA--TSTLSLCDLAGSER-----AVTQIVRRKEGAFINKSLLALGTVIAKLSMLG 381

Query: 424 ---------DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 474
                      +GHIP+R+SKLTR+LQ +L G++    I TI     +S ET +T+ +AS
Sbjct: 382 SQANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFAS 441

Query: 475 KAKNIK---NKPQLGAFIMKDILVKNITMEL 502
           +AKNI     K ++ +   KD +++N+  +L
Sbjct: 442 RAKNIALNVRKNEMDSHAEKDTIIQNLRKQL 472

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 67/132 (50%), Gaps = 12/132 (9%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF  G     ++  +  P+     +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 149 LSDSAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNEELKDLLDXXXXXXXXXGF 204
                G+IP+ +  +FD +  + +     Y VK S++E+YNE++ DLL+         G 
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLNYVDRQAGSTGQ 257

Query: 205 DGQFMKKLRIFD 216
             +    L+I D
Sbjct: 258 PSRNATGLKIRD 269

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 100/194 (51%), Gaps = 29/194 (14%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D   G+ +  L +     + E L  + KG K+R+ + T+ N  SSRSH I  I L  K 
Sbjct: 263 DDSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKD 322

Query: 372 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN---------- 420
            +     I  ++L DLAGSE   R    N+R KE   IN+SLL LG VI+          
Sbjct: 323 IRTGEQNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSH 379

Query: 421 ----------ALVDKSG-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 465
                     +L   +G     HIP+R+SKLTRLLQ +L G++    + TI  A  +S E
Sbjct: 380 HTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSE 439

Query: 466 TCSTLEYASKAKNI 479
           T +TL +AS++KN+
Sbjct: 440 TLNTLRFASRSKNV 453

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 68/134 (50%), Gaps = 23/134 (17%)

Query: 64  ITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCT 123
           I G K IS N  GD           +T D VF  G S   I+ +   PL    I+GYN T
Sbjct: 119 IHGDKVISHNDIGD-----------FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNAT 167

Query: 124 VLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQN----DYVVKCS 179
           +  YGMT +GKT+TM+G E        +  G+IP  +  LF +L  + N       V  S
Sbjct: 168 IFAYGMTGSGKTFTMSGTE--------EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVS 219

Query: 180 FIELYNEELKDLLD 193
           ++E+YNE++ DLLD
Sbjct: 220 YLEIYNEKINDLLD 233

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 67/188 (35%), Positives = 99/188 (52%), Gaps = 26/188 (13%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D  +G+ +  L E  + ++ + L+ ++ G  +R+   T  N  SSRSH I TI   K  
Sbjct: 269 DDARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTI---KVT 325

Query: 372 QDELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSG 427
             EL       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L   SG
Sbjct: 326 CTELLSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSG 382

Query: 428 ----------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 471
                           H+P+R+SKLTR+LQ +L G++    I TI        ET +T+ 
Sbjct: 383 ASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIR 442

Query: 472 YASKAKNI 479
           +AS+AKN+
Sbjct: 443 FASRAKNV 450

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 61/108 (56%), Gaps = 11/108 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DKVF P  +   +++E+  P+     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 149 LSDSAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEELKDLLD 193
             D AG+I   + ++F  +    +    Y V+ S++E+YNE++ DLL+
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN 239

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 99/200 (49%), Gaps = 35/200 (17%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D   G+ +  L E    ++ E L+ +  G K R++  T  N  SSRSH I  I L   +
Sbjct: 297 DDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTN 356

Query: 372 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDK---- 425
            ++   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  DK    
Sbjct: 357 VKNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSV 413

Query: 426 --------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPA 459
                                     S HIP+R+SKLTRLLQ +L G++    I T+   
Sbjct: 414 GSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 460 KVTSEETCSTLEYASKAKNI 479
              + ET +TL +AS+AKN+
Sbjct: 474 NDAAAETMNTLRFASRAKNV 493

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 61/109 (55%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   +++  + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDSAGIIPRVLLKLF-DTLELQQND---YVVKCSFIELYNEELKDLLD 193
           L    G+IP  +  LF + +E   N    + V  S++E+YNE + DLL+
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLE 263

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 110/215 (51%), Gaps = 31/215 (14%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK-- 369
           +D   G+ + +L E  + +  E +K +  G K+R+   T  N  SSRSH I  + L +  
Sbjct: 270 DDSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCE 329

Query: 370 -KHQDELFRISKMNLVDLAGSENINRSGALNQ--RAKEAGSINQSLLTLGRVINALVDK- 425
            K   E+   S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L    
Sbjct: 330 LKTGTEV--TSTLSLCDLAGSER-----AVTQLVRRKEGAFINKSLLALGTVIAKLSANS 382

Query: 426 ---------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 470
                           GHIP+R+SKLTR+LQ +L G++    I TI     ++ ET +T+
Sbjct: 383 AGSGSGSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTV 442

Query: 471 EYASKAKNIK---NKPQLGAFIMKDILVKNITMEL 502
            +AS+AKNI     K ++     KD +++N+  +L
Sbjct: 443 RFASRAKNISLNVRKNEMDTSNEKDSIIQNLRKQL 477

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 13/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   ++  +  P+     +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 149 LSDSAGIIPRVLLKLFD-----TLELQQNDYVVKCSFIELYNEELKDLL 192
                G+IP  +  +FD     T +  ++ Y VK S++E+YNE++ DLL
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLL 245

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 98/206 (47%), Gaps = 41/206 (19%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D   G+ +  L E    ++ + L+ +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297 DDSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTD 356

Query: 372 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDK---- 425
            +D   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  DK    
Sbjct: 357 VRDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSV 413

Query: 426 --------------------------------SGHIPFRESKLTRLLQDSLGGNTKTALI 453
                                           S HIP+R+SKLTRLLQ +L G++    I
Sbjct: 414 GSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTI 473

Query: 454 ATISPAKVTSEETCSTLEYASKAKNI 479
            T+      + ET +TL +AS+AKN+
Sbjct: 474 CTVDTRNDAAAETMNTLRFASRAKNV 499

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 62/109 (56%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   ++++ + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDSAGIIPRVLLKLF-DTLELQQND---YVVKCSFIELYNEELKDLLD 193
           L    G+IP  +  LF + +E   N    + V  S++E+YNE + DLL+
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLE 263

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 96/200 (48%), Gaps = 35/200 (17%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D   G+ +  L E    +  E L+ +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297 DDSKYGVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTD 356

Query: 372 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDK---- 425
             +   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  DK    
Sbjct: 357 VNNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSV 413

Query: 426 --------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPA 459
                                     S HIP+R+SKLTRLLQ +L G++    I T+   
Sbjct: 414 DSNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 460 KVTSEETCSTLEYASKAKNI 479
              + ET +TL +AS+AKN+
Sbjct: 474 NDAAAETMNTLRFASRAKNV 493

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   +++    P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDSAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNEELKDLLD 193
           L    G+IP  +  LF  +  Q  D    + V  S++E+YNE + DLL+
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLE 263

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 113/222 (50%), Gaps = 39/222 (17%)

Query: 306 RNSLAP-----------NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMND 354
           R+ LAP           + + + I I+NL+  ++T+ +E L   +KG   R +AS     
Sbjct: 166 RDLLAPLSEQKPLKLRLDSKKSSISIKNLRCVYVTSLLEALSYCEKG---RSLAS----- 217

Query: 355 FSSRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLL 413
             SRS  I  IT+ ++    E+F+     LVDL  S+ I++   L    +    INQS++
Sbjct: 218 --SRSSVIIRITVEQRDNVKEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMV 275

Query: 414 TLGRVINALVD----------KSG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKV 461
           TL  V  +L            +SG  +IP++ES LT+LLQ+++GGN KT L+   S AK 
Sbjct: 276 TLENVARSLAGTEQSVKNGRPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQ 335

Query: 462 TSEETCSTLEYASKAKNIK-----NKPQLGAFIMKDILVKNI 498
             EET +TL + +  K +K     NK    +  M D+L+K+ 
Sbjct: 336 DEEETLNTLNFGANMKLVKNLFQQNKAGTNSKAMLDLLMKDF 377

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 58/119 (48%), Gaps = 21/119 (17%)

Query: 82  AQMNAKRYTVDKVFGPGA-----SQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTY 136
           A  N K + VD++F PGA     +  +I D VA         GYN  ++ YG T +GKT 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVA-----QLFNGYNVAIMAYGQTDSGKTS 118

Query: 137 TMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 192
           TM G    YN       G+I  V  ++F T+E       DY +  S IE+  E ++DLL
Sbjct: 119 TMFG----YN----KGDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLL 169

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 93/184 (50%), Gaps = 19/184 (10%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D   G+ +  + E     A E +K +  G   R+   T  N  SSRSH I  + L   +
Sbjct: 237 DDPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTN 296

Query: 372 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS---- 426
             +     + ++L DLAGSE   ++    +R KE   IN+SLL LG VI+ L  +S    
Sbjct: 297 LLNGTTHFNTLSLCDLAGSE---KASEQLERRKEGSFINKSLLALGTVISKLSAESNAHD 353

Query: 427 -----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 475
                       HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +AS+
Sbjct: 354 SSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASR 413

Query: 476 AKNI 479
           AKN+
Sbjct: 414 AKNV 417

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 59/112 (52%), Gaps = 6/112 (5%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A  +   +  D VFGP A+ + +F E+   L +    G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG- 178

Query: 142 EKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD 193
              +N  +    G    V  ++ +  + +Q    V  S++E+YNE++ DLL+
Sbjct: 179 ---HNDGIVKMCGDC--VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLN 225

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 89/151 (58%), Gaps = 14/151 (9%)

Query: 335 LKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENIN 393
           L+L+ +G ++R+V ST+ N  SSRSH +  + +     D +   ++ + L DLAGSE   
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI----TDSMGSKARVLTLCDLAGSER-- 294

Query: 394 RSGALNQRA--KEAGSINQSLLTLG---RVINALVDKSGHIPFRESKLTRLLQDSLGGNT 448
              +++ R    E G+IN+SL+ LG   R++N     S H+P+R+SKLTRLL+ SL GN 
Sbjct: 295 --ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNG 352

Query: 449 KTALIATISPAKVTSEETCSTLEYASKAKNI 479
              ++ T+S +    E++  TL +A +A  +
Sbjct: 353 LVTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 51/117 (43%), Gaps = 31/117 (26%)

Query: 104 IFDEVASPLFQ----DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRV 159
           IF     PL      D I G   T++ YG T +GKTYTM G +           GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTKA--------EGGIVQ-- 168

Query: 160 LLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDXXXXXXXXXGFDGQFMKKLRIFD 216
            L + D L     +  +  S++E+YNE L DLL            DG   K+LRI D
Sbjct: 169 -LSIRDLLTQLSKNCQITISYLEIYNERLHDLL-----------CDG--TKELRILD 211

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 87/153 (56%), Gaps = 5/153 (3%)

Query: 328 ITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFT--ITLYKKHQDELFRISKMNLVD 385
           I  + +  +L++ G   R   ST MN+ SSRSH++F   IT + +   E     ++NLVD
Sbjct: 518 IAKSAQIRQLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQE-HSTGRLNLVD 576

Query: 386 LAGSENINRSGALNQRA--KEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDS 443
           LAGSE + +   +  +   KE  SIN+SL  L  VI+++  +  +IPFR SKLT LL++S
Sbjct: 577 LAGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNS 636

Query: 444 LGGNTKTALIATISPAKVTSEETCSTLEYASKA 476
           L   +KT +   ISP   +  ET ++L  A K 
Sbjct: 637 LINKSKTLMYVNISPNINSIRETINSLRLARKV 669

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (53%), Gaps = 16/114 (14%)

Query: 83  QMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 142
           Q++A  +T DK+FG       +FD++ + L Q  + GYN  +  YG T +GKTYTM    
Sbjct: 380 QLHA--FTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM---- 432

Query: 143 KLYNGELSDSAGIIPRV---LLKLFDTLELQQNDYVVKCSFIELYNEELKDLLD 193
                 L++  GII +    ++     L     +Y ++  FIE+YNE ++DLL+
Sbjct: 433 ------LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN 480

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/200 (33%), Positives = 96/200 (48%), Gaps = 35/200 (17%)

Query: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371
           +D   G+ +  L E    ++ E LK +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297 DDTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTD 356

Query: 372 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL----VDKS 426
            +    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L    ++ +
Sbjct: 357 LESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPT 413

Query: 427 GH----IP-----------------------FRESKLTRLLQDSLGGNTKTALIATISPA 459
           G      P                       +R+SKLTRLLQ +L G++    I T+   
Sbjct: 414 GSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 460 KVTSEETCSTLEYASKAKNI 479
              + ET +TL +AS+AKN+
Sbjct: 474 NDAAAETINTLRFASRAKNV 493

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 62/109 (56%), Gaps = 12/109 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   +++  + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDSAGIIPRVLLKLF-DTLELQQND---YVVKCSFIELYNEELKDLLD 193
           L    G+IP  +  LF + +EL  N    + V  S++E+YNE + DLL+
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLE 263

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 105/207 (50%), Gaps = 17/207 (8%)

Query: 316 NGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DE 374
           NG  ++NL+   +   +E LK+L       Q    + N+   RSHTI  +++ K+++ DE
Sbjct: 191 NGFQVENLRTTQVL-TLEELKILINICLLNQ--KERHNNLIQRSHTIMEVSIEKRNKLDE 247

Query: 375 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--DKSGHI--- 429
              +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN LV  ++ G I   
Sbjct: 248 SITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTD 307

Query: 430 --------PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 481
                   P++ S LTRLL D LGGN KT  + T S  K    ET STL++    K+   
Sbjct: 308 ISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANT 367

Query: 482 KPQLGAFIMKDILVKNITMELAKIKSD 508
            P++  F +      +I +   K+K D
Sbjct: 368 NPRINRFGLNSKATMDIFLTDMKLKED 394

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 74/135 (54%), Gaps = 25/135 (18%)

Query: 71  SINTTGDTGITA----QMNAKRYTVDKVFGPGASQDLIFD--EVASPLFQDFIKGYNCTV 124
           SIN T DT +T     Q+   +Y  DKVF   AS D   +  E      +  ++GYN ++
Sbjct: 52  SINFT-DTQLTGFSKDQVVNTQYKFDKVF---ASNDTGVEHQEFIESNLESLLQGYNTSI 107

Query: 125 LVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTL--ELQQND----YVVKC 178
           + YG + TGK++ + G+++          G+I ++L KLF+ +  E+  N+    Y VK 
Sbjct: 108 VTYGQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKF 158

Query: 179 SFIELYNEELKDLLD 193
           SF+E+Y E++ DL+D
Sbjct: 159 SFLEVYQEKMFDLMD 173

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 83/173 (47%), Gaps = 31/173 (17%)

Query: 30  VHNE--ELNITVAVRCRGR----NEREISMKSSVVVN-VPDITGSKEISINTTGDTGITA 82
           +HNE  EL   + V CR R    NE+E S  SS+ ++   D  G++ I+I          
Sbjct: 352 LHNELQELRGNIRVFCRLRPHLDNEKEDS--SSISIDGFSDENGTQCITIKR-------- 401

Query: 83  QMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 142
           +    ++T D+ FG   S   IF E+   L Q  + GYN  +  YG T +GKTYTM    
Sbjct: 402 EAKYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---- 456

Query: 143 KLYNGELSDSAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 192
                 L+   GIIP  L  +F  +E  +     Y +   FIE+YNE +KDL 
Sbjct: 457 ------LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLF 503

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 315 SNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITL 367
           S   +I N+    +TN      +L + +K R  A+T  N  SSRSH++F I L
Sbjct: 527 SQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 83/173 (47%), Gaps = 31/173 (17%)

Query: 30  VHNE--ELNITVAVRCRGR----NEREISMKSSVVVN-VPDITGSKEISINTTGDTGITA 82
           +HNE  EL   + V CR R    NE+E S  SS+ ++   D  G++ I+I          
Sbjct: 352 LHNELQELRGNIRVFCRLRPHLDNEKEDS--SSISIDGFSDENGTQCITIKR-------- 401

Query: 83  QMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 142
           +    ++T D+ FG   S   IF E+   L Q  + GYN  +  YG T +GKTYTM    
Sbjct: 402 EAKYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---- 456

Query: 143 KLYNGELSDSAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEELKDLL 192
                 L+   GIIP  L  +F  +E  +     Y +   FIE+YNE +KDL 
Sbjct: 457 ------LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLF 503

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 315 SNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITL 367
           S   +I N+    +TN      +L + +K R  A+T  N  SSRSH++F I L
Sbjct: 527 SQTTHITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 84/178 (47%), Gaps = 23/178 (12%)

Query: 23  SQIGCHTVHN-EELNITVAVRC---RGRNEREISMKSSVVVNVPDITGSKEISINTTGDT 78
           S +   T+ N E  +I V +R    +G    E + K+S   N      S     NTTGDT
Sbjct: 13  SSVPLPTIDNSEPCHIDVLLRAIPEKGLPNDESTFKASSSDNTVLFRTSNGPLQNTTGDT 72

Query: 79  GITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTM 138
             T Q        DKVF   A+Q  + D +  P   D + GYN T+L YG + +GK+Y++
Sbjct: 73  HSTFQF-------DKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSL 125

Query: 139 TGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQ----NDYVVKCSFIELYNEELKDLL 192
            G +        D  GI+P +   LF TLE ++    N++ V     E+Y E+  DLL
Sbjct: 126 IGPQ--------DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKTYDLL 175

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 76/139 (54%), Gaps = 17/139 (12%)

Query: 357 SRSHTIFTITLYKK-HQDELFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 413
           SRSH +F + + ++  + ++ + S + L+DL G+E  ++     L+Q + +   +NQS+ 
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKK--LNQSIE 291

Query: 414 TLGRVINAL---------VDKSGHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKVTS 463
            L   + +L           K+ H   +RES+LT +L+DSLGGN KT +I T   + V +
Sbjct: 292 ALKNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT 351

Query: 464 EETCSTLEYASKAKNIKNK 482
             T STL++    + I N+
Sbjct: 352 --TLSTLKFGDSIRQINNR 368

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 106/215 (49%), Gaps = 16/215 (7%)

Query: 317 GIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DEL 375
           G+ + NL++ H+ +  E L    + +    V ++K ++   R++TIF I + K  + DE 
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 376 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS--------- 426
              S + LVDLAGS+ I+R  +    +++   IN S+ ++  +I +L   S         
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 427 ---GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 483
                +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  +  ++ K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 484 QLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGI 518
           Q+  F + +    +I +E  K+K +    +  E +
Sbjct: 385 QINKFGLNENKTLSIALENFKLKENNFKIQQAESV 419

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 56/105 (53%), Gaps = 12/105 (11%)

Query: 94  VFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSA 153
           +F   ++ DLI + + + +  + ++GYN  ++ YG   +GKTY+      LY  ++ DS 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGNDVDDSF 142

Query: 154 GIIPRVLLKLFDTLELQQND------YVVKCSFIELYNEELKDLL 192
           G+   +   LF  +     D      ++VK SF+E++ +++ DLL
Sbjct: 143 GLGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL 187

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 19/128 (14%)

Query: 69  EISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYG 128
           E S  TTGDT  T       +  DKVF   A+Q+ + D +  P   D + GYN T++ YG
Sbjct: 62  EPSHETTGDTYST-------FKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYG 114

Query: 129 MTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELY 184
            + +GK+Y++ G ++   GE     GI+P +   LF+TL    E + N++ V     E++
Sbjct: 115 PSFSGKSYSLLGSQE---GE-----GILPNICKVLFETLEKNKETKGNNFSVSVLAFEIF 166

Query: 185 NEELKDLL 192
            E+  DLL
Sbjct: 167 MEKTYDLL 174

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 74/137 (54%), Gaps = 13/137 (9%)

Query: 357 SRSHTIFTITLYKKHQD-ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 415
           S+SH +F + + +++++ ++ R S + L+DL G+E  ++   +         +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 416 GRVINAL----------VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 465
             ++  L          V  S    +RES+LT +L+DSLGGN KT +I T   + V++  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 466 TCSTLEYASKAKNIKNK 482
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGECIRQITNK 367

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 58/108 (53%), Gaps = 12/108 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DKVF   A+Q+ +   +  P+  D + GYN TV+ YG + +GK+Y++ G +      
Sbjct: 75  FQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSK------ 128

Query: 149 LSDSAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNEELKDLL 192
             +S GI+P +   LFDTL    E + + + V     E+Y E+  DLL
Sbjct: 129 --ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLL 174

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 114/220 (51%), Gaps = 34/220 (15%)

Query: 357 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 413
           SRSH +F + + ++++ D++ + S + LVDL G+E  ++     L+Q A     +NQS+ 
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDA--LKKLNQSIE 290

Query: 414 TLGRVINALVDK----------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 463
            L   + +L  K          S    +RES+LT +L+DSLGGN KT +I T   + V +
Sbjct: 291 ALKNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT 350

Query: 464 EETCSTLEYASKAKNIKN-----------KPQLGAFIMKDILVK--NITMELAKIKSDLL 510
             T STLE+    + I N           K ++  FI +D+ +K  N   ++  +K+++ 
Sbjct: 351 --TLSTLEFGDSIRQINNKVTDNTTGLNLKKKMDLFI-QDMKIKDDNYVAQINILKAEID 407

Query: 511 STKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLT 550
           S KS     + +D  K +   LE+ K E  + K +++S+T
Sbjct: 408 SLKSLHNKSLPEDDEKKM---LENTKKENIKLKLQLDSIT 444

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 12/108 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DKVF   A+Q  + D + +P  +D + GYN T+L YG + +GK+Y++ G +  YN  
Sbjct: 75  FQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN-- 130

Query: 149 LSDSAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNEELKDLL 192
                G++P +   LF+TL    E +  ++ V     E+Y E+  DLL
Sbjct: 131 ----EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 114/220 (51%), Gaps = 34/220 (15%)

Query: 357 SRSHTIFTITLYKKHQDE-LFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 413
           S+SH +F + + ++++ E + + S + L+DL G+E   +     L+Q A +   +NQS+ 
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKK--LNQSIE 290

Query: 414 TLGRVINALV---------DKSGHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKVTS 463
            L  ++  L           K+ H   +RES+LT +L+DSLGGN K  +I T   + V +
Sbjct: 291 ALKNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT 350

Query: 464 EETCSTLEYASKAKNIKN-----------KPQLGAFIMKDILVK--NITMELAKIKSDLL 510
             T STLE+    + I N           K ++  F+ +D+ +K  N   ++  +KS+L 
Sbjct: 351 --TISTLEFGDNIRQIINKVMSSTTGLNMKKKMDLFV-QDMKIKDDNYVSQINILKSELD 407

Query: 511 STKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLT 550
           S K    +       +++ ++LE+Y+ E  + K +++S+T
Sbjct: 408 SLKD---LSNESSSREDMKTELENYEKENVKLKLQLDSIT 444

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 122/247 (49%), Gaps = 25/247 (10%)

Query: 316 NGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 375
           +G +I++L + H+T+ +E    L+ G K+     + ++   S+    F +    + +D++
Sbjct: 195 HGDHIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCIDR-KDDV 249

Query: 376 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDK----SGHIPF 431
            R S +  +DL GS+ + +  A    + +    NQ +  L  +I  L ++    S H  F
Sbjct: 250 TRCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--F 307

Query: 432 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ-----LG 486
           ++S L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P      L 
Sbjct: 308 KDSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKIGLN 364

Query: 487 AFIMKDILVKNITME----LAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQEC 542
           A    D+LV+++ ++    LAKI  +LL T+ K     N     + ++ LE+   E  + 
Sbjct: 365 AKRKMDLLVQDMNVKEQNYLAKI--NLLQTEIKTLKTENDSTTNSTSNSLENALQENSKL 422

Query: 543 KREIESL 549
           K ++ESL
Sbjct: 423 KLQLESL 429

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 8/105 (7%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           Y  D +F   + +   +D +   L  D  KGYN T++ YG TS+GK++ + GD    N  
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 149 LSDSAGIIPRVLL-KLFDTLELQQNDYVVKCSFIELYNEELKDLL 192
           L +   I  R+L  +  D L+      +   S  ELY +++ DLL
Sbjct: 146 LINH--IADRLLFPQCEDNLK-----TLCSISMWELYIDKVYDLL 183

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 88/176 (50%), Gaps = 20/176 (11%)

Query: 309 LAPNDQSN--GIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTIT 366
           + PN + N   + I+NL++ ++ +  E    L +G  +R      M   +SRS+ +  I 
Sbjct: 226 IRPNFKKNNSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKIN 280

Query: 367 LYKKH-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDK 425
           L +   +D+L + S + L+D+A S+ I+++ +L   AKEA  +N  + +    IN L + 
Sbjct: 281 LEQVFLEDQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAE- 339

Query: 426 SGHIPFRE-----------SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 470
           +G  P+ +           S L  ++   +GGN KT  I+TISP      ET  TL
Sbjct: 340 TGTSPYDQQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 11/82 (13%)

Query: 65  TGSKEI-SINTTGDTGITAQMNAKRYTVDKVFGPGASQ-DLIFDEVASPLFQDFIKGYNC 122
           TG++ I +  TTG+T          + VDKVF     Q DL+  ++      +   G+N 
Sbjct: 35  TGTRIIFTSETTGNT---------EFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNS 85

Query: 123 TVLVYGMTSTGKTYTMTGDEKL 144
           +++ +G + TGK++TM G+  L
Sbjct: 86  SIIAFGQSGTGKSFTMFGNNSL 107

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query: 88  RYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  +KV+  G  Q  + +++      + + G+N +++ +G   +GKTYTM G++     
Sbjct: 67  KFRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH---- 122

Query: 148 ELSDSAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNEELKDLL 192
                 GI+ R+   +FD L    E   N+  +  +F EL+ E + DLL
Sbjct: 123 ----EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 94/196 (47%), Gaps = 16/196 (8%)

Query: 318 IYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DELF 376
           + ++ L+   + +  E L  + +G  H +   +  +   SRS     IT+ ++++ +E  
Sbjct: 187 LSVKGLRTVSVNSVYELLAYINEG--HLRRCHSDSHYRKSRSSAFLNITVEQRNKKEETL 244

Query: 377 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD--------KSGH 428
           + S + L+DLA S+ ++++   +    E  S N S+  L +V+  L +         S  
Sbjct: 245 KHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNLHQVVYGLSELESPSSKNHSSK 304

Query: 429 IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP----- 483
              R S+L + LQ ++GG++KT  +   S  K   E T  TL   S+ ++I N P     
Sbjct: 305 HTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTVITLSLGSRLRSIHNFPVQNKM 364

Query: 484 QLGAFIMKDILVKNIT 499
            L +  + D+ +KN++
Sbjct: 365 GLNSKALLDLRLKNMS 380

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 57/108 (52%), Gaps = 8/108 (7%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           + +++DKVF P ASQ  +   +  P+  +   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 147 GELSDSAGIIPRVLLKLFDTLELQQNDYV-VKCSFIELYNEELKDLLD 193
                S G++ R+L K+F  +   +   V    S +EL N+++ DLL+
Sbjct: 100 -----SQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLLN 142

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 90/190 (47%), Gaps = 23/190 (12%)

Query: 316 NGI----YIQNLQEFHITNAMEGLKLLQKGLK-HRQVASTKMNDFSSRSHTIFTITLYKK 370
           NGI    +++NL    I      L  LQK  K   Q +S  +N  +++     +I + K 
Sbjct: 198 NGIKGDKHVKNLSHIQIA----SLDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKI 253

Query: 371 H------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 424
           H      +D+L+++S ++ +DL G +   +   +     E   +N  + +   +I  L D
Sbjct: 254 HLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKD-IQLTNDEMKKLNTLMSSFQNLITTLSD 312

Query: 425 KSGHIPF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKVTSEETCSTLEYASKAKN 478
               +P+     ++S L ++LQD +GGN+KT  I    SP+ +  EE    L++A   K+
Sbjct: 313 PKS-LPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKS 371

Query: 479 IKNKPQLGAF 488
           IKN   +  F
Sbjct: 372 IKNPLIMNVF 381

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/82 (19%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 57  VVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDF 116
           VV+N+  +  +++ +     +   T +++++ +  D +F   + Q+   + +     +D 
Sbjct: 37  VVLNLSSLKANQQDAFICDSNDKNTLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDL 93

Query: 117 IKGYNCTVLVYGMTSTGKTYTM 138
             GYN + + YG +++GK+ T+
Sbjct: 94  FDGYNQSFITYGKSNSGKSDTL 115

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 69/134 (51%), Gaps = 13/134 (9%)

Query: 358 RSHTIFTITLYKKHQDE-LFRISKMNLVDLAGSE--------NINRSGALNQRAKEAGSI 408
           RS TI  I L +  +DE L   S +  VDLAGS+         I R  A ++  +   S+
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAA-SKYNRVMDSL 323

Query: 409 NQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCS 468
           N  + TL    +  ++KS    +R S LTR+L D L GN KT LI + S  K    ET S
Sbjct: 324 NSMVYTLANSESISINKS---IYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFS 380

Query: 469 TLEYASKAKNIKNK 482
           TL ++S A ++ N+
Sbjct: 381 TLGFSSYASSMSNQ 394

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 69/169 (40%), Gaps = 50/169 (29%)

Query: 70  ISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGM 129
           I++N++ + G     N  R+  DK+F P    D I   ++     D  KGYN T + YG 
Sbjct: 41  ITLNSSVNQGSLGGSNQYRF--DKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQ 98

Query: 130 TSTGKTYTMTGDEKLYNGELSD-------------------------------------- 151
           T TGKTYT+ G    +N   +D                                      
Sbjct: 99  TGTGKTYTLYG--TAFNDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSIL 156

Query: 152 ---SAGIIPRVLLKLFDTLELQQN-----DYVVKCSFIELYNEELKDLL 192
              + G+I +V   LF+ ++  +       ++V  SF+E+Y EE+ DLL
Sbjct: 157 QKKNYGLISKVGNDLFEMIDQIRAIRKGITFLVNISFVEVYKEEVYDLL 205

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 94/206 (45%), Gaps = 45/206 (21%)

Query: 314 QSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD 373
           ++N  YI +++EF        +KL+Q    +++ +  KM+   S SH +   ++     +
Sbjct: 210 EANNEYINSIKEFDRV-----MKLIQD---NKEASEKKMDSKRSTSHVVIRCSV-----E 256

Query: 374 ELFRI------SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD--K 425
           +L R+      S +   DL GS    +        +    +N S+  L  V+N+++   +
Sbjct: 257 QLDRVHGTITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQ 316

Query: 426 SGH------------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETC 467
             H                  +P+++S+LT L+Q++LGGN++T ++      K   EET 
Sbjct: 317 KNHLYIENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETI 376

Query: 468 STLEYASKAKNIKNKPQLGAFIMKDI 493
           +TL +  + +NI N      F+  D+
Sbjct: 377 ATLRFGVQLQNILN------FVRADV 396

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 53/108 (49%), Gaps = 12/108 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  +KV+  G     I   ++  + +D   GY+ +++ YG   +GK++T+ G+E      
Sbjct: 87  FNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE------ 140

Query: 149 LSDSAGIIPRVLLKLFDT---LELQQNDYV-VKCSFIELYNEELKDLL 192
             DS GII      +      LE  QN  V ++ S +E+  E++ D+L
Sbjct: 141 --DSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKVYDML 186

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 72  INTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTS 131
           + T  DT +  ++  + ++  KV    A++   F E+AS +  D + G NC V  YG   
Sbjct: 75  VQTVNDTVV--KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGL 132

Query: 132 TGKTYTMTGDEKLYNGELSDS---AGIIPRVLLKLFDTLELQQ-NDYVVKCSFIELYNEE 187
              +  M G +   + E  DS   +G++ +    +F+ ++    ++Y V  S  E+Y ++
Sbjct: 133 AADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDK 192

Query: 188 LKDLL 192
           + DLL
Sbjct: 193 VFDLL 197

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 8/91 (8%)

Query: 104 IFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKL 163
           +++ +   L  +  +GY+  V+ YG   TGK+    G +  Y G      G++   +  L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG------GVVLMFVQDL 128

Query: 164 FDTLELQQND--YVVKCSFIELYNEELKDLL 192
           +D ++   ND  + V  S IE++ E++ DLL
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 100/223 (44%), Gaps = 28/223 (12%)

Query: 314 QSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDF--SSRSHTIFTITLYKKH 371
           Q +  Y ++L    +T+  E +  +     +R   S    ++   S+SH I  I + +++
Sbjct: 174 QDDEYYFKDLHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITKINVEQRN 233

Query: 372 QDE-LFRISKMNLVDLAGSENINRSG--ALNQRAKEAGSINQSLLTLGRVINALVDKS-- 426
            +E + +   ++  DLA  + I++    +L   + E   +N    TL   I ++ + S  
Sbjct: 234 LNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIISMSELSEN 293

Query: 427 --GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK---- 480
               IP++ S LT+LL     GN KT +I T S  K    ET  TL+   K ++I     
Sbjct: 294 PNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLESISSNVH 353

Query: 481 -NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQ 522
            NK  L +    D++V+++              KSKE  YMN+
Sbjct: 354 MNKHALNSKKKLDLIVEDM--------------KSKEANYMNR 382

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 65/153 (42%), Gaps = 30/153 (19%)

Query: 340 KGLKHRQVAS-TKMNDF--------SSRSHTIFTITL--YKKHQDELFRISKMNLVDLAG 388
           KGLK   V+S  ++ D+        +S  HT   I+L     H+D  FR   +  VDL  
Sbjct: 166 KGLKEVFVSSRCELQDYLNAACDLQNSTFHTFVKISLQLVNCHEDS-FRKCCIEFVDLCA 224

Query: 389 SENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNT 448
            E++                 Q + +L  V++   D    I   +S+  +LL +S+GGN 
Sbjct: 225 QEDVL----------------QLVCSLVAVLSN--DNDKKIGKEKSQFCKLLSNSIGGNR 266

Query: 449 KTALIATISPAKVTSEETCSTLEYASKAKNIKN 481
           KT  I   S  +   + +  TLE+  K   + N
Sbjct: 267 KTTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

 Score = 35.4 bits (80), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 16/88 (18%)

Query: 111 PLFQDFI----KGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDT 166
           PL  D I    +G +C+++ YG ++TGKT+ +               GIIP  + +L+  
Sbjct: 67  PLVIDNINELTRGVDCSMVTYGQSATGKTHVL----------FDQVRGIIPLFIEQLYIY 116

Query: 167 LELQQN-DYVVKCSFIELYNE-ELKDLL 192
           LE Q +  Y +  S  E  ++ +++DLL
Sbjct: 117 LEAQSDLQYQIGLSVWEADSKGKIRDLL 144

>ABR218C Chr2 complement(812375..814498) [2124 bp, 707 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL060W
          Length = 707

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 9/69 (13%)

Query: 571 NSQIESLKATIDHLRTQLDKQHKTE----LEISGFNSKLQKLTEVMQMALQDYKRRELDL 626
           +SQ+++L+   +HL TQL  QH +     +EI   N   Q+     +MA++++ RR L L
Sbjct: 630 DSQLQNLRVFTEHL-TQLLDQHNSYKPKMVEIWTQNPSTQQF----EMAMENWNRRYLYL 684

Query: 627 NKKFETHIT 635
           N  +E H T
Sbjct: 685 NSMYEKHYT 693

>KNAG0C05040 Chr3 complement(969572..971335) [1764 bp, 587 aa] {ON}
           Anc_5.416 YDR358W
          Length = 587

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 45/83 (54%), Gaps = 7/83 (8%)

Query: 818 KWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAIS 877
           K +   DL+NE  +M+NE   +   T+ ++ + +  +     K I       EE  +  +
Sbjct: 241 KLKRKADLLNEMLNMSNESEIAENGTIEELYAALKGAQPKFQKII-------EEEHDDDT 293

Query: 878 LLKNNIKFNDQFKQLINKHTILK 900
           L+++ +KFND   QL+NK+++LK
Sbjct: 294 LIQDLLKFNDTVNQLLNKYSLLK 316

>ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} similar
           to uniprot|Q756L3 Ashbya gossypii AER241W AER241Wp and
           weakly similar to uniprot|P32380 Saccharomyces
           cerevisiae YDR356W SPC110 Inner plaque spindle pole body
           (SPB) component
          Length = 835

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 62/302 (20%), Positives = 121/302 (40%), Gaps = 40/302 (13%)

Query: 527 NLNSDLESYKNEVQECKREIESLTXXXXXXXXXXXXXXETIQSQNSQIESLKATIDHLRT 586
           NLN  + + + E  E K + +                 + +Q+  +Q+E  + T   L+T
Sbjct: 402 NLNQRISALRKECDEWKSKYQRNESLDSNHRKAFDSLRQELQTTKTQLEETRKTAQQLQT 461

Query: 587 QL-----DKQHKTELEISGFNSKLQKLTEVMQMA---LQDYKRRELDLNKKFETHITTEI 638
           Q+         +T   I    +++QKL   +Q     L+D  RR           +  E 
Sbjct: 462 QVIENTTKNSERTSQRIKDKETQIQKLESELQFCKQQLKDGSRR-----------LQAEE 510

Query: 639 KNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILN 698
           +  + T  S+L  L+ +N  + T ++  + ++K E + L+ET   + EL    C    LN
Sbjct: 511 ERCRETFESELQNLEMKNGFERTKLEREITLLKEERVALIETHDRELELWKSKC--DALN 568

Query: 699 -ESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLS 757
            E+       +  +D +     +    + E L+    E  +L +              L 
Sbjct: 569 KENDILVRQEIGDLDGVKRKLSQQLDKLQEKLTTAEGERGDLAEKLIK----------LQ 618

Query: 758 HHVDSTYE-------KIEKKTNQFVENFKKALNDHLEENKKLIMK-NLTTTTSAVIDQEM 809
           H  DS  +       K+E  + +++++ + A+ND  ++ K   MK  L     ++ D+ +
Sbjct: 619 HSKDSYKDELKRVSSKLEYLSKEYLKSKQSAINDDEQKTKYNTMKQRLLVELKSLQDENL 678

Query: 810 SL 811
           SL
Sbjct: 679 SL 680

>NDAI0B05540 Chr2 (1355086..1356843) [1758 bp, 585 aa] {ON}
           Anc_5.416 YDR358W
          Length = 585

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 41/73 (56%), Gaps = 11/73 (15%)

Query: 835 EFYNSMATTLSQIKSTVDTSSNSMNKSISVMKGQ-------VEESENAISLLKNNIKFND 887
           + +N M +T     ++ D S+ ++ +  S +KG        +EE  +  +L+++ +KFND
Sbjct: 248 DLFNEMMST----SASPDVSNETIEELFSALKGAQPKFQKIIEEEHDDDALVQDLLKFND 303

Query: 888 QFKQLINKHTILK 900
              QL+ K+++LK
Sbjct: 304 TVNQLLEKYSLLK 316

>TPHA0A03150 Chr1 complement(690935..693820) [2886 bp, 961 aa] {ON}
           Anc_7.305 YDL190C
          Length = 961

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 41/96 (42%), Gaps = 16/96 (16%)

Query: 330 NAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLV---DL 386
           N ++ LKL  KG    +   T++ DF   + T F   +  KH   LF    +NL    D 
Sbjct: 453 NIIQSLKLSLKGFFSHKELQTEVFDFICGASTFFIRVIDPKH---LFPFEMINLPLIPDQ 509

Query: 387 AGSENINRSGALNQRAKEA----------GSINQSL 412
            G EN++ +  L +RA             G IN SL
Sbjct: 510 VGIENVDNAEYLRERAPVPFKYYPEFVIEGPINYSL 545

>TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {ON}
           Anc_5.267 YHR023W
          Length = 1915

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 711 IDIIGVDFERFYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTY 764
           +DI G  FE F KN  E    I+  N  L+Q+F NH F    +E L  ++D  Y
Sbjct: 480 LDIAG--FEIFQKNSFEQFC-INYTNEKLQQFFNNHMFILEQKEYLKENIDWDY 530

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 18/135 (13%)

Query: 325 EFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI------ 378
           E  I +A+E   LL    K+  V S  +N     S T   + L +  Q   F        
Sbjct: 367 EIDIDDAIE---LLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSD 423

Query: 379 ---SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDKSGHI--PFR 432
              S+  +VD+ G++++ +S  +  +  E   +N SLLTLG+ IN L +D+   +  P  
Sbjct: 424 KTNSEFTIVDMNGTQHLGKSQNVMPKTTE---LNSSLLTLGKSINNLNLDEMPIVISPLA 480

Query: 433 ESKLTRLLQDSLGGN 447
           E  + R L++S  GN
Sbjct: 481 EFLIRRALKNSRLGN 495

>Kwal_23.4187 s23 (607525..611301) [3777 bp, 1258 aa] {ON} YLR398C
           (SKI2) - antiviral protein, putative helicase [contig 1]
           FULL
          Length = 1258

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 65/145 (44%), Gaps = 22/145 (15%)

Query: 667 LDIIKNEVLTLMET---MQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYK 723
           L+ I NEV  L E     Q++ E++ K     ILN  PK  NA ++ +  IG+DF R  +
Sbjct: 217 LNQIDNEVENLQEISEKRQQEDEVLEKQASDLILNNGPKESNAAIDDLLPIGIDFGRTIR 276

Query: 724 NIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKI--EKKTNQF-VENFKK 780
              ++L          K++         H   L+H +D+  E +    +T  F ++ F+K
Sbjct: 277 KTKDDLGR--------KEW--------AHVVDLNHRIDNFDELVPNPARTWPFELDVFQK 320

Query: 781 ALNDHLEENKKLIMKNLTTTTSAVI 805
               HLE+   + +   T+    V+
Sbjct: 321 EAVYHLEQGDSVFVAAHTSAGKTVV 345

>Ecym_4691 Chr4 (1353076..1355187) [2112 bp, 703 aa] {ON} similar to
           Ashbya gossypii ABR218C
          Length = 703

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 5/82 (6%)

Query: 573 QIESLKATIDHLRTQLDKQHKTELEISGFNSKLQK-LTEVMQMALQDYKRRELDLNKKFE 631
           Q+ +LK   D L   +DK +  + ++   ++ L    T++ +MA+ ++ RR L LNK FE
Sbjct: 625 QLYNLKVFTDQLSELIDKHNACKPKM--VSTWLHTGTTKMFEMAMDNWNRRYLYLNKMFE 682

Query: 632 THITTEIKNMKTTLFS-QLSTL 652
            H    + ++KT   S QL+TL
Sbjct: 683 KH-NMYLTSLKTACESVQLTTL 703

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 32.0 bits (71), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 135 TYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQ 170
           T T   D++ Y GE +D  GI P+  +K+ +T   Q
Sbjct: 33  TVTNVEDDEWYYGEYADKEGIFPKSFVKILETAPAQ 68

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 95,473,454
Number of extensions: 4317308
Number of successful extensions: 24166
Number of sequences better than 10.0: 940
Number of HSP's gapped: 24752
Number of HSP's successfully gapped: 1370
Length of query: 1002
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 882
Effective length of database: 39,721,479
Effective search space: 35034344478
Effective search space used: 35034344478
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)